F459401

General Info

Members Datasets Scaffolds Average Seq Length
526 247 520 196

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10020157|Ga0157371_100201574
Length 215
Sequence MRAFQGESEMDVSEQTLHGAGERAKFREMAEGTQADWTIIGGHFREFAGGVGDRVLDHLKLLDGDFGGFPVCRLEHSLQTATRAWRDGRNERYTVMALLHDIGDTLGSFNHPDVAAAIVKPFVTEEEHWICQHHGFFQGYYYFHFLGMDREVRERFRDNPYFDSCAEFCAKYDQNSFDPDYKSEPLEFFVPMVHQVMARPLNSLYAKAAEEAAAA

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
6 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
172 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
222 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
223 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
224 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
225 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
230 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.19
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 3.04
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1019975 3300002155 Bacteria 852
2 JGI25165J46597_1000024 3300003214 Bacteria 335150
3 Ga0065712_10035725 3300005290 Bacteria 1265
4 Ga0065712_10076949 3300005290 Bacteria 3574
5 Ga0065715_10001024 3300005293 Bacteria 13467
6 Ga0065715_10257666 3300005293 Bacteria 1147
7 Ga0070658_10024360 3300005327 Bacteria 4855
8 Ga0070676_10008097 3300005328 Bacteria 5652
9 Ga0070676_10074458 3300005328 Bacteria 2045
10 Ga0070676_10101230 3300005328 Bacteria 1780
11 Ga0070683_100655306 3300005329 Bacteria 1005
12 Ga0070690_100692486 3300005330 Bacteria 782
13 Ga0070670_100017298 3300005331 Bacteria 6183
14 Ga0070670_100034330 3300005331 Bacteria 4365
15 Ga0070670_100069999 3300005331 Bacteria 3012
16 Ga0070677_10000691 3300005333 Bacteria 11299
17 Ga0070677_10045297 3300005333 Bacteria 1754
18 Ga0068869_100751341 3300005334 Bacteria 835
19 Ga0070666_10196288 3300005335 Bacteria 1419
20 Ga0068868_100186826 3300005338 Bacteria 1722
21 Ga0070660_100286365 3300005339 Bacteria 1349
22 Ga0070687_100193496 3300005343 Bacteria 1227
23 Ga0070661_100001212 3300005344 Bacteria 18170
24 Ga0070661_100003654 3300005344 Bacteria 10594
25 Ga0070661_100067981 3300005344 Bacteria 2619
26 Ga0070661_100264230 3300005344 Bacteria 1331
27 Ga0070668_100003621 3300005347 Bacteria 11397
28 Ga0070668_100200816 3300005347 Bacteria 1637
29 Ga0070668_100419240 3300005347 Bacteria 1146
30 Ga0070669_100004953 3300005353 Bacteria 9614
31 Ga0070669_100057781 3300005353 Bacteria 2847
32 Ga0070669_100083349 3300005353 Bacteria 2384
33 Ga0070669_100233832 3300005353 Bacteria 1458
34 Ga0070675_100000992 3300005354 Bacteria 20329
35 Ga0070675_100010526 3300005354 Bacteria 7224
36 Ga0070671_100000322 3300005355 Bacteria 32627
37 Ga0070671_100024294 3300005355 Bacteria 4961
38 Ga0070671_100084895 3300005355 Bacteria 2648
39 Ga0070671_100453778 3300005355 Bacteria 1100
40 Ga0070674_100004965 3300005356 Bacteria 7623
41 Ga0070673_100005410 3300005364 Bacteria 8169
42 Ga0070673_100006584 3300005364 Bacteria 7560
43 Ga0070659_100152362 3300005366 Bacteria 1887
44 Ga0070667_100118523 3300005367 Bacteria 2301
45 Ga0070701_10157020 3300005438 Bacteria 1315
46 Ga0070708_100448121 3300005445 Bacteria 1218
47 Ga0070663_100015036 3300005455 Bacteria 4981
48 Ga0070663_100133861 3300005455 Bacteria 1885
49 Ga0070678_100090423 3300005456 Bacteria 2346
50 Ga0070678_100156383 3300005456 Bacteria 1842
51 Ga0070678_100864345 3300005456 Bacteria 825
52 Ga0070662_100001422 3300005457 Bacteria 14770
53 Ga0070662_100008026 3300005457 Bacteria 6869
54 Ga0070662_100009676 3300005457 Bacteria 6306
55 Ga0068867_100290495 3300005459 Bacteria 1344
56 Ga0068853_100018761 3300005539 Bacteria 5729
57 Ga0068853_100283467 3300005539 Bacteria 1528
58 Ga0070672_100001444 3300005543 Bacteria 14691
59 Ga0070672_100008841 3300005543 Bacteria 6917
60 Ga0070672_100523688 3300005543 Bacteria 1027
61 Ga0070672_100607900 3300005543 Bacteria 953
62 Ga0070672_100647445 3300005543 Bacteria 923
63 Ga0070686_100252770 3300005544 Bacteria 1288
64 Ga0070696_100039215 3300005546 Bacteria 3271
65 Ga0070665_100254478 3300005548 Bacteria 1757
66 Ga0068855_100139222 3300005563 Bacteria 2768
67 Ga0070664_100001079 3300005564 Bacteria 21478
68 Ga0070664_100025720 3300005564 Bacteria 4881
69 Ga0070664_100086640 3300005564 Bacteria 2706
70 Ga0070664_100102460 3300005564 Bacteria 2491
71 Ga0068857_100044488 3300005577 Bacteria 3938
72 Ga0068857_100310466 3300005577 Bacteria 1455
73 Ga0068854_100294814 3300005578 Bacteria 1310
74 Ga0068854_100447695 3300005578 Bacteria 1078
75 Ga0068856_100086838 3300005614 Bacteria 3109
76 Ga0070702_100146077 3300005615 Bacteria 1512
77 Ga0070702_100585335 3300005615 Bacteria 834
78 Ga0068852_100009206 3300005616 Bacteria 7318
79 Ga0068852_100173893 3300005616 Bacteria 2020
80 Ga0068859_100007514 3300005617 Bacteria 11062
81 Ga0068864_100012110 3300005618 Bacteria 7126
82 Ga0068864_100108897 3300005618 Bacteria 2466
83 Ga0068864_100585143 3300005618 Bacteria 1082
84 Ga0068870_10379397 3300005840 Bacteria 915
85 Ga0068858_100001536 3300005842 Bacteria 23689
86 Ga0068860_100085067 3300005843 Bacteria 3008
87 Ga0068860_100112597 3300005843 Bacteria 2602
88 Ga0068862_100133281 3300005844 Bacteria 2200
89 Ga0068862_100258529 3300005844 Bacteria 1589
90 Ga0068862_100281229 3300005844 Bacteria 1525
91 Ga0075430_100057076 3300006846 Bacteria 3284
92 Ga0075433_10527861 3300006852 Bacteria 1038
93 Ga0075429_100123114 3300006880 Bacteria 2267
94 Ga0068865_100473109 3300006881 Bacteria 1040
95 Ga0097620_100007514 3300006931 Bacteria 11062
96 Ga0105240_10000653 3300009093 Bacteria 63948
97 Ga0105240_10101199 3300009093 Bacteria 3505
98 Ga0111539_10192943 3300009094 Bacteria 2376
99 Ga0105245_10002741 3300009098 Bacteria 15846
100 Ga0105247_10024614 3300009101 Bacteria 3629
101 Ga0105247_10122169 3300009101 Bacteria 1689
102 Ga0105247_10490113 3300009101 Bacteria 893
103 Ga0114129_10213877 3300009147 Bacteria 2605
104 Ga0105243_10043276 3300009148 Bacteria 3529
105 Ga0105243_10064461 3300009148 Bacteria 2940
106 Ga0105241_10015658 3300009174 Bacteria 5558
107 Ga0105241_10627133 3300009174 Bacteria 974
108 Ga0105242_10008803 3300009176 Bacteria 7744
109 Ga0105242_10408804 3300009176 Bacteria 1269
110 Ga0105248_10005849 3300009177 Bacteria 13518
111 Ga0105248_10075057 3300009177 Bacteria 3800
112 Ga0105248_10135344 3300009177 Bacteria 2779
113 Ga0105248_10749325 3300009177 Bacteria 1102
114 Ga0105237_10081675 3300009545 Bacteria 3223
115 Ga0105238_10026317 3300009551 Bacteria 5929
116 Ga0105238_10123379 3300009551 Bacteria 2570
117 Ga0105249_11263679 3300009553 Bacteria 810
118 Ga0105239_10001093 3300010375 Bacteria 37498
119 Ga0105239_10009490 3300010375 Bacteria 10958
120 Ga0105239_10159880 3300010375 Bacteria 2516
121 Ga0157371_10020157 3300013102 Bacteria 4908
122 Ga0157371_10550328 3300013102 Bacteria 855
123 Ga0157370_10502218 3300013104 Bacteria 1114
124 Ga0157369_10059690 3300013105 Bacteria 4113
125 Ga0157369_10222525 3300013105 Bacteria 1975
126 Ga0157374_10047798 3300013296 Bacteria 3969
127 Ga0157374_11639994 3300013296 Bacteria 667
128 Ga0157378_10055323 3300013297 Bacteria 3535
129 Ga0157378_10623788 3300013297 Bacteria 1091
130 Ga0157372_10068343 3300013307 Bacteria 3994
131 Ga0157372_10462296 3300013307 Bacteria 1479
132 Ga0157375_10018735 3300013308 Bacteria 6281
133 Ga0157375_10381947 3300013308 Bacteria 1575
