F459465

General Info

Members Datasets Scaffolds Average Seq Length
526 266 525 78

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0090371|Ga0496117_0090371_306_581
Length 91
Sequence MAGPIKRSVMIAGHATSVSLEPIFWEALKRAAEADTLPISALVARIDAERIADPDPVNLASAIRVWLMERALRGESGTTLFGGTIGKSPLP

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
170 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
223 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
224 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
225 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
226 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
227 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
230 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
231 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
232 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
233 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
234 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
240 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
245 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
246 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
247 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
248 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
249 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
250 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
257 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.99
Nodule 0
Rhizoplane 3.42
Rhizosphere 85.74
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10033143 3300001979 Bacteria 1644
2 JGI24740J21852_10072424 3300001979 Bacteria 920
3 JGI24740J21852_10131929 3300001979 Bacteria 623
4 JGI24739J22299_10007028 3300001989 Bacteria 4238
5 JGI24739J22299_10025438 3300001989 Bacteria 2082
6 JGI24739J22299_10034286 3300001989 Bacteria 1730
7 JGI24739J22299_10076393 3300001989 Bacteria 1034
8 JGI24737J22298_10006335 3300001990 Bacteria 4047
9 JGI24737J22298_10015506 3300001990 Bacteria 2467
10 JGI24737J22298_10017825 3300001990 Bacteria 2284
11 JGI24737J22298_10110948 3300001990 Bacteria 811
12 JGI24737J22298_10210541 3300001990 Bacteria 574
13 JGI24735J21928_10005981 3300002067 Bacteria 4020
14 JGI24735J21928_10006747 3300002067 Bacteria 3767
15 JGI24735J21928_10012035 3300002067 Bacteria 2737
16 JGI24735J21928_10013225 3300002067 Bacteria 2598
17 JGI24735J21928_10013747 3300002067 Bacteria 2539
18 JGI24735J21928_10043464 3300002067 Bacteria 1306
19 JGI24735J21928_10090892 3300002067 Bacteria 875
20 JGI24735J21928_10097522 3300002067 Bacteria 843
21 JGI24735J21928_10138215 3300002067 Bacteria 703
22 JGI24750J21931_1000069 3300002070 Bacteria 15037
23 JGI24748J21848_1000066 3300002074 Bacteria 39384
24 JGI24738J21930_10002570 3300002075 Bacteria 4704
25 JGI24738J21930_10003805 3300002075 Bacteria 3772
26 JGI24749J21850_1003139 3300002076 Bacteria 2307
27 JGI24744J21845_10005178 3300002077 Bacteria 2698
28 JGI24034J26672_10000015 3300002239 Bacteria 137655
29 JGI24742J22300_10003954 3300002244 Bacteria 2417
30 JGI24742J22300_10011783 3300002244 Bacteria 1454
31 JGI24751J29686_10004259 3300002459 Bacteria 2904
32 rootL2_10090057 3300003322 Bacteria 1865
33 Ga0055529_1011761 3300003763 Bacteria 1125
34 Ga0070658_10000078 3300005327 Bacteria 92521
35 Ga0070658_10005671 3300005327 Bacteria 10120
36 Ga0070658_10008987 3300005327 Bacteria 8032
37 Ga0070658_10330890 3300005327 Bacteria 1302
38 Ga0070658_11162927 3300005327 Bacteria 671
39 Ga0070676_10104672 3300005328 Bacteria 1754
40 Ga0070676_10171121 3300005328 Bacteria 1405
41 Ga0070676_10227469 3300005328 Bacteria 1235
42 Ga0070690_100000025 3300005330 Bacteria 69409
43 Ga0070670_100457586 3300005331 Bacteria 1131
44 Ga0070677_10529614 3300005333 Bacteria 643
45 Ga0068869_100000568 3300005334 Bacteria 20681
46 Ga0070666_10000015 3300005335 Bacteria 208372
47 Ga0070666_10940773 3300005335 Bacteria 640
48 Ga0070682_100206968 3300005337 Bacteria 1388
49 Ga0070682_101812180 3300005337 Bacteria 533
50 Ga0068868_100000133 3300005338 Bacteria 47802
51 Ga0068868_102117354 3300005338 Bacteria 535
52 Ga0070660_100001564 3300005339 Bacteria 15741
53 Ga0070660_100005229 3300005339 Bacteria 8977
54 Ga0070660_100013558 3300005339 Bacteria 5851
55 Ga0070660_100222165 3300005339 Bacteria 1536
56 Ga0070660_100954545 3300005339 Bacteria 724
57 Ga0070660_101069081 3300005339 Bacteria 683
58 Ga0070660_101402342 3300005339 Bacteria 593
59 Ga0070661_100018936 3300005344 Bacteria 4903
60 Ga0070668_100260766 3300005347 Bacteria 1441
61 Ga0070668_100550762 3300005347 Bacteria 1004
62 Ga0070669_100000059 3300005353 Bacteria 108504
63 Ga0070669_100018483 3300005353 Bacteria 4981
64 Ga0070675_100014731 3300005354 Bacteria 6169
65 Ga0070675_100095864 3300005354 Bacteria 2492
66 Ga0070675_100175631 3300005354 Bacteria 1850
67 Ga0070671_100000769 3300005355 Bacteria 23061
68 Ga0070671_100065987 3300005355 Bacteria 3016
69 Ga0070671_100191523 3300005355 Bacteria 1733
70 Ga0070671_100581653 3300005355 Bacteria 967
71 Ga0070671_101200361 3300005355 Bacteria 668
72 Ga0070674_100039217 3300005356 Bacteria 3197
73 Ga0070674_100251293 3300005356 Bacteria 1389
74 Ga0070674_100685301 3300005356 Bacteria 875
75 Ga0070673_100000015 3300005364 Bacteria 118064
76 Ga0070673_100302333 3300005364 Bacteria 1409
77 Ga0070673_101055684 3300005364 Bacteria 758
78 Ga0070688_100001673 3300005365 Bacteria 11096
79 Ga0070659_100016487 3300005366 Bacteria 5547
80 Ga0070659_100084581 3300005366 Bacteria 2537
81 Ga0070659_100193841 3300005366 Bacteria 1671
82 Ga0070659_100762779 3300005366 Bacteria 840
83 Ga0070659_101135324 3300005366 Bacteria 689
84 Ga0070659_101792195 3300005366 Bacteria 550
85 Ga0070667_100009850 3300005367 Bacteria 7923
86 Ga0070667_100264209 3300005367 Bacteria 1542
87 Ga0070663_100050179 3300005455 Bacteria 2966
88 Ga0070663_100848801 3300005455 Bacteria 786
89 Ga0070662_100006260 3300005457 Bacteria 7666
90 Ga0070662_100020303 3300005457 Bacteria 4522