134 Ga0163163_10105268 3300014325 Bacteria 2847
135 Ga0157380_10000690 3300014326 Bacteria 20983
136 Ga0157380_10021693 3300014326 Bacteria 4822
137 Ga0157380_10069049 3300014326 Bacteria 2850
138 Ga0182007_10175966 3300015262 Bacteria 738
139 Ga0163161_10002558 3300017792 Bacteria 12995
140 Ga0163161_10021074 3300017792 Bacteria 4581
141 Ga0163161_10030063 3300017792 Bacteria 3863
142 Ga0163161_11068508 3300017792 Bacteria 692
143 Ga0206351_10212233 3300020077 Bacteria 1683
144 Ga0209026_1004463 3300025250 Bacteria 4132
145 Ga0209233_1000084 3300025261 Bacteria 335222
146 Ga0209257_1010446 3300025304 Bacteria 4696
147 Ga0207697_10001871 3300025315 Bacteria 11243
148 Ga0207682_10000477 3300025893 Bacteria 18558
149 Ga0207710_10031456 3300025900 Bacteria 2320
150 Ga0207688_10007326 3300025901 Bacteria 6006
151 Ga0207688_10080008 3300025901 Bacteria 1865
152 Ga0207645_10039159 3300025907 Bacteria 3037
153 Ga0207645_10107054 3300025907 Bacteria 1808
154 Ga0207645_10126542 3300025907 Bacteria 1661
155 Ga0207705_10024405 3300025909 Bacteria 4315
156 Ga0207654_10112041 3300025911 Bacteria 1699
157 Ga0207695_10000012 3300025913 Bacteria 840961
158 Ga0207695_10051869 3300025913 Bacteria 4303
159 Ga0207671_10152637 3300025914 Bacteria 1785
160 Ga0207657_10383234 3300025919 Bacteria 1107
161 Ga0207649_10016187 3300025920 Bacteria 4200
162 Ga0207649_10060699 3300025920 Bacteria 2377
163 Ga0207681_10078897 3300025923 Bacteria 2318
164 Ga0207681_10122098 3300025923 Bacteria 1912
165 Ga0207681_10237849 3300025923 Bacteria 1416
166 Ga0207681_10505141 3300025923 Bacteria 990
167 Ga0207694_10000006 3300025924 Bacteria 631109
168 Ga0207694_10005329 3300025924 Bacteria 9909
169 Ga0207650_10003915 3300025925 Bacteria 10182
170 Ga0207650_10005126 3300025925 Bacteria 8942
171 Ga0207650_10154642 3300025925 Bacteria 1813
172 Ga0207650_10184241 3300025925 Bacteria 1665
173 Ga0207650_10573503 3300025925 Bacteria 947
174 Ga0207659_10008374 3300025926 Bacteria 6413
175 Ga0207687_10024054 3300025927 Bacteria 4065
176 Ga0207644_10048133 3300025931 Bacteria 3046
177 Ga0207644_10064022 3300025931 Bacteria 2671
178 Ga0207690_10221010 3300025932 Bacteria 1449
179 Ga0207706_10001535 3300025933 Bacteria 22912
180 Ga0207706_10008458 3300025933 Bacteria 9492
181 Ga0207706_10009810 3300025933 Bacteria 8785
182 Ga0207706_10011111 3300025933 Bacteria 8206
183 Ga0207706_10343537 3300025933 Bacteria 1298
184 Ga0207686_10079705 3300025934 Bacteria 2133
185 Ga0207669_10004786 3300025937 Bacteria 6005
186 Ga0207669_10386976 3300025937 Bacteria 1091
187 Ga0207704_11133060 3300025938 Bacteria 665
188 Ga0207691_10002244 3300025940 Bacteria 18938
189 Ga0207691_10003507 3300025940 Bacteria 15267
190 Ga0207691_10502640 3300025940 Bacteria 1029
191 Ga0207691_10769288 3300025940 Bacteria 810
192 Ga0207711_10215624 3300025941 Bacteria 1754
193 Ga0207711_10435928 3300025941 Bacteria 1219
194 Ga0207711_10694442 3300025941 Bacteria 949
195 Ga0207661_10120409 3300025944 Bacteria 2234
196 Ga0207679_10004630 3300025945 Bacteria 8562
197 Ga0207679_10078249 3300025945 Bacteria 2519
198 Ga0207679_10168576 3300025945 Bacteria 1800
199 Ga0207651_10002158 3300025960 Bacteria 9305
200 Ga0207651_10073680 3300025960 Bacteria 2429
201 Ga0207651_10108921 3300025960 Bacteria 2074
202 Ga0207712_10376116 3300025961 Bacteria 1187
203 Ga0207668_10094072 3300025972 Bacteria 2209
204 Ga0207668_10173214 3300025972 Bacteria 1694
205 Ga0207668_10193503 3300025972 Bacteria 1614
206 Ga0207668_10233220 3300025972 Bacteria 1485
207 Ga0207640_10108253 3300025981 Bacteria 1964
208 Ga0207658_10008134 3300025986 Bacteria 7144
209 Ga0207703_10001249 3300026035 Bacteria 23830
210 Ga0207639_10053549 3300026041 Bacteria 3080
211 Ga0207639_10073769 3300026041 Bacteria 2676
212 Ga0207639_10275156 3300026041 Bacteria 1478
213 Ga0207678_10074711 3300026067 Bacteria 2904
214 Ga0207641_10478246 3300026088 Bacteria 1207
215 Ga0207648_10009374 3300026089 Bacteria 9376
216 Ga0207648_10690473 3300026089 Bacteria 945
217 Ga0207676_10163822 3300026095 Bacteria 1930
218 Ga0207676_10232568 3300026095 Bacteria 1649
219 Ga0207676_10718368 3300026095 Bacteria 969
220 Ga0207676_11081308 3300026095 Bacteria 792
221 Ga0207674_10055851 3300026116 Bacteria 4012
222 Ga0207674_10073822 3300026116 Bacteria 3424
223 Ga0207674_10140507 3300026116 Bacteria 2374
224 Ga0207674_10643354 3300026116 Bacteria 1024
225 Ga0207675_100003165 3300026118 Bacteria 16155
226 Ga0207675_101272883 3300026118 Bacteria 756
227 Ga0207683_10007302 3300026121 Bacteria 9469
228 Ga0207683_10164425 3300026121 Bacteria 2007
229 Ga0207698_10031145 3300026142 Bacteria 3847
230 Ga0207698_10350476 3300026142 Bacteria 1394
231 Ga0207698_11533827 3300026142 Bacteria 682
232 Ga0210000_1033232 3300027462 Bacteria 810
233 Ga0209982_1016428 3300027552 Bacteria 1125
234 Ga0209971_1022303 3300027682 Bacteria 1508
235 Ga0209974_10004340 3300027876 Bacteria 5042
236 Ga0209974_10014554 3300027876 Bacteria 2616
237 Ga0209974_10063607 3300027876 Bacteria 1251
238 Ga0207428_10042343 3300027907 Bacteria 3682
239 Ga0268266_10005862 3300028379 Bacteria 11370
240 Ga0268265_10004054 3300028380 Bacteria 10304
241 Ga0268265_10333595 3300028380 Bacteria 1378
242 Ga0268265_10858986 3300028380 Bacteria 888
243 Ga0268264_10039062 3300028381 Bacteria 3921
244 Ga0307515_10168338 3300028794 Bacteria 2198
245 Ga0316183_1184895 3300030742 Bacteria 2468
246 Ga0265320_10000628 3300031240 Bacteria 27016
247 Ga0265325_10018902 3300031241 Bacteria 3817
248 Ga0265340_10006825 3300031247 Bacteria 6247
249 Ga0265327_10010515 3300031251 Bacteria 6497
250 Ga0307513_10514417 3300031456 Bacteria 913
251 Ga0307509_10306509 3300031507 Bacteria 1333
252 Ga0307408_100006221 3300031548 Bacteria 7928
253 Ga0307408_100009738 3300031548 Bacteria 6332
254 Ga0307408_100046548 3300031548 Bacteria 3103
255 Ga0307408_100079484 3300031548 Bacteria 2447
256 Ga0307408_100095345 3300031548 Bacteria 2255
257 Ga0307408_100200096 3300031548 Bacteria 1616
258 Ga0307408_100211908 3300031548 Bacteria 1575
259 Ga0307408_100456293 3300031548 Bacteria 1110
260 Ga0307508_10003117 3300031616 Bacteria 16994
261 Ga0307508_10006626 3300031616 Bacteria 10875
262 Ga0265342_10107562 3300031712 Bacteria 1582
263 Ga0307516_10037891 3300031730 Bacteria 4816
264 Ga0307516_10176462 3300031730 Bacteria 1873
265 Ga0307405_10000247 3300031731 Bacteria 19718
266 Ga0307405_10042295 3300031731 Bacteria 2773
267 Ga0307405_10054680 3300031731 Bacteria 2494
268 Ga0307405_10091207 3300031731 Bacteria 2018
269 Ga0307405_10175126 3300031731 Bacteria 1534
270 Ga0307405_10207603 3300031731 Bacteria 1427
271 Ga0307405_10209360 3300031731 Bacteria 1422
272 Ga0307413_10001963 3300031824 Bacteria 8158
273 Ga0307413_10009570 3300031824 Bacteria 4645
274 Ga0307413_10012158 3300031824 Bacteria 4272
275 Ga0307413_10019353 3300031824 Bacteria 3595
276 Ga0307413_10035981 3300031824 Bacteria 2846
277 Ga0307413_10066251 3300031824 Bacteria 2253
278 Ga0307413_10090039 3300031824 Bacteria 1995
279 Ga0307413_10136686 3300031824 Bacteria 1686
280 Ga0307413_10161680 3300031824 Bacteria 1574
281 Ga0307413_10329491 3300031824 Bacteria 1170
282 Ga0307413_10358220 3300031824 Bacteria 1128
283 Ga0307413_10748598 3300031824 Bacteria 816
284 Ga0307410_10001143 3300031852 Bacteria 11654
285 Ga0307410_10004318 3300031852 Bacteria 7326