91 Ga0070662_100022850 3300005457 Bacteria 4288
92 Ga0070662_100197126 3300005457 Bacteria 1596
93 Ga0070662_100362999 3300005457 Bacteria 1189
94 Ga0070662_100605383 3300005457 Bacteria 922
95 Ga0070662_100900226 3300005457 Bacteria 755
96 Ga0070662_101540077 3300005457 Bacteria 573
97 Ga0068867_100000030 3300005459 Bacteria 86560
98 Ga0070685_10000297 3300005466 Bacteria 31390
99 Ga0070685_11155809 3300005466 Bacteria 587
100 Ga0070679_102026508 3300005530 Bacteria 525
101 Ga0070684_101794964 3300005535 Bacteria 579
102 Ga0068853_100043864 3300005539 Bacteria 3826
103 Ga0068853_100243231 3300005539 Bacteria 1650
104 Ga0068853_100862272 3300005539 Bacteria 869
105 Ga0068853_100917703 3300005539 Bacteria 841
106 Ga0068853_101482901 3300005539 Bacteria 657
107 Ga0070672_100103614 3300005543 Bacteria 2311
108 Ga0070672_100238903 3300005543 Bacteria 1528
109 Ga0070686_100000006 3300005544 Bacteria 243316
110 Ga0070695_101000944 3300005545 Bacteria 680
111 Ga0070693_100876714 3300005547 Bacteria 671
112 Ga0070665_100000217 3300005548 Bacteria 97947
113 Ga0070665_100940021 3300005548 Bacteria 877
114 Ga0070665_102291186 3300005548 Bacteria 543
115 Ga0068855_100029358 3300005563 Bacteria 6576
116 Ga0068855_100741668 3300005563 Bacteria 1048
117 Ga0068855_101534792 3300005563 Bacteria 683
118 Ga0070664_100183794 3300005564 Bacteria 1859
119 Ga0070664_102081383 3300005564 Bacteria 539
120 Ga0068857_100117562 3300005577 Bacteria 2392
121 Ga0068857_100205173 3300005577 Bacteria 1798
122 Ga0068857_102457275 3300005577 Bacteria 512
123 Ga0068854_100000027 3300005578 Bacteria 117836
124 Ga0068854_100137767 3300005578 Bacteria 1870
125 Ga0068854_100413742 3300005578 Bacteria 1118
126 Ga0068854_100761551 3300005578 Bacteria 841
127 Ga0068854_101072578 3300005578 Bacteria 716
128 Ga0068856_101393845 3300005614 Bacteria 715
129 Ga0068856_102541455 3300005614 Bacteria 518
130 Ga0068852_100004127 3300005616 Bacteria 10227
131 Ga0068852_100265821 3300005616 Bacteria 1649
132 Ga0068852_100506997 3300005616 Bacteria 1202
133 Ga0068852_102752482 3300005616 Bacteria 511
134 Ga0068859_100130635 3300005617 Bacteria 2583
135 Ga0068859_100169735 3300005617 Bacteria 2262
136 Ga0068859_101394862 3300005617 Bacteria 773
137 Ga0068864_100016871 3300005618 Bacteria 6086
138 Ga0068864_101871414 3300005618 Unclassified 606
139 Ga0068866_10031246 3300005718 Bacteria 2563
140 Ga0068861_100006381 3300005719 Bacteria 8033
141 Ga0068861_101380114 3300005719 Bacteria 688
142 Ga0068851_10058058 3300005834 Bacteria 1977
143 Ga0068851_10135618 3300005834 Bacteria 1334
144 Ga0068863_100000108 3300005841 Bacteria 87921
145 Ga0068863_100333064 3300005841 Bacteria 1476
146 Ga0068858_100000582 3300005842 Bacteria 38264
147 Ga0068860_100000050 3300005843 Bacteria 208372
148 Ga0068860_101209191 3300005843 Bacteria 776
149 Ga0068862_100000062 3300005844 Bacteria 126792
150 Ga0068862_102108860 3300005844 Bacteria 575
151 Ga0081455_10000212 3300005937 Bacteria 74448
152 Ga0075366_10542227 3300006195 Bacteria 720
153 Ga0097621_100003095 3300006237 Bacteria 11412
154 Ga0075370_10021739 3300006353 Bacteria 3516
155 Ga0068871_100004613 3300006358 Bacteria 9620
156 Ga0068865_100000021 3300006881 Bacteria 103137
157 Ga0097620_100130636 3300006931 Bacteria 2583
158 Ga0097620_100169724 3300006931 Bacteria 2262
159 Ga0097620_101394632 3300006931 Bacteria 773
160 Ga0105250_10036238 3300009092 Bacteria 1980
161 Ga0105240_10424865 3300009093 Bacteria 1492
162 Ga0111539_10947880 3300009094 Bacteria 1001
163 Ga0105245_10001778 3300009098 Bacteria 19623
164 Ga0105245_10444960 3300009098 Bacteria 1303
165 Ga0105243_12811919 3300009148 Bacteria 527
166 Ga0105241_10059533 3300009174 Bacteria 2937
167 Ga0105241_10602281 3300009174 Bacteria 993
168 Ga0105241_10815551 3300009174 Bacteria 861
169 Ga0105242_10000198 3300009176 Bacteria 46869
170 Ga0105248_10057834 3300009177 Bacteria 4353
171 Ga0105248_10088056 3300009177 Bacteria 3495
172 Ga0105237_10091931 3300009545 Bacteria 3024
173 Ga0105237_10467986 3300009545 Bacteria 1267
174 Ga0105237_11264326 3300009545 Bacteria 744
175 Ga0105238_10074113 3300009551 Bacteria 3397
176 Ga0105238_10141035 3300009551 Bacteria 2387
177 Ga0105238_11782327 3300009551 Bacteria 647
178 Ga0105249_10000034 3300009553 Bacteria 208378
179 Ga0105239_10006050 3300010375 Bacteria 14087
180 Ga0105239_10148583 3300010375 Bacteria 2615
181 Ga0105239_10345074 3300010375 Bacteria 1681
182 Ga0105239_11900261 3300010375 Bacteria 690
183 Ga0105246_10008205 3300011119 Bacteria 6414
184 Ga0157373_10093177 3300013100 Bacteria 2122
185 Ga0157373_10171797 3300013100 Bacteria 1525
186 Ga0157373_10417825 3300013100 Bacteria 963
187 Ga0157373_11037792 3300013100 Bacteria 613
188 Ga0157373_11052971 3300013100 Bacteria 609
189 Ga0157371_10067580 3300013102 Bacteria 2530
190 Ga0157371_10277821 3300013102 Bacteria 1209
191 Ga0157371_10281042 3300013102 Bacteria 1202
192 Ga0157371_10289212 3300013102 Bacteria 1185
193 Ga0157370_10000203 3300013104 Bacteria 75249
194 Ga0157370_10025393 3300013104 Bacteria 5864
195 Ga0157370_10296466 3300013104 Bacteria 1493
196 Ga0157369_10060262 3300013105 Bacteria 4092
197 Ga0157369_11917222 3300013105 Bacteria 601
198 Ga0157374_10349458 3300013296 Bacteria 1469
199 Ga0163162_10086804 3300013306 Bacteria 3207
200 Ga0163162_10267707 3300013306 Bacteria 1840
201 Ga0157372_10193120 3300013307 Bacteria 2358
202 Ga0157372_10255625 3300013307 Bacteria 2034
203 Ga0157372_10368806 3300013307 Bacteria 1673
204 Ga0157372_10523875 3300013307 Bacteria 1382
205 Ga0157372_10783560 3300013307 Bacteria 1108
206 Ga0157372_13231876 3300013307 Bacteria 519
207 Ga0157375_11544781 3300013308 Bacteria 784
208 Ga0163163_10172115 3300014325 Bacteria 2212
209 Ga0163163_10200655 3300014325 Bacteria 2043
210 Ga0157380_10002383 3300014326 Bacteria 12632
211 Ga0157380_10251890 3300014326 Bacteria 1599
212 Ga0157380_13319435 3300014326 Bacteria 515
213 Ga0157379_10007092 3300014968 Bacteria 9690
214 Ga0163161_10000051 3300017792 Bacteria 122360
215 Ga0163161_10090800 3300017792 Bacteria 2260
216 Ga0213875_10003515 3300021388 Bacteria 8900
217 Ga0207672_1000874 3300025223 Bacteria 3082
218 Ga0209437_132384 3300025233 Bacteria 517
219 Ga0209148_1000061 3300025254 Bacteria 349575
220 Ga0209148_1001629 3300025254 Bacteria 10319
221 Ga0209455_1000655 3300025272 Bacteria 21163
222 Ga0209455_1012259 3300025272 Bacteria 2062
223 Ga0207656_10053333 3300025321 Bacteria 1754
224 Ga0207656_10071683 3300025321 Bacteria 1541
225 Ga0207656_10430055 3300025321 Bacteria 666
226 Ga0207696_1077374 3300025711 Bacteria 921
227 Ga0207682_10000690 3300025893 Bacteria 15677
228 Ga0207642_10044275 3300025899 Bacteria 1969
229 Ga0207688_10458941 3300025901 Bacteria 795
230 Ga0207680_10000007 3300025903 Bacteria 623574
231 Ga0207680_10779963 3300025903 Bacteria 685
232 Ga0207647_10001490 3300025904 Bacteria 17990
233 Ga0207647_10001987 3300025904 Bacteria 15638
234 Ga0207647_10005170 3300025904 Bacteria 9598
235 Ga0207647_10015909 3300025904 Bacteria 5147
236 Ga0207647_10051471 3300025904 Bacteria 2545
237 Ga0207647_10134615 3300025904 Bacteria 1451
238 Ga0207647_10651012 3300025904 Bacteria 578
239 Ga0207645_10000523 3300025907 Bacteria 31917
240 Ga0207645_10230456 3300025907 Bacteria 1222
241 Ga0207705_10000025 3300025909 Bacteria 259826
242 Ga0207705_10000331 3300025909 Bacteria 43023
243 Ga0207705_10007636 3300025909 Bacteria 7953
244 Ga0207705_10371793 3300025909 Bacteria 1103
245 Ga0207705_10505140 3300025909 Bacteria 939
246 Ga0207705_10692345 3300025909 Bacteria 792
247 Ga0207705_11180035 3300025909 Bacteria 588
248 Ga0207654_10008185 3300025911 Bacteria 5274
249 Ga0207654_10034449 3300025911 Bacteria 2813
250 Ga0207654_10492557 3300025911 Bacteria 865
251 Ga0207695_10005706 3300025913 Bacteria 16411
252 Ga0207695_10006157 3300025913 Bacteria 15640
253 Ga0207671_10000658 3300025914 Bacteria 45037
254 Ga0207671_10287729 3300025914 Bacteria 1297
255 Ga0207671_10347950 3300025914 Bacteria 1175
256 Ga0207671_11381059 3300025914 Bacteria 547
257 Ga0207657_10001332 3300025919 Bacteria 26222
258 Ga0207657_10002731 3300025919 Bacteria 19000
259 Ga0207657_10239761 3300025919 Bacteria 1448
260 Ga0207657_10453949 3300025919 Bacteria 1006
261 Ga0207657_10493547 3300025919 Bacteria 959
262 Ga0207657_11087009 3300025919 Bacteria 611
263 Ga0207649_10363768 3300025920 Bacteria 1074
264 Ga0207681_10000089 3300025923 Bacteria 79526
265 Ga0207694_10001347 3300025924 Bacteria 21148
266 Ga0207694_10052477 3300025924 Bacteria 3161
267 Ga0207694_10864613 3300025924 Bacteria 764
268 Ga0207650_10724279 3300025925 Bacteria 841
269 Ga0207659_10061813 3300025926 Bacteria 2701
270 Ga0207659_10079918 3300025926 Bacteria 2414
271 Ga0207659_10398673 3300025926 Bacteria 1150
272 Ga0207659_11516175 3300025926 Bacteria 573
273 Ga0207687_10005128 3300025927 Bacteria 8686
274 Ga0207644_10000657 3300025931 Bacteria 21865
275 Ga0207644_10032222 3300025931 Bacteria 3655
276 Ga0207644_10159545 3300025931 Bacteria 1752
277 Ga0207644_10861046 3300025931 Bacteria 759
278 Ga0207690_10000083 3300025932 Bacteria 78909
279 Ga0207690_10055331 3300025932 Bacteria 2672
280 Ga0207690_10212213 3300025932 Bacteria 1477
281 Ga0207690_10256997 3300025932 Bacteria 1352
282 Ga0207690_10470118 3300025932 Bacteria 1013
283 Ga0207690_11068417 3300025932 Bacteria 672
284 Ga0207706_10007622 3300025933 Bacteria 10008
285 Ga0207706_10010127 3300025933 Bacteria 8632
286 Ga0207706_10014467 3300025933 Bacteria 7152
287 Ga0207706_10100329 3300025933 Bacteria 2547
288 Ga0207706_10129163 3300025933 Bacteria 2222
289 Ga0207706_10667468 3300025933 Bacteria 890
290 Ga0207706_10667469 3300025933 Bacteria 890
291 Ga0207706_10723415 3300025933 Bacteria 849
292 Ga0207686_10006212 3300025934 Bacteria 6424
293 Ga0207709_10000118 3300025935 Bacteria 122125
294 Ga0207670_10041724 3300025936 Bacteria 3019
295 Ga0207669_10111353 3300025937 Bacteria 1835
296 Ga0207669_10482372 3300025937 Bacteria 988
297 Ga0207704_10000027 3300025938 Bacteria 122372
298 Ga0207691_10049066 3300025940 Bacteria 3868
299 Ga0207691_10140497 3300025940 Bacteria 2128
300 Ga0207711_10019349 3300025941 Bacteria 5669
301 Ga0207711_10451845 3300025941 Bacteria 1196
302 Ga0207689_10000584 3300025942 Bacteria 34795
303 Ga0207679_11085738 3300025945 Bacteria 734
304 Ga0207667_10000035 3300025949 Bacteria 301056
305 Ga0207667_10004684 3300025949 Bacteria 16743
306 Ga0207667_10035908 3300025949 Bacteria 5316
307 Ga0207667_11139837 3300025949 Bacteria 762
308 Ga0207667_11556269 3300025949 Bacteria 631
309 Ga0207651_10000016 3300025960 Bacteria 122094
310 Ga0207651_10782068 3300025960 Bacteria 845
311 Ga0207651_10822699 3300025960 Bacteria 824
312 Ga0207712_10000004 3300025961 Bacteria 614655
313 Ga0207712_10002574 3300025961 Bacteria 11653
314 Ga0207668_10012930 3300025972 Bacteria 5126
315 Ga0207668_10026592 3300025972 Bacteria 3758
316 Ga0207668_10509120 3300025972 Bacteria 1037
317 Ga0207640_10000145 3300025981 Bacteria 51603
318 Ga0207640_10068931 3300025981 Bacteria 2372
319 Ga0207640_10144012 3300025981 Bacteria 1741
320 Ga0207640_10751648 3300025981 Bacteria 841
321 Ga0207658_10000921 3300025986 Bacteria 24296
322 Ga0207658_10167617 3300025986 Bacteria 1806
323 Ga0207658_11703504 3300025986 Bacteria 576
324 Ga0207658_11972465 3300025986 Bacteria 531
325 Ga0207677_10000192 3300026023 Bacteria 49458
326 Ga0207677_11793589 3300026023 Bacteria 569
327 Ga0207703_10001141 3300026035 Bacteria 25115
328 Ga0207639_10005234 3300026041 Bacteria 8750
329 Ga0207639_10014979 3300026041 Bacteria 5463
330 Ga0207639_10034891 3300026041 Bacteria 3721
331 Ga0207639_10070443 3300026041 Bacteria 2731
332 Ga0207639_10118509 3300026041 Bacteria 2171
333 Ga0207639_10239479 3300026041 Bacteria 1577
334 Ga0207639_10421089 3300026041 Bacteria 1207
335 Ga0207639_10434772 3300026041 Bacteria 1189