286 Ga0307410_10025584 3300031852 Bacteria 3705
287 Ga0307410_10029410 3300031852 Bacteria 3498
288 Ga0307410_10033202 3300031852 Bacteria 3330
289 Ga0307410_10052674 3300031852 Bacteria 2750
290 Ga0307410_10062528 3300031852 Bacteria 2551
291 Ga0307410_10119607 3300031852 Bacteria 1919
292 Ga0307410_10164495 3300031852 Bacteria 1666
293 Ga0307410_10169735 3300031852 Bacteria 1642
294 Ga0307410_10206773 3300031852 Bacteria 1502
295 Ga0307410_10507909 3300031852 Bacteria 993
296 Ga0307410_10553659 3300031852 Bacteria 953
297 Ga0307410_10880804 3300031852 Bacteria 766
298 Ga0307406_10042442 3300031901 Bacteria 2839
299 Ga0307406_10108843 3300031901 Bacteria 1903
300 Ga0307406_10386874 3300031901 Bacteria 1104
301 Ga0307406_10456557 3300031901 Bacteria 1026
302 Ga0307406_10511427 3300031901 Bacteria 975
303 Ga0307406_10612232 3300031901 Bacteria 899
304 Ga0307407_10017854 3300031903 Bacteria 3572
305 Ga0307407_10027565 3300031903 Bacteria 3025
306 Ga0307407_10046490 3300031903 Bacteria 2458
307 Ga0307407_10062610 3300031903 Bacteria 2179
308 Ga0307407_10063100 3300031903 Bacteria 2172
309 Ga0307407_10129677 3300031903 Bacteria 1611
310 Ga0307407_10136462 3300031903 Bacteria 1577
311 Ga0307407_10209063 3300031903 Bacteria 1313
312 Ga0307412_10009522 3300031911 Bacteria 5577
313 Ga0307412_10014517 3300031911 Bacteria 4646
314 Ga0307412_10016981 3300031911 Bacteria 4348
315 Ga0307412_10044420 3300031911 Bacteria 2899
316 Ga0307412_10048156 3300031911 Bacteria 2802
317 Ga0307412_10063317 3300031911 Bacteria 2494
318 Ga0307412_10065412 3300031911 Bacteria 2461
319 Ga0307412_10068749 3300031911 Bacteria 2409
320 Ga0307412_10180769 3300031911 Bacteria 1586
321 Ga0307412_10188840 3300031911 Bacteria 1556
322 Ga0307412_10189846 3300031911 Bacteria 1552
323 Ga0307412_10275103 3300031911 Bacteria 1319
324 Ga0307412_10885073 3300031911 Bacteria 781
325 Ga0307409_100014572 3300031995 Bacteria 5121
326 Ga0307409_100015178 3300031995 Bacteria 5043
327 Ga0307409_100021142 3300031995 Bacteria 4454
328 Ga0307409_100028708 3300031995 Bacteria 3968
329 Ga0307409_100039864 3300031995 Bacteria 3490
330 Ga0307409_100052842 3300031995 Bacteria 3118
331 Ga0307409_100064865 3300031995 Bacteria 2871
332 Ga0307409_100076740 3300031995 Bacteria 2681
333 Ga0307409_100133459 3300031995 Bacteria 2126
334 Ga0307409_100134996 3300031995 Bacteria 2115
335 Ga0307409_100148936 3300031995 Bacteria 2029
336 Ga0307409_100175144 3300031995 Bacteria 1892
337 Ga0307409_100240408 3300031995 Bacteria 1648
338 Ga0307409_100287290 3300031995 Bacteria 1523
339 Ga0307409_100302492 3300031995 Bacteria 1488
340 Ga0307409_100362470 3300031995 Bacteria 1371
341 Ga0307409_100615073 3300031995 Bacteria 1075
342 Ga0307409_100884428 3300031995 Bacteria 906
343 Ga0307409_101069062 3300031995 Bacteria 827
344 Ga0307409_101416135 3300031995 Bacteria 721
345 Ga0307416_100007245 3300032002 Bacteria 7029
346 Ga0307416_100021872 3300032002 Bacteria 4603
347 Ga0307416_100038548 3300032002 Bacteria 3688
348 Ga0307416_100059700 3300032002 Bacteria 3101
349 Ga0307416_100079182 3300032002 Bacteria 2768
350 Ga0307416_100094593 3300032002 Bacteria 2577
351 Ga0307416_100107300 3300032002 Bacteria 2450
352 Ga0307416_100126004 3300032002 Bacteria 2294
353 Ga0307416_100130315 3300032002 Bacteria 2262
354 Ga0307416_100163374 3300032002 Bacteria 2062
355 Ga0307416_100179908 3300032002 Bacteria 1980
356 Ga0307416_100296508 3300032002 Bacteria 1604
357 Ga0307416_100411602 3300032002 Bacteria 1393
358 Ga0307416_100456644 3300032002 Bacteria 1331
359 Ga0307416_100522192 3300032002 Bacteria 1256
360 Ga0307416_100545165 3300032002 Bacteria 1232
361 Ga0307416_100634661 3300032002 Bacteria 1151
362 Ga0307416_100646963 3300032002 Bacteria 1141
363 Ga0307414_10001335 3300032004 Bacteria 12766
364 Ga0307414_10004437 3300032004 Bacteria 7620
365 Ga0307414_10041290 3300032004 Bacteria 3123
366 Ga0307414_10047684 3300032004 Bacteria 2950
367 Ga0307414_10060798 3300032004 Bacteria 2673
368 Ga0307414_10065962 3300032004 Bacteria 2585
369 Ga0307414_10119832 3300032004 Bacteria 2021
370 Ga0307414_10137229 3300032004 Bacteria 1909
371 Ga0307414_10142115 3300032004 Bacteria 1881
372 Ga0307414_10180772 3300032004 Bacteria 1696
373 Ga0307414_10316478 3300032004 Bacteria 1326
374 Ga0307414_10619788 3300032004 Bacteria 972
375 Ga0307414_10737810 3300032004 Bacteria 894
376 Ga0307414_10790066 3300032004 Bacteria 865
377 Ga0307411_10003744 3300032005 Bacteria 7134
378 Ga0307411_10007409 3300032005 Bacteria 5588
379 Ga0307411_10010443 3300032005 Bacteria 4950
380 Ga0307411_10012029 3300032005 Bacteria 4701
381 Ga0307411_10043545 3300032005 Bacteria 2872
382 Ga0307411_10055125 3300032005 Bacteria 2614
383 Ga0307411_10061226 3300032005 Bacteria 2504
384 Ga0307411_10065792 3300032005 Bacteria 2432
385 Ga0307411_10067894 3300032005 Bacteria 2401
386 Ga0307411_10087957 3300032005 Bacteria 2159
387 Ga0307411_10106226 3300032005 Bacteria 1998
388 Ga0307411_10128814 3300032005 Bacteria 1846
389 Ga0307411_10138976 3300032005 Bacteria 1788
390 Ga0307411_10196063 3300032005 Bacteria 1546
391 Ga0307411_10207699 3300032005 Bacteria 1509
392 Ga0307411_10353836 3300032005 Bacteria 1198
393 Ga0307411_10397640 3300032005 Bacteria 1138
394 Ga0307411_10443740 3300032005 Bacteria 1084
395 Ga0307411_10640573 3300032005 Bacteria 919
396 Ga0307411_10909288 3300032005 Bacteria 782
397 Ga0307415_100013368 3300032126 Bacteria 4790
398 Ga0307415_100016425 3300032126 Bacteria 4412
399 Ga0307415_100046293 3300032126 Bacteria 2921
400 Ga0307415_100124818 3300032126 Bacteria 1938
401 Ga0307415_100151337 3300032126 Bacteria 1786
402 Ga0307415_100155130 3300032126 Bacteria 1767
403 Ga0307415_100215213 3300032126 Bacteria 1536
404 Ga0307415_100263179 3300032126 Bacteria 1408
405 Ga0307415_100424446 3300032126 Bacteria 1142
406 Ga0307415_100568043 3300032126 Bacteria 1004
407 Ga0307415_100569792 3300032126 Bacteria 1002
408 Ga0307415_100573988 3300032126 Bacteria 999
409 Ga0307415_100730309 3300032126 Bacteria 897
410 Ga0307510_10191581 3300033180 Bacteria 1592
411 Ga0316574_0317738 3300035398 Bacteria 989
412 Ga0373937_0059385 3300036401 Bacteria 3515
413 Ga0373925_0325807 3300037068 Bacteria 1244
414 Ga0395899_0088201 3300037312 Bacteria 2251
415 Ga0395900_0001678 3300037418 Bacteria 25788
416 Ga0395905_0000083 3300037471 Bacteria 158407
417 Ga0395905_0213011 3300037471 Bacteria 1810
418 Ga0395901_0003561 3300038443 Bacteria 15706
419 Ga0436363_0334646 3300039450 Bacteria 1908
420 Ga0451807_0236445 3300041486 Bacteria 2772
421 Ga0439433_0081133 3300041999 Bacteria 789
422 Ga0439445_0032580 3300042004 Bacteria 1359
423 Ga0439432_015789 3300042006 Bacteria 2546
424 Ga0439449_0207433 3300042007 Bacteria 734
425 Ga0450920_001945 3300042122 Bacteria 3478
426 Ga0450890_014574 3300042127 Bacteria 1031
427 Ga0439434_0085767 3300042435 Bacteria 1003
428 Ga0451577_0169287 3300042876 Bacteria 1969
429 Ga0451576_1337517 3300045051 Bacteria 746
430 Ga0495638_0002615 3300046460 Bacteria 14491
431 Ga0495580_0051652 3300046472 Bacteria 2906
432 Ga0495605_0292158 3300046474 Bacteria 691
433 Ga0495585_0021751 3300046492 Bacteria 3682
434 Ga0495585_0262353 3300046492 Bacteria 859
435 Ga0495663_0000869 3300046525 Bacteria 10194
436 Ga0495642_0069062 3300046528 Bacteria 1475
437 Ga0495642_0134000 3300046528 Bacteria 1067