336 Ga0207678_10052501 3300026067 Bacteria 3517
337 Ga0207678_10056269 3300026067 Bacteria 3386
338 Ga0207702_10003111 3300026078 Bacteria 15373
339 Ga0207702_10007774 3300026078 Bacteria 9103
340 Ga0207702_10009067 3300026078 Bacteria 8374
341 Ga0207702_11725613 3300026078 Bacteria 619
342 Ga0207641_10000428 3300026088 Bacteria 48639
343 Ga0207641_10069814 3300026088 Bacteria 3018
344 Ga0207648_10000116 3300026089 Bacteria 77755
345 Ga0207648_10750664 3300026089 Bacteria 906
346 Ga0207676_10069883 3300026095 Bacteria 2813
347 Ga0207674_10016578 3300026116 Bacteria 8058
348 Ga0207674_10188856 3300026116 Bacteria 2010
349 Ga0207674_10839814 3300026116 Bacteria 886
350 Ga0207674_11097988 3300026116 Bacteria 765
351 Ga0207675_100000449 3300026118 Bacteria 39979
352 Ga0207683_10624561 3300026121 Bacteria 998
353 Ga0207698_10001220 3300026142 Bacteria 15021
354 Ga0207698_10152084 3300026142 Bacteria 2010
355 Ga0207698_10330596 3300026142 Bacteria 1431
356 Ga0207698_10808875 3300026142 Bacteria 940
357 Ga0207698_10876840 3300026142 Bacteria 904
358 Ga0207698_11267645 3300026142 Bacteria 751
359 Ga0268266_10000225 3300028379 Bacteria 98082
360 Ga0268265_10000086 3300028380 Bacteria 119049
361 Ga0268264_10000003 3300028381 Bacteria 1141976
362 Ga0268264_10723527 3300028381 Bacteria 990
363 Ga0268264_10909645 3300028381 Bacteria 883
364 Ga0307408_100076794 3300031548 Bacteria 2486
365 Ga0307408_100157397 3300031548 Bacteria 1801
366 Ga0307408_100524069 3300031548 Bacteria 1041
367 Ga0307408_101099178 3300031548 Bacteria 737
368 Ga0307405_10326973 3300031731 Bacteria 1173
369 Ga0307413_10696052 3300031824 Bacteria 844
370 Ga0307413_10705856 3300031824 Bacteria 838
371 Ga0307410_10287863 3300031852 Bacteria 1292
372 Ga0307410_12024090 3300031852 Bacteria 514
373 Ga0307406_10637629 3300031901 Bacteria 883
374 Ga0307406_10924814 3300031901 Bacteria 744
375 Ga0307416_100586230 3300032002 Bacteria 1193
376 Ga0307416_102257336 3300032002 Bacteria 645
377 Ga0307414_11265224 3300032004 Bacteria 684
378 Ga0307411_10235509 3300032005 Bacteria 1430
379 Ga0307411_11025959 3300032005 Bacteria 740
380 Ga0307415_100603372 3300032126 Bacteria 977
381 Ga0307510_10052161 3300033180 Bacteria 4317
382 Ga0395899_0000797 3300037312 Bacteria 30839
383 Ga0395900_0176646 3300037418 Bacteria 2172
384 Ga0395905_0132640 3300037471 Bacteria 2343
385 Ga0395905_0170339 3300037471 Bacteria 2045
386 Ga0395905_0313534 3300037471 Bacteria 1457
387 Ga0395905_1023047 3300037471 Bacteria 729
388 Ga0436364_0852694 3300037853 Bacteria 36694
389 Ga0395901_0053106 3300038443 Bacteria 4211
390 Ga0395901_1163034 3300038443 Bacteria 739
391 Ga0436365_1771744 3300039437 Bacteria 719
392 Ga0451793_1648096 3300041452 Bacteria 541
393 Ga0451802_1748341 3300041460 Bacteria 646
394 Ga0451802_2102928 3300041460 Bacteria 678
395 Ga0451806_677182 3300041462 Bacteria 2140
396 Ga0451807_0002806 3300041486 Bacteria 1859
397 Ga0451835_0931463 3300041492 Bacteria 586
398 Ga0451853_0066861 3300041512 Bacteria 1036
399 Ga0451853_3235022 3300041512 Bacteria 1145
400 Ga0439448_0002270 3300042005 Bacteria 5199
401 Ga0439448_0032258 3300042005 Bacteria 1666
402 Ga0439448_0069177 3300042005 Bacteria 1175
403 Ga0439448_0100393 3300042005 Bacteria 983
404 Ga0439454_034327 3300042011 Bacteria 808
405 Ga0439455_0000208 3300042012 Bacteria 6878
406 Ga0439455_0045539 3300042012 Bacteria 1134
407 Ga0439458_0000048 3300042157 Bacteria 19869
408 Ga0439458_0003209 3300042157 Bacteria 3870
409 Ga0466969_0102247 3300044656 Bacteria 1348
410 Ga0466972_0009310 3300044658 Bacteria 4937
411 Ga0466965_0198251 3300044683 Bacteria 1064
412 Ga0466966_0336947 3300044684 Bacteria 906
413 Ga0466961_0031975 3300044693 Bacteria 3381
414 Ga0466964_0317573 3300044706 Bacteria 790
415 Ga0466964_0469961 3300044706 Bacteria 670
416 Ga0466971_0484870 3300044719 Bacteria 609
417 Ga0466971_0665829 3300044719 Bacteria 522
418 Ga0466968_0031985 3300044735 Bacteria 2186
419 Ga0466970_0398999 3300044765 Bacteria 785
420 Ga0466957_0646253 3300044842 Bacteria 743
421 Ga0466959_0187074 3300045049 Bacteria 1446
422 Ga0466959_0853064 3300045049 Bacteria 608
423 Ga0466958_0223568 3300045836 Bacteria 1201
424 Ga0466967_1513300 3300045976 Bacteria 668
425 Ga0495638_0011356 3300046460 Bacteria 6138
426 Ga0495583_0000212 3300046506 Bacteria 97784
427 Ga0495606_0001173 3300046507 Bacteria 36966
428 Ga0495606_0079069 3300046507 Bacteria 2049
429 Ga0495610_0148564 3300046512 Bacteria 1002
430 Ga0495648_0014366 3300046524 Bacteria 5800
431 Ga0495668_0214883 3300046616 Bacteria 1053
432 Ga0495661_0402718 3300046665 Bacteria 665
433 Ga0495670_0006695 3300046691 Bacteria 5666
434 Ga0495649_0534056 3300046694 Bacteria 582
435 Ga0495686_0000619 3300047472 Bacteria 49008
436 Ga0495686_0007008 3300047472 Bacteria 8517
437 Ga0495626_0232991 3300048091 Bacteria 744
438 Ga0496101_0952762 3300048904 Bacteria 675
439 Ga0496101_1148843 3300048904 Bacteria 609
440 Ga0496102_0000100 3300048905 Bacteria 123531
441 Ga0496102_0004941 3300048905 Bacteria 11296
442 Ga0496102_0455490 3300048905 Bacteria 1200
443 Ga0496103_0000070 3300048906 Bacteria 121077
444 Ga0496103_0001574 3300048906 Bacteria 15064
445 Ga0496104_0720331 3300048907 Bacteria 905
446 Ga0496105_0225332 3300048908 Bacteria 1525
447 Ga0496106_0506783 3300048909 Bacteria 969
448 Ga0496107_0121756 3300048910 Bacteria 1922
449 Ga0496111_0019433 3300048914 Bacteria 4719
450 Ga0496111_0078104 3300048914 Bacteria 2414
451 Ga0496116_0001752 3300048919 Bacteria 23645
452 Ga0496116_0024938 3300048919 Bacteria 4409
453 Ga0496117_0000194 3300048920 Bacteria 123531
454 Ga0496117_0005305 3300048920 Bacteria 13633
455 Ga0496117_0006563 3300048920 Bacteria 11707
456 Ga0496117_0090371 3300048920 Bacteria 1973
457 Ga0496117_0137219 3300048920 Bacteria 1471
458 Ga0496117_0581603 3300048920 Bacteria 527
459 Ga0496118_0000146 3300048921 Bacteria 123531
460 Ga0496118_0001200 3300048921 Bacteria 39881
461 Ga0496118_0017907 3300048921 Bacteria 6425
462 Ga0496118_0109080 3300048921 Bacteria 1843
463 Ga0496118_0271653 3300048921 Bacteria 949
464 Ga0496118_0352023 3300048921 Bacteria 784
465 Ga0496119_0068394 3300048922 Bacteria 2091
466 Ga0496120_0148537 3300048923 Bacteria 1180
467 Ga0496121_0028649 3300048924 Bacteria 5179
468 Ga0496121_0154276 3300048924 Bacteria 1686
469 Ga0496122_0002248 3300048925 Bacteria 27991
470 Ga0496123_0003226 3300048926 Bacteria 18563
471 Ga0496123_0023294 3300048926 Bacteria 4742
472 Ga0496124_0000185 3300048927 Bacteria 123531
473 Ga0496124_0016005 3300048927 Bacteria 7158
474 Ga0496124_0081232 3300048927 Bacteria 2665
475 Ga0496124_0618646 3300048927 Bacteria 701
476 Ga0496125_0529242 3300048928 Bacteria 657
477 Ga0496126_0509332 3300048929 Bacteria 961
478 Ga0496126_1014005 3300048929 Bacteria 622
479 Ga0495682_0014769 3300049460 Bacteria 2960
480 Ga0501292_000018 3300049515 Bacteria 56361
481 Ga0501294_000220 3300049517 Bacteria 7031
482 Ga0501300_000845 3300049523 Bacteria 4661
483 Ga0501301_040372 3300049524 Bacteria 527
484 Ga0501302_002598 3300049525 Bacteria 1026
485 Ga0501335_018298 3300049551 Bacteria 733
486 Ga0501033_0549341 3300049570 Bacteria 796
487 Ga0501202_010236 3300049652 Bacteria 1737
488 Ga0501206_000738 3300049653 Bacteria 3985
489 Ga0501222_000155 3300049662 Bacteria 13700
490 Ga0501223_001548 3300049663 Bacteria 5303
491 Ga0501224_001047 3300049664 Bacteria 3605
492 Ga0501227_011750 3300049665 Bacteria 1911
493 Ga0501233_000942 3300049668 Bacteria 4928
494 Ga0501235_002627 3300049669 Bacteria 3865
495 Ga0501236_001780 3300049670 Bacteria 2460
496 Ga0501257_037928 3300049686 Bacteria 1176
497 Ga0501261_000422 3300049690 Bacteria 5552
498 Ga0501221_001387 3300049704 Bacteria 3990
499 Ga0501225_0000955 3300049705 Bacteria 9046
500 Ga0501229_030174 3300049706 Bacteria 742
501 Ga0501245_000633 3300049708 Bacteria 4328
502 Ga0501264_004216 3300049761 Bacteria 1304
503 Ga0501276_008073 3300049773 Bacteria 852
504 Ga0501279_000007 3300049775 Bacteria 141756
505 Ga0501280_000007 3300049776 Bacteria 75585
506 Ga0501281_00186 3300049777 Bacteria 7164
507 Ga0501282_000162 3300049778 Bacteria 8036
508 Ga0501283_000666 3300049779 Bacteria 4537
509 Ga0501035_0114070 3300049822 Bacteria 2367
510 nmdc:mga08y16_872135_c1 3300050511 Bacteria 888
511 nmdc:mga0n895_1926289_c1 3300050512 Bacteria 550
512 Ga0500647_0016714 3300053091 Bacteria 3375
513 Ga0500555_000216 3300053103 Bacteria 26527
514 Ga0500592_000653 3300053116 Bacteria 5698
515 Ga0500618_008447 3300053125 Bacteria 2869
516 Ga0500618_028148 3300053125 Bacteria 1332
517 Ga0500658_0149942 3300053134 Bacteria 1051
518 Ga0500573_0486957 3300053140 Bacteria 561
519 Ga0500577_0035909 3300053142 Bacteria 1771
520 Ga0500604_0175671 3300053151 Bacteria 733
521 Ga0500627_0252202 3300053158 Bacteria 781
522 Ga0500636_0047869 3300053177 Bacteria 2518
523 Ga0500611_151889 3300053727 Unclassified 636
524 Ga0500587_000297 3300053739 Bacteria 5556
525 Ga0466962_0125801 3300061719 Bacteria 1238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100550762 Ga0070668_1005507622 66
2 3300005354 Ga0070675_100175631 Ga0070675_1001756312 66
3 3300005356 Ga0070674_100251293 Ga0070674_1002512931 66
4 3300005364 Ga0070673_100302333 Ga0070673_1003023332 66
5 3300005457 Ga0070662_100605383 Ga0070662_1006053832 66
6 3300005543 Ga0070672_100238903 Ga0070672_1002389032 66
7 3300005545 Ga0070695_101000944 Ga0070695_1010009442 66
8 3300005617 Ga0068859_101394862 Ga0068859_1013948621 66
9 3300005719 Ga0068861_101380114 Ga0068861_1013801142 66
10 3300006931 Ga0097620_101394632 Ga0097620_1013946321 66
11 3300009094 Ga0111539_10947880 Ga0111539_109478802 66
12 3300014326 Ga0157380_10251890 Ga0157380_102518902 66
13 3300025926 Ga0207659_10398673 Ga0207659_103986732 66
14 3300025940 Ga0207691_10049066 Ga0207691_100490663 66
15 3300025960 Ga0207651_10822699 Ga0207651_108226992 66
16 3300025972 Ga0207668_10509120 Ga0207668_105091202 66
17 3300050511 nmdc:mga08y16_872135_c1 nmdc:mga08y16_872135_c1_539_766 66
18 3300046524 Ga0495648_0014366 Ga0495648_0014366_2633_2854 69
19 3300053091 Ga0500647_0016714 Ga0500647_0016714_1612_1833 69
20 3300053125 Ga0500618_008447 Ga0500618_008447_673_894 69
21 3300053177 Ga0500636_0047869 Ga0500636_0047869_805_1026 69
22 3300013307 Ga0157372_13231876 Ga0157372_132318761 71
23 3300001979 JGI24740J21852_10072424 JGI24740J21852_100724242 72
24 3300001979 JGI24740J21852_10131929 JGI24740J21852_101319291 72
25 3300005339 Ga0070660_100005229 Ga0070660_1000052294 72
26 3300005466 Ga0070685_11155809 Ga0070685_111558091 72
27 3300005539 Ga0068853_100243231 Ga0068853_1002432312 72
28 3300005563 Ga0068855_100029358 Ga0068855_1000293585 72
29 3300005617 Ga0068859_100130635 Ga0068859_1001306353 72
30 3300006931 Ga0097620_100130636 Ga0097620_1001306363 72
31 3300009545 Ga0105237_10467986 Ga0105237_104679862 72
32 3300010375 Ga0105239_10148583 Ga0105239_101485832 72
33 3300013104 Ga0157370_10296466 Ga0157370_102964662 72
34 3300025914 Ga0207671_10347950 Ga0207671_103479502 72
35 3300025919 Ga0207657_10001332 Ga0207657_100013324 72
36 3300025949 Ga0207667_10035908 Ga0207667_100359082 72
37 3300026041 Ga0207639_10239479 Ga0207639_102394793 72
38 3300033180 Ga0307510_10052161 Ga0307510_100521612 72
39 3300048920 Ga0496117_0581603 Ga0496117_0581603_250_480 72
40 3300005337 Ga0070682_101812180 Ga0070682_1018121801 73
41 3300005618 Ga0068864_101871414 Ga0068864_1018714142 73
42 3300013308 Ga0157375_11544781 Ga0157375_115447812 73
43 3300014326 Ga0157380_13319435 Ga0157380_133194352 73
44 3300026041 Ga0207639_10434772 Ga0207639_104347722 73
45 3300026121 Ga0207683_10624561 Ga0207683_106245612 73
46 3300031548 Ga0307408_100157397 Ga0307408_1001573973 73
47 3300031824 Ga0307413_10696052 Ga0307413_106960522 73
48 3300031824 Ga0307413_10705856 Ga0307413_107058561 73
49 3300031852 Ga0307410_10287863 Ga0307410_102878632 73