438 Ga0495598_0014589 3300046537 Bacteria 1967
439 Ga0495598_0088142 3300046537 Bacteria 1007
440 Ga0495621_0000136 3300046539 Bacteria 15516
441 Ga0495621_0001522 3300046539 Bacteria 6026
442 Ga0495621_0124556 3300046539 Bacteria 998
443 Ga0495597_0192294 3300046542 Bacteria 820
444 Ga0495645_0134123 3300046543 Bacteria 1733
445 Ga0495622_0280586 3300046557 Bacteria 728
446 Ga0495633_0001812 3300046558 Bacteria 15737
447 Ga0495633_0034463 3300046558 Bacteria 2435
448 Ga0495668_0124920 3300046616 Bacteria 1408
449 Ga0495625_0000107 3300046660 Bacteria 125777
450 Ga0495659_0133049 3300046664 Bacteria 987
451 Ga0495669_0000459 3300046684 Bacteria 19113
452 Ga0495669_0052483 3300046684 Bacteria 1832
453 Ga0495669_0063634 3300046684 Bacteria 1673
454 Ga0495670_0000029 3300046691 Bacteria 87662
455 Ga0495670_0117890 3300046691 Bacteria 1377
456 Ga0495670_0289936 3300046691 Bacteria 876
457 Ga0495686_0046196 3300047472 Bacteria 2754
458 Ga0496101_0734539 3300048904 Bacteria 779
459 Ga0496106_0158908 3300048909 Bacteria 1787
460 Ga0496107_0229479 3300048910 Bacteria 1381
461 Ga0496108_0378957 3300048911 Bacteria 1235
462 Ga0496109_0143426 3300048912 Bacteria 2234
463 Ga0496109_0380548 3300048912 Bacteria 1333
464 Ga0496109_1030889 3300048912 Bacteria 760
465 Ga0496109_1284242 3300048912 Bacteria 668
466 Ga0496110_0002462 3300048913 Bacteria 13869
467 Ga0496110_0908590 3300048913 Bacteria 787
468 Ga0496111_0042436 3300048914 Bacteria 3266
469 Ga0496111_0497249 3300048914 Bacteria 898
470 Ga0496114_0063732 3300048917 Bacteria 3086
471 Ga0496115_0000991 3300048918 Bacteria 20577
472 Ga0496115_0118453 3300048918 Bacteria 2178
473 Ga0496121_0053327 3300048924 Bacteria 3389
474 Ga0496126_0035732 3300048929 Bacteria 4653
475 Ga0496126_0729980 3300048929 Bacteria 767
476 Ga0495682_0033142 3300049460 Bacteria 1907
477 Ga0501034_0238765 3300049571 Bacteria 1764
478 Ga0501036_0648910 3300049572 Bacteria 874
479 Ga0501038_0342231 3300049574 Bacteria 1166
480 Ga0501040_0067675 3300049576 Bacteria 2462
481 Ga0501047_0247501 3300049581 Bacteria 1632
482 Ga0501048_0762780 3300049582 Bacteria 695
483 Ga0501068_0213442 3300049584 Bacteria 1226
484 Ga0501071_0056384 3300049587 Bacteria 2838
485 Ga0501072_0034103 3300049588 Bacteria 3989
486 Ga0501076_0289729 3300049592 Bacteria 1341
487 Ga0501230_018815 3300049667 Bacteria 1184
488 Ga0501235_015074 3300049669 Bacteria 1704
489 Ga0501242_017594 3300049674 Bacteria 903
490 Ga0501247_011332 3300049677 Bacteria 1074
491 Ga0501247_029922 3300049677 Bacteria 740
492 Ga0501249_006477 3300049679 Bacteria 2407
493 Ga0501250_015213 3300049680 Bacteria 943
494 Ga0501257_012102 3300049686 Bacteria 1972
495 Ga0501221_009818 3300049704 Bacteria 1687
496 Ga0501221_121964 3300049704 Bacteria 667
497 Ga0501081_0101471 3300049743 Bacteria 2035
498 Ga0501268_001975 3300049765 Bacteria 2633
499 Ga0501270_010919 3300049767 Bacteria 1208
500 Ga0501273_016182 3300049770 Bacteria 974
501 Ga0501273_039594 3300049770 Bacteria 694
502 Ga0501045_0154730 3300049824 Bacteria 1706
503 Ga0501204_009975 3300049850 Bacteria 1106
504 nmdc:mga03n38_283976_c1 3300050490 Bacteria 884
505 nmdc:mga05p37_102382_c1 3300050507 Bacteria 3527
506 nmdc:mga09592_118377_c1 3300050508 Bacteria 2274
507 nmdc:mga06r32_103991_c1 3300050510 Bacteria 2789
508 nmdc:mga08y16_19611_c1 3300050511 Bacteria 7131
509 nmdc:mga0a205_360910_c1 3300050515 Bacteria 1319
510 Ga0500643_003600 3300053087 Bacteria 7363
511 Ga0500643_046586 3300053087 Bacteria 1251
512 Ga0500641_0001393 3300053096 Bacteria 8615
513 Ga0500641_0243871 3300053096 Bacteria 755
514 Ga0500562_096628 3300053108 Bacteria 803
515 Ga0500608_151868 3300053122 Bacteria 1014
516 Ga0500655_000936 3300053133 Bacteria 5648
517 Ga0500658_0007914 3300053134 Bacteria 3927
518 Ga0500559_0010957 3300053136 Bacteria 3883
519 Ga0500568_0013220 3300053139 Bacteria 3767
520 Ga0501082_0123905 3300060353 Bacteria 2241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_11133060 Ga0207704_111330601 173
2 3300032005 Ga0307411_10061226 Ga0307411_100612262 176
3 3300049576 Ga0501040_0067675 Ga0501040_0067675_33_608 179
4 3300049584 Ga0501068_0213442 Ga0501068_0213442_33_608 179
5 3300031911 Ga0307412_10180769 Ga0307412_101807692 180
6 3300032002 Ga0307416_100411602 Ga0307416_1004116022 181
7 3300010375 Ga0105239_10159880 Ga0105239_101598805 182
8 3300031730 Ga0307516_10176462 Ga0307516_101764623 182
9 3300046474 Ga0495605_0292158 Ga0495605_0292158_15_563 182
10 3300049677 Ga0501247_029922 Ga0501247_029922_164_718 182
11 3300005344 Ga0070661_100001212 Ga0070661_10000121216 183
12 3300032002 Ga0307416_100079182 Ga0307416_1000791822 183
13 3300053087 Ga0500643_003600 Ga0500643_003600_6434_7009 187
14 3300053087 Ga0500643_046586 Ga0500643_046586_356_931 187
15 3300025925 Ga0207650_10154642 Ga0207650_101546422 188
16 3300025933 Ga0207706_10009810 Ga0207706_100098101 188
17 3300025945 Ga0207679_10168576 Ga0207679_101685762 188
18 3300027876 Ga0209974_10014554 Ga0209974_100145542 188
19 3300005328 Ga0070676_10074458 Ga0070676_100744582 190
20 3300005353 Ga0070669_100083349 Ga0070669_1000833491 190
21 3300005844 Ga0068862_100281229 Ga0068862_1002812292 190
22 3300006846 Ga0075430_100057076 Ga0075430_1000570762 190
23 3300006880 Ga0075429_100123114 Ga0075429_1001231142 190
24 3300009094 Ga0111539_10192943 Ga0111539_101929432 190
25 3300009147 Ga0114129_10213877 Ga0114129_102138772 190
26 3300020077 Ga0206351_10212233 Ga0206351_102122332 190
27 3300025907 Ga0207645_10126542 Ga0207645_101265421 190
28 3300025923 Ga0207681_10122098 Ga0207681_101220981 190
29 3300025937 Ga0207669_10386976 Ga0207669_103869761 190
30 3300027907 Ga0207428_10042343 Ga0207428_100423433 190
31 3300049587 Ga0501071_0056384 Ga0501071_0056384_1258_1890 190
32 3300049588 Ga0501072_0034103 Ga0501072_0034103_449_1081 190
33 3300049592 Ga0501076_0289729 Ga0501076_0289729_382_1014 190
34 3300049743 Ga0501081_0101471 Ga0501081_0101471_748_1380 190
35 3300049824 Ga0501045_0154730 Ga0501045_0154730_513_1145 190
36 3300050507 nmdc:mga05p37_102382_c1 nmdc:mga05p37_102382_c1_1685_2269 190
37 3300050508 nmdc:mga09592_118377_c1 nmdc:mga09592_118377_c1_563_1147 190
38 3300050510 nmdc:mga06r32_103991_c1 nmdc:mga06r32_103991_c1_1259_1843 190
39 3300050511 nmdc:mga08y16_19611_c1 nmdc:mga08y16_19611_c1_5160_5744 190
40 iso_pu_bacteria 2643221598 2644000888 190
41 iso_pu_bacteria 2643221614 2644088612 190
42 iso_pu_bacteria 2643221661 2644343847 190
43 iso_pu_bacteria 2643221666 2644368674 190
44 3300005290 Ga0065712_10035725 Ga0065712_100357252 191
45 3300005293 Ga0065715_10001024 Ga0065715_1000102410 191
46 3300005328 Ga0070676_10008097 Ga0070676_100080973 191
47 3300005331 Ga0070670_100034330 Ga0070670_1000343303 191
48 3300005333 Ga0070677_10000691 Ga0070677_1000069112 191
49 3300005335 Ga0070666_10196288 Ga0070666_101962882 191
50 3300005343 Ga0070687_100193496 Ga0070687_1001934961 191
51 3300005344 Ga0070661_100264230 Ga0070661_1002642301 191
52 3300005347 Ga0070668_100003621 Ga0070668_1000036212 191
53 3300005353 Ga0070669_100004953 Ga0070669_1000049538 191
54 3300005354 Ga0070675_100000992 Ga0070675_1000009925 191
55 3300005355 Ga0070671_100024294 Ga0070671_1000242945 191
56 3300005356 Ga0070674_100004965 Ga0070674_1000049653 191
57 3300005364 Ga0070673_100006584 Ga0070673_1000065842 191
58 3300005438 Ga0070701_10157020 Ga0070701_101570202 191
59 3300005455 Ga0070663_100015036 Ga0070663_1000150363 191
60 3300005457 Ga0070662_100001422 Ga0070662_1000014228 191
61 3300005459 Ga0068867_100290495 Ga0068867_1002904952 191
62 3300005543 Ga0070672_100008841 Ga0070672_1000088414 191
63 3300005564 Ga0070664_100025720 Ga0070664_1000257203 191
64 3300005577 Ga0068857_100044488 Ga0068857_1000444882 191
65 3300005577 Ga0068857_100310466 Ga0068857_1003104662 191
66 3300005578 Ga0068854_100294814 Ga0068854_1002948142 191
67 3300005615 Ga0070702_100146077 Ga0070702_1001460772 191
68 3300005616 Ga0068852_100173893 Ga0068852_1001738932 191
69 3300005617 Ga0068859_100007514 Ga0068859_1000075143 191
70 3300005618 Ga0068864_100012110 Ga0068864_1000121105 191
71 3300005843 Ga0068860_100085067 Ga0068860_1000850672 191
72 3300005844 Ga0068862_100133281 Ga0068862_1001332812 191
73 3300006852 Ga0075433_10527861 Ga0075433_105278611 191
74 3300006931 Ga0097620_100007514 Ga0097620_1000075143 191
75 3300009148 Ga0105243_10043276 Ga0105243_100432762 191
76 3300009177 Ga0105248_10135344 Ga0105248_101353442 191
77 3300014326 Ga0157380_10000690 Ga0157380_1000069017 191
78 3300017792 Ga0163161_10002558 Ga0163161_100025588 191
79 3300025315 Ga0207697_10001871 Ga0207697_1000187112 191
80 3300025893 Ga0207682_10000477 Ga0207682_1000047712 191
81 3300025901 Ga0207688_10007326 Ga0207688_100073264 191
82 3300025907 Ga0207645_10039159 Ga0207645_100391593 191
83 3300025925 Ga0207650_10003915 Ga0207650_100039155 191
84 3300025925 Ga0207650_10573503 Ga0207650_105735032 191
85 3300025931 Ga0207644_10048133 Ga0207644_100481331 191
86 3300025933 Ga0207706_10001535 Ga0207706_1000153513 191
87 3300025937 Ga0207669_10004786 Ga0207669_100047868 191
88 3300025940 Ga0207691_10003507 Ga0207691_1000350715 191
89 3300025941 Ga0207711_10435928 Ga0207711_104359282 191
90 3300025960 Ga0207651_10002158 Ga0207651_100021583 191
91 3300025972 Ga0207668_10173214 Ga0207668_101732142 191
92 3300025981 Ga0207640_10108253 Ga0207640_101082532 191
93 3300026067 Ga0207678_10074711 Ga0207678_100747112 191
94 3300026089 Ga0207648_10009374 Ga0207648_100093744 191
95 3300026095 Ga0207676_10718368 Ga0207676_107183682 191
96 3300026116 Ga0207674_10055851 Ga0207674_100558512 191
97 3300026116 Ga0207674_10073822 Ga0207674_100738222 191
98 3300026116 Ga0207674_10643354 Ga0207674_106433542 191
99 3300026118 Ga0207675_100003165 Ga0207675_10000316514 191
100 3300026121 Ga0207683_10007302 Ga0207683_100073028 191
101 3300026142 Ga0207698_10031145 Ga0207698_100311453 191
102 3300028380 Ga0268265_10004054 Ga0268265_100040547 191
103 3300028381 Ga0268264_10039062 Ga0268264_100390622 191
104 3300031548 Ga0307408_100211908 Ga0307408_1002119082 191
105 3300031548 Ga0307408_100456293 Ga0307408_1004562932 191
106 3300031731 Ga0307405_10054680 Ga0307405_100546801 191
107 3300031852 Ga0307410_10029410 Ga0307410_100294104 191
108 3300031903 Ga0307407_10136462 Ga0307407_101364622 191
109 3300031911 Ga0307412_10044420 Ga0307412_100444203 191
110 3300031911 Ga0307412_10065412 Ga0307412_100654123 191
111 3300031911 Ga0307412_10068749 Ga0307412_100687493 191
112 3300031995 Ga0307409_100287290 Ga0307409_1002872902 191
113 3300031995 Ga0307409_100615073 Ga0307409_1006150732 191
114 3300032002 Ga0307416_100522192 Ga0307416_1005221922 191
115 3300032002 Ga0307416_100646963 Ga0307416_1006469632 191
116 3300032004 Ga0307414_10142115 Ga0307414_101421152 191
117 3300032004 Ga0307414_10619788 Ga0307414_106197881 191
118 3300032005 Ga0307411_10067894 Ga0307411_100678943 191
119 3300032005 Ga0307411_10397640 Ga0307411_103976401 191
120 3300032005 Ga0307411_10909288 Ga0307411_109092881 191
121 3300032126 Ga0307415_100155130 Ga0307415_1001551302 191
122 3300032126 Ga0307415_100215213 Ga0307415_1002152131 191
123 3300032126 Ga0307415_100568043 Ga0307415_1005680432 191
124 3300046528 Ga0495642_0069062 Ga0495642_0069062_188_775 191
125 3300046537 Ga0495598_0088142 Ga0495598_0088142_10_597 191
126 3300046539 Ga0495621_0001522 Ga0495621_0001522_5329_5916 191
127 3300046539 Ga0495621_0124556 Ga0495621_0124556_307_894 191
128 3300046558 Ga0495633_0034463 Ga0495633_0034463_1475_2062 191
129 3300050515 nmdc:mga0a205_360910_c1 nmdc:mga0a205_360910_c1_396_983 191
130 3300031911 Ga0307412_10048156 Ga0307412_100481562 192
131 3300031995 Ga0307409_100240408 Ga0307409_1002404082 192
132 3300046492 Ga0495585_0262353 Ga0495585_0262353_233_817 192
133 3300046528 Ga0495642_0134000 Ga0495642_0134000_340_924 192
134 3300046664 Ga0495659_0133049 Ga0495659_0133049_288_872 192
135 3300046684 Ga0495669_0063634 Ga0495669_0063634_424_1008 192
136 3300046691 Ga0495670_0289936 Ga0495670_0289936_179_763 192
137 3300005329 Ga0070683_100655306 Ga0070683_1006553062 193
138 3300005344 Ga0070661_100067981 Ga0070661_1000679812 193
139 3300005564 Ga0070664_100102460 Ga0070664_1001024602 193
140 3300005844 Ga0068862_100258529 Ga0068862_1002585292 193
141 3300009101 Ga0105247_10024614 Ga0105247_100246143 193
142 3300009176 Ga0105242_10008803 Ga0105242_100088038 193
143 3300013105 Ga0157369_10059690 Ga0157369_100596903 193
144 3300013297 Ga0157378_10623788 Ga0157378_106237882 193
145 3300025900 Ga0207710_10031456 Ga0207710_100314563 193
146 3300025920 Ga0207649_10060699 Ga0207649_100606992 193
147 3300025934 Ga0207686_10079705 Ga0207686_100797052 193
148 3300026089 Ga0207648_10690473 Ga0207648_106904731 193
149 3300027552 Ga0209982_1016428 Ga0209982_10164281 193
150 3300028380 Ga0268265_10858986 Ga0268265_108589862 193
151 3300031901 Ga0307406_10386874 Ga0307406_103868742 193
152 3300031995 Ga0307409_101416135 Ga0307409_1014161352 193
153 3300032126 Ga0307415_100263179 Ga0307415_1002631792 193
154 3300035398 Ga0316574_0317738 Ga0316574_0317738_157_741 193
155 3300046542 Ga0495597_0192294 Ga0495597_0192294_86_667 193
156 3300046660 Ga0495625_0000107 Ga0495625_0000107_58401_58982 193
157 3300046691 Ga0495670_0117890 Ga0495670_0117890_537_1118 193
158 iso_pu_bacteria 2882806704 2882809184 193
159 iso_pu_bacteria 2895880812 2895881107 193
160 3300003214 JGI25165J46597_1000024 JGI25165J46597_100002487 194
161 3300005290 Ga0065712_10076949 Ga0065712_100769491 194
162 3300005327 Ga0070658_10024360 Ga0070658_100243602 194
163 3300005330 Ga0070690_100692486 Ga0070690_1006924861 194
164 3300005331 Ga0070670_100017298 Ga0070670_1000172982 194
165 3300005333 Ga0070677_10045297 Ga0070677_100452972 194
166 3300005334 Ga0068869_100751341 Ga0068869_1007513411 194
167 3300005338 Ga0068868_100186826 Ga0068868_1001868261 194
168 3300005339 Ga0070660_100286365 Ga0070660_1002863652 194
169 3300005344 Ga0070661_100003654 Ga0070661_1000036543 194
170 3300005347 Ga0070668_100419240 Ga0070668_1004192402 194
171 3300005353 Ga0070669_100233832 Ga0070669_1002338322 194
172 3300005355 Ga0070671_100000322 Ga0070671_10000032231 194
173 3300005355 Ga0070671_100084895 Ga0070671_1000848952 194
174 3300005355 Ga0070671_100453778 Ga0070671_1004537782 194
175 3300005364 Ga0070673_100005410 Ga0070673_1000054107 194
176 3300005366 Ga0070659_100152362 Ga0070659_1001523622 194
177 3300005367 Ga0070667_100118523 Ga0070667_1001185232 194
178 3300005445 Ga0070708_100448121 Ga0070708_1004481212 194
179 3300005455 Ga0070663_100133861 Ga0070663_1001338612 194
180 3300005456 Ga0070678_100090423 Ga0070678_1000904232 194
181 3300005456 Ga0070678_100864345 Ga0070678_1008643451 194