50 3300031852 Ga0307410_12024090 Ga0307410_120240902 73
51 3300032002 Ga0307416_100586230 Ga0307416_1005862303 73
52 3300032004 Ga0307414_11265224 Ga0307414_112652242 73
53 3300032005 Ga0307411_10235509 Ga0307411_102355092 73
54 3300041460 Ga0451802_1748341 Ga0451802_1748341_329_550 73
55 3300041512 Ga0451853_3235022 Ga0451853_3235022_796_1020 73
56 3300046616 Ga0495668_0214883 Ga0495668_0214883_640_861 73
57 3300048929 Ga0496126_1014005 Ga0496126_1014005_134_355 73
58 3300053134 Ga0500658_0149942 Ga0500658_0149942_768_989 73
59 3300053727 Ga0500611_151889 Ga0500611_151889_361_582 73
60 3300053739 Ga0500587_000297 Ga0500587_000297_1170_1391 73
61 3300001989 JGI24739J22299_10034286 JGI24739J22299_100342861 74
62 3300001990 JGI24737J22298_10006335 JGI24737J22298_100063355 74
63 3300002067 JGI24735J21928_10006747 JGI24735J21928_100067475 74
64 3300002075 JGI24738J21930_10003805 JGI24738J21930_100038055 74
65 3300005327 Ga0070658_10000078 Ga0070658_1000007821 74
66 3300005328 Ga0070676_10104672 Ga0070676_101046722 74
67 3300005339 Ga0070660_100001564 Ga0070660_1000015646 74
68 3300005339 Ga0070660_100954545 Ga0070660_1009545452 74
69 3300005354 Ga0070675_100095864 Ga0070675_1000958642 74
70 3300005355 Ga0070671_101200361 Ga0070671_1012003612 74
71 3300005366 Ga0070659_100193841 Ga0070659_1001938412 74
72 3300005366 Ga0070659_101792195 Ga0070659_1017921951 74
73 3300005457 Ga0070662_100006260 Ga0070662_1000062604 74
74 3300005548 Ga0070665_102291186 Ga0070665_1022911861 74
75 3300005564 Ga0070664_102081383 Ga0070664_1020813832 74
76 3300005577 Ga0068857_100205173 Ga0068857_1002051731 74
77 3300005578 Ga0068854_100761551 Ga0068854_1007615512 74
78 3300005614 Ga0068856_102541455 Ga0068856_1025414551 74
79 3300005841 Ga0068863_100333064 Ga0068863_1003330642 74
80 3300009098 Ga0105245_10444960 Ga0105245_104449604 74
81 3300013102 Ga0157371_10289212 Ga0157371_102892122 74
82 3300013307 Ga0157372_10783560 Ga0157372_107835602 74
83 3300025904 Ga0207647_10001987 Ga0207647_100019877 74
84 3300025909 Ga0207705_10000331 Ga0207705_100003318 74
85 3300025914 Ga0207671_10287729 Ga0207671_102877292 74
86 3300025919 Ga0207657_10002731 Ga0207657_1000273113 74
87 3300025919 Ga0207657_11087009 Ga0207657_110870092 74
88 3300025926 Ga0207659_10061813 Ga0207659_100618133 74
89 3300025931 Ga0207644_10861046 Ga0207644_108610461 74
90 3300025932 Ga0207690_10000083 Ga0207690_1000008311 74
91 3300025932 Ga0207690_10055331 Ga0207690_100553312 74
92 3300025933 Ga0207706_10007622 Ga0207706_100076225 74
93 3300025981 Ga0207640_10751648 Ga0207640_107516481 74
94 3300026078 Ga0207702_11725613 Ga0207702_117256131 74
95 3300026088 Ga0207641_10069814 Ga0207641_100698142 74
96 3300026116 Ga0207674_10188856 Ga0207674_101888561 74
97 3300028381 Ga0268264_10909645 Ga0268264_109096452 74
98 3300031548 Ga0307408_101099178 Ga0307408_1010991781 74
99 3300031901 Ga0307406_10637629 Ga0307406_106376292 74
100 3300032002 Ga0307416_102257336 Ga0307416_1022573362 74
101 3300044656 Ga0466969_0102247 Ga0466969_0102247_323_556 74
102 3300044684 Ga0466966_0336947 Ga0466966_0336947_146_379 74
103 3300044693 Ga0466961_0031975 Ga0466961_0031975_88_321 74
104 3300044706 Ga0466964_0469961 Ga0466964_0469961_223_456 74
105 3300044719 Ga0466971_0665829 Ga0466971_0665829_102_335 74
106 3300045049 Ga0466959_0187074 Ga0466959_0187074_986_1219 74
107 3300045049 Ga0466959_0853064 Ga0466959_0853064_65_298 74
108 3300045836 Ga0466958_0223568 Ga0466958_0223568_160_393 74
109 3300048914 Ga0496111_0019433 Ga0496111_0019433_1120_1347 74
110 3300048925 Ga0496122_0002248 Ga0496122_0002248_27014_27241 74
111 3300048926 Ga0496123_0003226 Ga0496123_0003226_709_936 74
112 3300048927 Ga0496124_0016005 Ga0496124_0016005_4575_4802 74
113 3300048928 Ga0496125_0529242 Ga0496125_0529242_81_305 74
114 3300061719 Ga0466962_0125801 Ga0466962_0125801_50_283 74
115 iso_pu_bacteria 2582581305 2585263984 74
116 3300001990 JGI24737J22298_10017825 JGI24737J22298_100178253 75
117 3300003763 Ga0055529_1011761 Ga0055529_10117612 75
118 3300005327 Ga0070658_10330890 Ga0070658_103308902 75
119 3300005328 Ga0070676_10171121 Ga0070676_101711213 75
120 3300005338 Ga0068868_102117354 Ga0068868_1021173541 75
121 3300005339 Ga0070660_101402342 Ga0070660_1014023421 75
122 3300005530 Ga0070679_102026508 Ga0070679_1020265082 75
123 3300005563 Ga0068855_101534792 Ga0068855_1015347921 75
124 3300005578 Ga0068854_100000027 Ga0068854_10000002732 75
125 3300005616 Ga0068852_100506997 Ga0068852_1005069973 75
126 3300005834 Ga0068851_10058058 Ga0068851_100580583 75
127 3300006195 Ga0075366_10542227 Ga0075366_105422272 75
128 3300006237 Ga0097621_100003095 Ga0097621_1000030957 75
129 3300006358 Ga0068871_100004613 Ga0068871_1000046133 75
130 3300009174 Ga0105241_10059533 Ga0105241_100595333 75
131 3300009551 Ga0105238_10141035 Ga0105238_101410352 75
132 3300009551 Ga0105238_11782327 Ga0105238_117823272 75
133 3300010375 Ga0105239_10006050 Ga0105239_100060506 75
134 3300013100 Ga0157373_10093177 Ga0157373_100931773 75
135 3300013296 Ga0157374_10349458 Ga0157374_103494583 75
136 3300013307 Ga0157372_10193120 Ga0157372_101931202 75
137 3300021388 Ga0213875_10003515 Ga0213875_100035155 75
138 3300025233 Ga0209437_132384 Ga0209437_1323841 75
139 3300025254 Ga0209148_1001629 Ga0209148_10016295 75
140 3300025272 Ga0209455_1000655 Ga0209455_100065519 75
141 3300025321 Ga0207656_10071683 Ga0207656_100716833 75
142 3300025904 Ga0207647_10005170 Ga0207647_100051709 75
143 3300025904 Ga0207647_10651012 Ga0207647_106510121 75
144 3300025907 Ga0207645_10230456 Ga0207645_102304562 75
145 3300025909 Ga0207705_10007636 Ga0207705_100076364 75
146 3300025909 Ga0207705_10371793 Ga0207705_103717931 75
147 3300025909 Ga0207705_10692345 Ga0207705_106923452 75
148 3300025911 Ga0207654_10034449 Ga0207654_100344493 75
149 3300025919 Ga0207657_10453949 Ga0207657_104539492 75
150 3300025924 Ga0207694_10864613 Ga0207694_108646132 75
151 3300025949 Ga0207667_11556269 Ga0207667_115562691 75