182 3300005457 Ga0070662_100009676 Ga0070662_1000096762 194
183 3300005539 Ga0068853_100018761 Ga0068853_1000187613 194
184 3300005539 Ga0068853_100283467 Ga0068853_1002834671 194
185 3300005543 Ga0070672_100001444 Ga0070672_1000014442 194
186 3300005543 Ga0070672_100523688 Ga0070672_1005236881 194
187 3300005543 Ga0070672_100607900 Ga0070672_1006079002 194
188 3300005543 Ga0070672_100647445 Ga0070672_1006474452 194
189 3300005544 Ga0070686_100252770 Ga0070686_1002527702 194
190 3300005546 Ga0070696_100039215 Ga0070696_1000392154 194
191 3300005548 Ga0070665_100254478 Ga0070665_1002544782 194
192 3300005563 Ga0068855_100139222 Ga0068855_1001392221 194
193 3300005564 Ga0070664_100001079 Ga0070664_10000107912 194
194 3300005578 Ga0068854_100447695 Ga0068854_1004476952 194
195 3300005614 Ga0068856_100086838 Ga0068856_1000868382 194
196 3300005615 Ga0070702_100585335 Ga0070702_1005853351 194
197 3300005616 Ga0068852_100009206 Ga0068852_1000092062 194
198 3300005618 Ga0068864_100108897 Ga0068864_1001088973 194
199 3300005618 Ga0068864_100585143 Ga0068864_1005851432 194
200 3300005840 Ga0068870_10379397 Ga0068870_103793972 194
201 3300005842 Ga0068858_100001536 Ga0068858_1000015366 194
202 3300005843 Ga0068860_100112597 Ga0068860_1001125972 194
203 3300006881 Ga0068865_100473109 Ga0068865_1004731092 194
204 3300009093 Ga0105240_10000653 Ga0105240_1000065333 194
205 3300009093 Ga0105240_10101199 Ga0105240_101011993 194
206 3300009098 Ga0105245_10002741 Ga0105245_100027418 194
207 3300009101 Ga0105247_10122169 Ga0105247_101221692 194
208 3300009101 Ga0105247_10490113 Ga0105247_104901131 194
209 3300009148 Ga0105243_10064461 Ga0105243_100644613 194
210 3300009174 Ga0105241_10015658 Ga0105241_100156586 194
211 3300009174 Ga0105241_10627133 Ga0105241_106271332 194
212 3300009176 Ga0105242_10408804 Ga0105242_104088042 194
213 3300009177 Ga0105248_10005849 Ga0105248_1000584911 194
214 3300009177 Ga0105248_10075057 Ga0105248_100750572 194
215 3300009177 Ga0105248_10749325 Ga0105248_107493252 194
216 3300009545 Ga0105237_10081675 Ga0105237_100816753 194
217 3300009551 Ga0105238_10026317 Ga0105238_100263172 194
218 3300009551 Ga0105238_10123379 Ga0105238_101233792 194
219 3300009553 Ga0105249_11263679 Ga0105249_112636791 194
220 3300010375 Ga0105239_10001093 Ga0105239_1000109319 194
221 3300010375 Ga0105239_10009490 Ga0105239_100094903 194
222 3300013102 Ga0157371_10020157 Ga0157371_100201574 194
223 3300013102 Ga0157371_10550328 Ga0157371_105503281 194
224 3300013104 Ga0157370_10502218 Ga0157370_105022182 194
225 3300013105 Ga0157369_10222525 Ga0157369_102225253 194
226 3300013296 Ga0157374_10047798 Ga0157374_100477982 194
227 3300013296 Ga0157374_11639994 Ga0157374_116399941 194
228 3300013297 Ga0157378_10055323 Ga0157378_100553231 194
229 3300013307 Ga0157372_10068343 Ga0157372_100683432 194
230 3300013307 Ga0157372_10462296 Ga0157372_104622962 194
231 3300013308 Ga0157375_10018735 Ga0157375_100187356 194
232 3300013308 Ga0157375_10381947 Ga0157375_103819472 194
233 3300014325 Ga0163163_10105268 Ga0163163_101052682 194
234 3300014326 Ga0157380_10069049 Ga0157380_100690493 194
235 3300015262 Ga0182007_10175966 Ga0182007_101759661 194
236 3300017792 Ga0163161_10021074 Ga0163161_100210742 194
237 3300017792 Ga0163161_10030063 Ga0163161_100300633 194
238 3300025250 Ga0209026_1004463 Ga0209026_10044631 194
239 3300025261 Ga0209233_1000084 Ga0209233_1000084224 194
240 3300025304 Ga0209257_1010446 Ga0209257_10104462 194
241 3300025901 Ga0207688_10080008 Ga0207688_100800081 194
242 3300025909 Ga0207705_10024405 Ga0207705_100244056 194
243 3300025911 Ga0207654_10112041 Ga0207654_101120412 194
244 3300025913 Ga0207695_10000012 Ga0207695_10000012370 194
245 3300025913 Ga0207695_10051869 Ga0207695_100518691 194
246 3300025914 Ga0207671_10152637 Ga0207671_101526372 194
247 3300025919 Ga0207657_10383234 Ga0207657_103832342 194
248 3300025920 Ga0207649_10016187 Ga0207649_100161872 194
249 3300025923 Ga0207681_10078897 Ga0207681_100788973 194
250 3300025923 Ga0207681_10237849 Ga0207681_102378492 194
251 3300025923 Ga0207681_10505141 Ga0207681_105051412 194
252 3300025924 Ga0207694_10000006 Ga0207694_10000006295 194
253 3300025924 Ga0207694_10005329 Ga0207694_100053296 194
254 3300025925 Ga0207650_10005126 Ga0207650_100051269 194
255 3300025925 Ga0207650_10184241 Ga0207650_101842411 194
256 3300025927 Ga0207687_10024054 Ga0207687_100240543 194
257 3300025931 Ga0207644_10064022 Ga0207644_100640222 194
258 3300025932 Ga0207690_10221010 Ga0207690_102210102 194
259 3300025933 Ga0207706_10008458 Ga0207706_100084583 194
260 3300025933 Ga0207706_10343537 Ga0207706_103435371 194
261 3300025940 Ga0207691_10002244 Ga0207691_1000224414 194
262 3300025940 Ga0207691_10502640 Ga0207691_105026402 194
263 3300025940 Ga0207691_10769288 Ga0207691_107692881 194
264 3300025941 Ga0207711_10215624 Ga0207711_102156242 194
265 3300025941 Ga0207711_10694442 Ga0207711_106944423 194
266 3300025944 Ga0207661_10120409 Ga0207661_101204093 194
267 3300025945 Ga0207679_10004630 Ga0207679_1000463010 194
268 3300025960 Ga0207651_10108921 Ga0207651_101089212 194
269 3300025961 Ga0207712_10376116 Ga0207712_103761163 194
270 3300025972 Ga0207668_10094072 Ga0207668_100940723 194
271 3300025972 Ga0207668_10193503 Ga0207668_101935032 194
272 3300025972 Ga0207668_10233220 Ga0207668_102332201 194
273 3300025986 Ga0207658_10008134 Ga0207658_100081342 194
274 3300026035 Ga0207703_10001249 Ga0207703_100012494 194
275 3300026041 Ga0207639_10053549 Ga0207639_100535492 194
276 3300026041 Ga0207639_10073769 Ga0207639_100737692 194
277 3300026041 Ga0207639_10275156 Ga0207639_102751562 194
278 3300026088 Ga0207641_10478246 Ga0207641_104782462 194
279 3300026095 Ga0207676_10163822 Ga0207676_101638222 194
280 3300026095 Ga0207676_10232568 Ga0207676_102325682 194
281 3300026095 Ga0207676_11081308 Ga0207676_110813081 194
282 3300026116 Ga0207674_10140507 Ga0207674_101405072 194
283 3300026118 Ga0207675_101272883 Ga0207675_1012728831 194
284 3300026121 Ga0207683_10164425 Ga0207683_101644252 194
285 3300026142 Ga0207698_10350476 Ga0207698_103504762 194
286 3300026142 Ga0207698_11533827 Ga0207698_115338271 194
287 3300027462 Ga0210000_1033232 Ga0210000_10332321 194
288 3300027682 Ga0209971_1022303 Ga0209971_10223032 194
289 3300027876 Ga0209974_10004340 Ga0209974_100043402 194
290 3300027876 Ga0209974_10063607 Ga0209974_100636072 194
291 3300028379 Ga0268266_10005862 Ga0268266_1000586212 194
292 3300028380 Ga0268265_10333595 Ga0268265_103335952 194
293 3300028794 Ga0307515_10168338 Ga0307515_101683382 194
294 3300030742 Ga0316183_1184895 Ga0316183_11848952 194
295 3300031240 Ga0265320_10000628 Ga0265320_1000062834 194
296 3300031241 Ga0265325_10018902 Ga0265325_100189025 194
297 3300031247 Ga0265340_10006825 Ga0265340_100068252 194
298 3300031456 Ga0307513_10514417 Ga0307513_105144171 194
299 3300031507 Ga0307509_10306509 Ga0307509_103065092 194
300 3300031548 Ga0307408_100006221 Ga0307408_1000062219 194
301 3300031548 Ga0307408_100009738 Ga0307408_1000097386 194
302 3300031548 Ga0307408_100046548 Ga0307408_1000465482 194
303 3300031548 Ga0307408_100079484 Ga0307408_1000794843 194
304 3300031548 Ga0307408_100095345 Ga0307408_1000953452 194
305 3300031548 Ga0307408_100200096 Ga0307408_1002000962 194
306 3300031616 Ga0307508_10003117 Ga0307508_100031179 194
307 3300031616 Ga0307508_10006626 Ga0307508_100066266 194
308 3300031712 Ga0265342_10107562 Ga0265342_101075621 194
309 3300031730 Ga0307516_10037891 Ga0307516_100378914 194
310 3300031731 Ga0307405_10000247 Ga0307405_100002479 194
311 3300031731 Ga0307405_10042295 Ga0307405_100422951 194
312 3300031731 Ga0307405_10091207 Ga0307405_100912072 194
313 3300031731 Ga0307405_10175126 Ga0307405_101751262 194
314 3300031731 Ga0307405_10207603 Ga0307405_102076032 194
315 3300031824 Ga0307413_10001963 Ga0307413_100019634 194
316 3300031824 Ga0307413_10009570 Ga0307413_100095702 194
317 3300031824 Ga0307413_10012158 Ga0307413_100121583 194
318 3300031824 Ga0307413_10019353 Ga0307413_100193536 194
319 3300031824 Ga0307413_10035981 Ga0307413_100359812 194
320 3300031824 Ga0307413_10066251 Ga0307413_100662512 194
321 3300031824 Ga0307413_10090039 Ga0307413_100900392 194
322 3300031824 Ga0307413_10136686 Ga0307413_101366862 194
323 3300031824 Ga0307413_10161680 Ga0307413_101616802 194
324 3300031824 Ga0307413_10358220 Ga0307413_103582203 194
325 3300031824 Ga0307413_10748598 Ga0307413_107485982 194
326 3300031852 Ga0307410_10004318 Ga0307410_100043183 194
327 3300031852 Ga0307410_10025584 Ga0307410_100255842 194
328 3300031852 Ga0307410_10033202 Ga0307410_100332023 194
329 3300031852 Ga0307410_10052674 Ga0307410_100526742 194
330 3300031852 Ga0307410_10062528 Ga0307410_100625282 194
331 3300031852 Ga0307410_10164495 Ga0307410_101644952 194
332 3300031852 Ga0307410_10169735 Ga0307410_101697352 194
333 3300031852 Ga0307410_10507909 Ga0307410_105079092 194
334 3300031852 Ga0307410_10553659 Ga0307410_105536591 194
335 3300031852 Ga0307410_10880804 Ga0307410_108808041 194
336 3300031901 Ga0307406_10042442 Ga0307406_100424423 194
337 3300031901 Ga0307406_10108843 Ga0307406_101088432 194
338 3300031901 Ga0307406_10456557 Ga0307406_104565572 194
339 3300031901 Ga0307406_10511427 Ga0307406_105114271 194
340 3300031901 Ga0307406_10612232 Ga0307406_106122322 194
341 3300031903 Ga0307407_10017854 Ga0307407_100178543 194
342 3300031903 Ga0307407_10027565 Ga0307407_100275652 194
343 3300031903 Ga0307407_10046490 Ga0307407_100464902 194
344 3300031903 Ga0307407_10062610 Ga0307407_100626102 194
345 3300031903 Ga0307407_10063100 Ga0307407_100631002 194
346 3300031903 Ga0307407_10129677 Ga0307407_101296772 194
347 3300031903 Ga0307407_10209063 Ga0307407_102090632 194
348 3300031911 Ga0307412_10009522 Ga0307412_100095223 194
349 3300031911 Ga0307412_10014517 Ga0307412_100145174 194
350 3300031911 Ga0307412_10016981 Ga0307412_100169812 194
351 3300031911 Ga0307412_10063317 Ga0307412_100633173 194
352 3300031911 Ga0307412_10188840 Ga0307412_101888402 194
353 3300031911 Ga0307412_10189846 Ga0307412_101898462 194
354 3300031911 Ga0307412_10275103 Ga0307412_102751032 194
355 3300031911 Ga0307412_10885073 Ga0307412_108850731 194
356 3300031995 Ga0307409_100014572 Ga0307409_1000145725 194
357 3300031995 Ga0307409_100021142 Ga0307409_1000211423 194
358 3300031995 Ga0307409_100028708 Ga0307409_1000287082 194
359 3300031995 Ga0307409_100052842 Ga0307409_1000528422 194
360 3300031995 Ga0307409_100064865 Ga0307409_1000648652 194
361 3300031995 Ga0307409_100134996 Ga0307409_1001349963 194
362 3300031995 Ga0307409_100148936 Ga0307409_1001489362 194
363 3300031995 Ga0307409_100175144 Ga0307409_1001751442 194
364 3300031995 Ga0307409_100302492 Ga0307409_1003024922 194
365 3300031995 Ga0307409_100362470 Ga0307409_1003624701 194
366 3300031995 Ga0307409_100884428 Ga0307409_1008844281 194
367 3300031995 Ga0307409_101069062 Ga0307409_1010690622 194
368 3300032002 Ga0307416_100007245 Ga0307416_1000072455 194
369 3300032002 Ga0307416_100021872 Ga0307416_1000218723 194
370 3300032002 Ga0307416_100038548 Ga0307416_1000385482 194
371 3300032002 Ga0307416_100059700 Ga0307416_1000597002 194
372 3300032002 Ga0307416_100107300 Ga0307416_1001073002 194
373 3300032002 Ga0307416_100126004 Ga0307416_1001260042 194
374 3300032002 Ga0307416_100130315 Ga0307416_1001303152 194
375 3300032002 Ga0307416_100179908 Ga0307416_1001799082 194
376 3300032002 Ga0307416_100456644 Ga0307416_1004566443 194
377 3300032002 Ga0307416_100545165 Ga0307416_1005451652 194
378 3300032002 Ga0307416_100634661 Ga0307416_1006346612 194
379 3300032004 Ga0307414_10004437 Ga0307414_100044378 194
380 3300032004 Ga0307414_10041290 Ga0307414_100412902 194
381 3300032004 Ga0307414_10047684 Ga0307414_100476843 194
382 3300032004 Ga0307414_10060798 Ga0307414_100607982 194
383 3300032004 Ga0307414_10065962 Ga0307414_100659623 194
384 3300032004 Ga0307414_10119832 Ga0307414_101198322 194
385 3300032004 Ga0307414_10137229 Ga0307414_101372292 194
386 3300032004 Ga0307414_10180772 Ga0307414_101807722 194
387 3300032004 Ga0307414_10316478 Ga0307414_103164782 194
388 3300032004 Ga0307414_10737810 Ga0307414_107378101 194
389 3300032004 Ga0307414_10790066 Ga0307414_107900662 194
390 3300032005 Ga0307411_10003744 Ga0307411_100037443 194
391 3300032005 Ga0307411_10007409 Ga0307411_100074092 194
392 3300032005 Ga0307411_10010443 Ga0307411_100104436 194
393 3300032005 Ga0307411_10043545 Ga0307411_100435452 194
394 3300032005 Ga0307411_10055125 Ga0307411_100551252 194
395 3300032005 Ga0307411_10065792 Ga0307411_100657922 194
396 3300032005 Ga0307411_10087957 Ga0307411_100879572 194
397 3300032005 Ga0307411_10128814 Ga0307411_101288142 194
398 3300032005 Ga0307411_10138976 Ga0307411_101389762 194
399 3300032005 Ga0307411_10196063 Ga0307411_101960632 194
400 3300032005 Ga0307411_10207699 Ga0307411_102076992 194
401 3300032005 Ga0307411_10353836 Ga0307411_103538362 194
402 3300032005 Ga0307411_10443740 Ga0307411_104437402 194
403 3300032005 Ga0307411_10640573 Ga0307411_106405731 194
404 3300032126 Ga0307415_100013368 Ga0307415_1000133687 194
405 3300032126 Ga0307415_100016425 Ga0307415_1000164256 194
406 3300032126 Ga0307415_100046293 Ga0307415_1000462933 194
407 3300032126 Ga0307415_100124818 Ga0307415_1001248182 194
408 3300032126 Ga0307415_100151337 Ga0307415_1001513373 194
409 3300032126 Ga0307415_100424446 Ga0307415_1004244462 194
410 3300032126 Ga0307415_100569792 Ga0307415_1005697922 194
411 3300032126 Ga0307415_100573988 Ga0307415_1005739882 194
412 3300032126 Ga0307415_100730309 Ga0307415_1007303092 194
413 3300036401 Ga0373937_0059385 Ga0373937_0059385_2721_3323 194
414 3300037068 Ga0373925_0325807 Ga0373925_0325807_45_647 194
415 3300037312 Ga0395899_0088201 Ga0395899_0088201_869_1459 194
416 3300037418 Ga0395900_0001678 Ga0395900_0001678_23109_23699 194
417 3300037471 Ga0395905_0000083 Ga0395905_0000083_84906_85496 194
418 3300037471 Ga0395905_0213011 Ga0395905_0213011_988_1572 194
419 3300038443 Ga0395901_0003561 Ga0395901_0003561_6706_7296 194
420 3300039450 Ga0436363_0334646 Ga0436363_0334646_668_1258 194
421 3300041486 Ga0451807_0236445 Ga0451807_0236445_1174_1764 194
422 3300041999 Ga0439433_0081133 Ga0439433_0081133_74_658 194
423 3300042006 Ga0439432_015789 Ga0439432_015789_340_924 194
424 3300042007 Ga0439449_0207433 Ga0439449_0207433_121_705 194
425 3300042122 Ga0450920_001945 Ga0450920_001945_515_1288 194
426 3300042127 Ga0450890_014574 Ga0450890_014574_76_660 194
427 3300042876 Ga0451577_0169287 Ga0451577_0169287_301_885 194
428 3300046460 Ga0495638_0002615 Ga0495638_0002615_7721_8320 194
429 3300046472 Ga0495580_0051652 Ga0495580_0051652_803_1405 194