152 3300025981 Ga0207640_10000145 Ga0207640_1000014510 75
153 3300025986 Ga0207658_11972465 Ga0207658_119724652 75
154 3300026023 Ga0207677_11793589 Ga0207677_117935891 75
155 3300026041 Ga0207639_10005234 Ga0207639_100052347 75
156 3300026067 Ga0207678_10056269 Ga0207678_100562693 75
157 3300026078 Ga0207702_10003111 Ga0207702_100031112 75
158 3300026142 Ga0207698_10808875 Ga0207698_108088751 75
159 3300031548 Ga0307408_100076794 Ga0307408_1000767941 75
160 3300032126 Ga0307415_100603372 Ga0307415_1006033722 75
161 3300037312 Ga0395899_0000797 Ga0395899_0000797_17942_18169 75
162 3300037418 Ga0395900_0176646 Ga0395900_0176646_1895_2137 75
163 3300037471 Ga0395905_0170339 Ga0395905_0170339_930_1157 75
164 3300037471 Ga0395905_0313534 Ga0395905_0313534_361_603 75
165 3300037471 Ga0395905_1023047 Ga0395905_1023047_82_324 75
166 3300037853 Ga0436364_0852694 Ga0436364_0852694_31212_31439 75
167 3300038443 Ga0395901_0053106 Ga0395901_0053106_3012_3254 75
168 3300039437 Ga0436365_1771744 Ga0436365_1771744_269_496 75
169 3300047472 Ga0495686_0007008 Ga0495686_0007008_6872_7141 75
170 3300048905 Ga0496102_0455490 Ga0496102_0455490_68_295 75
171 3300049515 Ga0501292_000018 Ga0501292_000018_6120_6347 75
172 3300049517 Ga0501294_000220 Ga0501294_000220_2739_2966 75
173 3300049523 Ga0501300_000845 Ga0501300_000845_1703_1930 75
174 3300049524 Ga0501301_040372 Ga0501301_040372_142_369 75
175 3300049525 Ga0501302_002598 Ga0501302_002598_243_470 75
176 3300049551 Ga0501335_018298 Ga0501335_018298_252_479 75
177 3300049652 Ga0501202_010236 Ga0501202_010236_36_263 75
178 3300049653 Ga0501206_000738 Ga0501206_000738_2802_3029 75
179 3300049662 Ga0501222_000155 Ga0501222_000155_2700_2927 75
180 3300049663 Ga0501223_001548 Ga0501223_001548_2734_2961 75
181 3300049664 Ga0501224_001047 Ga0501224_001047_2688_2915 75
182 3300049665 Ga0501227_011750 Ga0501227_011750_658_885 75
183 3300049668 Ga0501233_000942 Ga0501233_000942_1975_2202 75
184 3300049669 Ga0501235_002627 Ga0501235_002627_2662_2889 75
185 3300049670 Ga0501236_001780 Ga0501236_001780_1879_2106 75
186 3300049686 Ga0501257_037928 Ga0501257_037928_118_345 75
187 3300049690 Ga0501261_000422 Ga0501261_000422_2472_2699 75
188 3300049704 Ga0501221_001387 Ga0501221_001387_713_940 75
189 3300049705 Ga0501225_0000955 Ga0501225_0000955_5968_6195 75
190 3300049706 Ga0501229_030174 Ga0501229_030174_235_462 75
191 3300049708 Ga0501245_000633 Ga0501245_000633_2674_2901 75
192 3300049761 Ga0501264_004216 Ga0501264_004216_934_1161 75
193 3300049773 Ga0501276_008073 Ga0501276_008073_164_391 75
194 3300049775 Ga0501279_000007 Ga0501279_000007_138666_138893 75
195 3300049776 Ga0501280_000007 Ga0501280_000007_72506_72733 75
196 3300049777 Ga0501281_00186 Ga0501281_00186_4608_4835 75
197 3300049778 Ga0501282_000162 Ga0501282_000162_4163_4390 75
198 3300049779 Ga0501283_000666 Ga0501283_000666_1474_1701 75
199 3300050512 nmdc:mga0n895_1926289_c1 nmdc:mga0n895_1926289_c1_153_380 75
200 3300001989 JGI24739J22299_10076393 JGI24739J22299_100763932 76
201 3300001990 JGI24737J22298_10015506 JGI24737J22298_100155063 76
202 3300001990 JGI24737J22298_10210541 JGI24737J22298_102105412 76
203 3300002067 JGI24735J21928_10005981 JGI24735J21928_100059812 76
204 3300002067 JGI24735J21928_10013747 JGI24735J21928_100137472 76
205 3300002067 JGI24735J21928_10090892 JGI24735J21928_100908922 76
206 3300002077 JGI24744J21845_10005178 JGI24744J21845_100051781 76
207 3300002244 JGI24742J22300_10003954 JGI24742J22300_100039542 76
208 3300005327 Ga0070658_11162927 Ga0070658_111629271 76
209 3300005328 Ga0070676_10227469 Ga0070676_102274692 76
210 3300005333 Ga0070677_10529614 Ga0070677_105296141 76
211 3300005339 Ga0070660_100222165 Ga0070660_1002221652 76
212 3300005354 Ga0070675_100014731 Ga0070675_1000147315 76
213 3300005356 Ga0070674_100039217 Ga0070674_1000392174 76
214 3300005364 Ga0070673_101055684 Ga0070673_1010556842 76
215 3300005366 Ga0070659_100084581 Ga0070659_1000845812 76
216 3300005539 Ga0068853_101482901 Ga0068853_1014829012 76
217 3300005543 Ga0070672_100103614 Ga0070672_1001036142 76
218 3300005937 Ga0081455_10000212 Ga0081455_1000021278 76
219 3300013100 Ga0157373_11052971 Ga0157373_110529712 76
220 3300014325 Ga0163163_10172115 Ga0163163_101721153 76
221 3300017792 Ga0163161_10090800 Ga0163161_100908003 76
222 3300025893 Ga0207682_10000690 Ga0207682_100006906 76
223 3300025901 Ga0207688_10458941 Ga0207688_104589412 76
224 3300025904 Ga0207647_10134615 Ga0207647_101346152 76
225 3300025909 Ga0207705_11180035 Ga0207705_111800351 76
226 3300025926 Ga0207659_10079918 Ga0207659_100799183 76
227 3300025932 Ga0207690_10256997 Ga0207690_102569972 76
228 3300025937 Ga0207669_10482372 Ga0207669_104823722 76
229 3300025940 Ga0207691_10140497 Ga0207691_101404972 76
230 3300025960 Ga0207651_10782068 Ga0207651_107820681 76
231 3300025986 Ga0207658_11703504 Ga0207658_117035041 76
232 3300026041 Ga0207639_10118509 Ga0207639_101185092 76
233 3300044719 Ga0466971_0484870 Ga0466971_0484870_188_433 76
234 3300044842 Ga0466957_0646253 Ga0466957_0646253_499_729 76
235 3300001989 JGI24739J22299_10025438 JGI24739J22299_100254383 77
236 3300002067 JGI24735J21928_10012035 JGI24735J21928_100120354 77
237 3300002067 JGI24735J21928_10043464 JGI24735J21928_100434642 77
238 3300003322 rootL2_10090057 rootL2_100900571 77
239 3300005339 Ga0070660_101069081 Ga0070660_1010690812 77
240 3300005355 Ga0070671_100581653 Ga0070671_1005816531 77
241 3300005366 Ga0070659_100762779 Ga0070659_1007627792 77
242 3300005455 Ga0070663_100848801 Ga0070663_1008488012 77
243 3300005457 Ga0070662_100020303 Ga0070662_1000203033 77
244 3300005457 Ga0070662_100362999 Ga0070662_1003629992 77
245 3300005457 Ga0070662_101540077 Ga0070662_1015400771 77
246 3300005539 Ga0068853_100043864 Ga0068853_1000438642 77
247 3300005563 Ga0068855_100741668 Ga0068855_1007416681 77
248 3300005578 Ga0068854_100413742 Ga0068854_1004137421 77