430 3300046492 Ga0495585_0021751 Ga0495585_0021751_1917_2501 194
431 3300046525 Ga0495663_0000869 Ga0495663_0000869_1592_2176 194
432 3300046537 Ga0495598_0014589 Ga0495598_0014589_405_989 194
433 3300046539 Ga0495621_0000136 Ga0495621_0000136_6667_7251 194
434 3300046543 Ga0495645_0134123 Ga0495645_0134123_771_1361 194
435 3300046557 Ga0495622_0280586 Ga0495622_0280586_123_713 194
436 3300046558 Ga0495633_0001812 Ga0495633_0001812_10532_11116 194
437 3300046616 Ga0495668_0124920 Ga0495668_0124920_432_1022 194
438 3300046684 Ga0495669_0000459 Ga0495669_0000459_4748_5332 194
439 3300046684 Ga0495669_0052483 Ga0495669_0052483_678_1262 194
440 3300046691 Ga0495670_0000029 Ga0495670_0000029_27021_27620 194
441 3300047472 Ga0495686_0046196 Ga0495686_0046196_1153_1743 194
442 3300048904 Ga0496101_0734539 Ga0496101_0734539_123_707 194
443 3300048909 Ga0496106_0158908 Ga0496106_0158908_1011_1595 194
444 3300048910 Ga0496107_0229479 Ga0496107_0229479_640_1224 194
445 3300048911 Ga0496108_0378957 Ga0496108_0378957_533_1117 194
446 3300048912 Ga0496109_0143426 Ga0496109_0143426_1128_1712 194
447 3300048912 Ga0496109_0380548 Ga0496109_0380548_321_905 194
448 3300048912 Ga0496109_1030889 Ga0496109_1030889_77_661 194
449 3300048912 Ga0496109_1284242 Ga0496109_1284242_43_627 194
450 3300048913 Ga0496110_0002462 Ga0496110_0002462_3070_3654 194
451 3300048913 Ga0496110_0908590 Ga0496110_0908590_10_594 194
452 3300048914 Ga0496111_0042436 Ga0496111_0042436_774_1358 194
453 3300048914 Ga0496111_0497249 Ga0496111_0497249_204_788 194
454 3300048917 Ga0496114_0063732 Ga0496114_0063732_2458_3069 194
455 3300048918 Ga0496115_0000991 Ga0496115_0000991_9467_10057 194
456 3300048918 Ga0496115_0118453 Ga0496115_0118453_948_1532 194
457 3300048924 Ga0496121_0053327 Ga0496121_0053327_2713_3315 194
458 3300048929 Ga0496126_0035732 Ga0496126_0035732_3793_4407 194
459 3300048929 Ga0496126_0729980 Ga0496126_0729980_98_691 194
460 3300049460 Ga0495682_0033142 Ga0495682_0033142_236_850 194
461 3300049571 Ga0501034_0238765 Ga0501034_0238765_693_1319 194
462 3300049572 Ga0501036_0648910 Ga0501036_0648910_135_770 194
463 3300049574 Ga0501038_0342231 Ga0501038_0342231_391_1020 194
464 3300049581 Ga0501047_0247501 Ga0501047_0247501_857_1480 194
465 3300049667 Ga0501230_018815 Ga0501230_018815_27_644 194
466 3300049669 Ga0501235_015074 Ga0501235_015074_450_1067 194
467 3300049674 Ga0501242_017594 Ga0501242_017594_130_747 194
468 3300049679 Ga0501249_006477 Ga0501249_006477_1682_2299 194
469 3300049680 Ga0501250_015213 Ga0501250_015213_113_748 194
470 3300049686 Ga0501257_012102 Ga0501257_012102_305_922 194
471 3300049704 Ga0501221_009818 Ga0501221_009818_766_1383 194
472 3300049704 Ga0501221_121964 Ga0501221_121964_29_613 194
473 3300049765 Ga0501268_001975 Ga0501268_001975_1686_2303 194
474 3300049767 Ga0501270_010919 Ga0501270_010919_314_931 194
475 3300049770 Ga0501273_016182 Ga0501273_016182_214_831 194
476 3300049770 Ga0501273_039594 Ga0501273_039594_82_666 194
477 3300049850 Ga0501204_009975 Ga0501204_009975_209_826 194
478 3300050490 nmdc:mga03n38_283976_c1 nmdc:mga03n38_283976_c1_122_712 194
479 3300053096 Ga0500641_0001393 Ga0500641_0001393_2637_3245 194
480 3300053096 Ga0500641_0243871 Ga0500641_0243871_43_627 194
481 3300053108 Ga0500562_096628 Ga0500562_096628_30_614 194
482 3300053133 Ga0500655_000936 Ga0500655_000936_1279_1893 194
483 3300053134 Ga0500658_0007914 Ga0500658_0007914_1341_1940 194
484 3300053136 Ga0500559_0010957 Ga0500559_0010957_3128_3712 194
485 3300053139 Ga0500568_0013220 Ga0500568_0013220_1749_2333 194
486 3300060353 Ga0501082_0123905 Ga0501082_0123905_49_666 194
487 3300002155 JGI24033J26618_1019975 JGI24033J26618_10199752 195
488 3300005293 Ga0065715_10257666 Ga0065715_102576661 195
489 3300005328 Ga0070676_10101230 Ga0070676_101012302 195
490 3300005331 Ga0070670_100069999 Ga0070670_1000699992 195
491 3300005347 Ga0070668_100200816 Ga0070668_1002008161 195
492 3300005353 Ga0070669_100057781 Ga0070669_1000577811 195
493 3300005354 Ga0070675_100010526 Ga0070675_1000105263 195
494 3300005456 Ga0070678_100156383 Ga0070678_1001563833 195
495 3300005457 Ga0070662_100008026 Ga0070662_1000080263 195
496 3300005564 Ga0070664_100086640 Ga0070664_1000866402 195
497 3300014326 Ga0157380_10021693 Ga0157380_100216933 195
498 3300017792 Ga0163161_11068508 Ga0163161_110685081 195
499 3300025907 Ga0207645_10107054 Ga0207645_101070542 195
500 3300025926 Ga0207659_10008374 Ga0207659_100083743 195
501 3300025933 Ga0207706_10011111 Ga0207706_100111113 195
502 3300025945 Ga0207679_10078249 Ga0207679_100782492 195
503 3300025960 Ga0207651_10073680 Ga0207651_100736802 195
504 3300031251 Ga0265327_10010515 Ga0265327_100105153 195
505 3300031731 Ga0307405_10209360 Ga0307405_102093602 195
506 3300031824 Ga0307413_10329491 Ga0307413_103294912 195
507 3300031852 Ga0307410_10001143 Ga0307410_100011438 195
508 3300031852 Ga0307410_10119607 Ga0307410_101196072 195
509 3300031852 Ga0307410_10206773 Ga0307410_102067732 195
510 3300031995 Ga0307409_100015178 Ga0307409_1000151782 195
511 3300031995 Ga0307409_100039864 Ga0307409_1000398643 195
512 3300031995 Ga0307409_100076740 Ga0307409_1000767402 195
513 3300031995 Ga0307409_100133459 Ga0307409_1001334592 195
514 3300032002 Ga0307416_100094593 Ga0307416_1000945932 195
515 3300032002 Ga0307416_100163374 Ga0307416_1001633742 195
516 3300032002 Ga0307416_100296508 Ga0307416_1002965082 195
517 3300032004 Ga0307414_10001335 Ga0307414_100013358 195
518 3300032005 Ga0307411_10012029 Ga0307411_100120292 195
519 3300032005 Ga0307411_10106226 Ga0307411_101062262 195
520 3300033180 Ga0307510_10191581 Ga0307510_101915813 195
521 3300042004 Ga0439445_0032580 Ga0439445_0032580_213_806 195
522 3300042435 Ga0439434_0085767 Ga0439434_0085767_257_850 195
523 3300045051 Ga0451576_1337517 Ga0451576_1337517_20_652 195
524 3300049582 Ga0501048_0762780 Ga0501048_0762780_84_671 195
525 3300049677 Ga0501247_011332 Ga0501247_011332_422_1009 195
526 3300053122 Ga0500608_151868 Ga0500608_151868_79_672 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

73

173

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8219 32 181
4n71-assembly3.cif.gz_D x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8151 32 181
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.8099 32 181
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.8011 32 181
6npa-assembly2.cif.gz_B x-ray crystal structure of tmpb, (r)-1-hydroxy-2-trimethylaminoethylphosphonate oxygenase, with (r)-1-hydroxy-2-trimethylaminoethylphosphonate 0.7904 32 180
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7872 31 181 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6638 31 181 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6366 39 186 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6363 27 180 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5153 27 180 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A848QJA5-F1-model_v4 HD domain-containing protein 0.9927 1 190
AF-A0A7C7Y4W0-F1-model_v4 HD domain-containing protein 0.9917 5 181
AF-A0A6S6G2N5-F1-model_v4 Phosphohydrolase 0.9891 1 188 GO:0016787
AF-A0A7Y1TB96-F1-model_v4 HD domain-containing protein 0.9883 13 178
AF-A0A382FYQ4-F1-model_v4 HD domain-containing protein 0.9876 75 183

Feature Viewer

pLDDT pTM Quality
93.08 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map