249 3300006353 Ga0075370_10021739 Ga0075370_100217394 77
250 3300013100 Ga0157373_10171797 Ga0157373_101717972 77
251 3300013100 Ga0157373_11037792 Ga0157373_110377921 77
252 3300013102 Ga0157371_10067580 Ga0157371_100675801 77
253 3300013105 Ga0157369_11917222 Ga0157369_119172222 77
254 3300013307 Ga0157372_10368806 Ga0157372_103688063 77
255 3300025904 Ga0207647_10015909 Ga0207647_100159095 77
256 3300025904 Ga0207647_10051471 Ga0207647_100514714 77
257 3300025919 Ga0207657_10493547 Ga0207657_104935472 77
258 3300025932 Ga0207690_10470118 Ga0207690_104701182 77
259 3300025933 Ga0207706_10010127 Ga0207706_100101277 77
260 3300025933 Ga0207706_10014467 Ga0207706_100144674 77
261 3300025933 Ga0207706_10100329 Ga0207706_101003294 77
262 3300026041 Ga0207639_10014979 Ga0207639_100149794 77
263 3300026116 Ga0207674_10016578 Ga0207674_100165786 77
264 3300031548 Ga0307408_100524069 Ga0307408_1005240692 77
265 3300031731 Ga0307405_10326973 Ga0307405_103269732 77
266 3300031901 Ga0307406_10924814 Ga0307406_109248142 77
267 3300032005 Ga0307411_11025959 Ga0307411_110259591 77
268 3300042005 Ga0439448_0002270 Ga0439448_0002270_2384_2617 77
269 3300042005 Ga0439448_0032258 Ga0439448_0032258_1362_1595 77
270 3300042005 Ga0439448_0100393 Ga0439448_0100393_415_648 77
271 3300042011 Ga0439454_034327 Ga0439454_034327_446_679 77
272 3300042012 Ga0439455_0000208 Ga0439455_0000208_1930_2163 77
273 3300042012 Ga0439455_0045539 Ga0439455_0045539_413_646 77
274 3300042157 Ga0439458_0000048 Ga0439458_0000048_4694_4927 77
275 3300042157 Ga0439458_0003209 Ga0439458_0003209_3613_3846 77
276 3300046507 Ga0495606_0079069 Ga0495606_0079069_283_516 77
277 3300046694 Ga0495649_0534056 Ga0495649_0534056_290_523 77
278 3300047472 Ga0495686_0000619 Ga0495686_0000619_22505_22741 77
279 3300048091 Ga0495626_0232991 Ga0495626_0232991_441_674 77
280 3300053116 Ga0500592_000653 Ga0500592_000653_3170_3403 77
281 3300053142 Ga0500577_0035909 Ga0500577_0035909_1021_1254 77
282 3300053151 Ga0500604_0175671 Ga0500604_0175671_135_368 77
283 3300053158 Ga0500627_0252202 Ga0500627_0252202_126_359 77
284 3300001979 JGI24740J21852_10033143 JGI24740J21852_100331433 78
285 3300001989 JGI24739J22299_10007028 JGI24739J22299_100070284 78
286 3300001990 JGI24737J22298_10110948 JGI24737J22298_101109482 78
287 3300002067 JGI24735J21928_10013225 JGI24735J21928_100132252 78
288 3300002067 JGI24735J21928_10097522 JGI24735J21928_100975223 78
289 3300002067 JGI24735J21928_10138215 JGI24735J21928_101382151 78
290 3300002070 JGI24750J21931_1000069 JGI24750J21931_100006916 78
291 3300002074 JGI24748J21848_1000066 JGI24748J21848_100006619 78
292 3300002075 JGI24738J21930_10002570 JGI24738J21930_100025703 78
293 3300002076 JGI24749J21850_1003139 JGI24749J21850_10031392 78
294 3300002239 JGI24034J26672_10000015 JGI24034J26672_1000001519 78
295 3300002244 JGI24742J22300_10011783 JGI24742J22300_100117831 78
296 3300002459 JGI24751J29686_10004259 JGI24751J29686_100042592 78
297 3300005327 Ga0070658_10005671 Ga0070658_100056714 78
298 3300005327 Ga0070658_10008987 Ga0070658_100089876 78
299 3300005330 Ga0070690_100000025 Ga0070690_10000002518 78
300 3300005331 Ga0070670_100457586 Ga0070670_1004575862 78
301 3300005334 Ga0068869_100000568 Ga0068869_10000056812 78
302 3300005335 Ga0070666_10000015 Ga0070666_10000015209 78
303 3300005335 Ga0070666_10940773 Ga0070666_109407731 78
304 3300005337 Ga0070682_100206968 Ga0070682_1002069683 78
305 3300005338 Ga0068868_100000133 Ga0068868_10000013330 78
306 3300005339 Ga0070660_100013558 Ga0070660_1000135582 78
307 3300005344 Ga0070661_100018936 Ga0070661_1000189362 78
308 3300005347 Ga0070668_100260766 Ga0070668_1002607662 78
309 3300005353 Ga0070669_100000059 Ga0070669_100000059109 78
310 3300005353 Ga0070669_100018483 Ga0070669_1000184832 78
311 3300005355 Ga0070671_100000769 Ga0070671_10000076920 78
312 3300005355 Ga0070671_100065987 Ga0070671_1000659872 78
313 3300005355 Ga0070671_100191523 Ga0070671_1001915232 78
314 3300005356 Ga0070674_100685301 Ga0070674_1006853011 78
315 3300005364 Ga0070673_100000015 Ga0070673_10000001513 78
316 3300005365 Ga0070688_100001673 Ga0070688_1000016736 78
317 3300005366 Ga0070659_100016487 Ga0070659_1000164872 78
318 3300005366 Ga0070659_101135324 Ga0070659_1011353242 78
319 3300005367 Ga0070667_100009850 Ga0070667_1000098503 78
320 3300005367 Ga0070667_100264209 Ga0070667_1002642091 78
321 3300005455 Ga0070663_100050179 Ga0070663_1000501794 78
322 3300005457 Ga0070662_100022850 Ga0070662_1000228504 78
323 3300005457 Ga0070662_100197126 Ga0070662_1001971262 78
324 3300005457 Ga0070662_100900226 Ga0070662_1009002262 78
325 3300005459 Ga0068867_100000030 Ga0068867_10000003069 78
326 3300005466 Ga0070685_10000297 Ga0070685_1000029718 78
327 3300005535 Ga0070684_101794964 Ga0070684_1017949642 78
328 3300005539 Ga0068853_100862272 Ga0068853_1008622722 78
329 3300005539 Ga0068853_100917703 Ga0068853_1009177032 78
330 3300005544 Ga0070686_100000006 Ga0070686_10000000644 78
331 3300005547 Ga0070693_100876714 Ga0070693_1008767141 78
332 3300005548 Ga0070665_100000217 Ga0070665_10000021795 78
333 3300005548 Ga0070665_100940021 Ga0070665_1009400211 78
334 3300005564 Ga0070664_100183794 Ga0070664_1001837942 78
335 3300005577 Ga0068857_100117562 Ga0068857_1001175622 78
336 3300005577 Ga0068857_102457275 Ga0068857_1024572751 78
337 3300005578 Ga0068854_100137767 Ga0068854_1001377672 78
338 3300005578 Ga0068854_101072578 Ga0068854_1010725781 78
339 3300005614 Ga0068856_101393845 Ga0068856_1013938451 78
340 3300005616 Ga0068852_100004127 Ga0068852_1000041277 78
341 3300005616 Ga0068852_100265821 Ga0068852_1002658212 78
342 3300005616 Ga0068852_102752482 Ga0068852_1027524821 78
343 3300005617 Ga0068859_100169735 Ga0068859_1001697352 78
344 3300005618 Ga0068864_100016871 Ga0068864_1000168712 78
345 3300005718 Ga0068866_10031246 Ga0068866_100312463 78
346 3300005719 Ga0068861_100006381 Ga0068861_1000063812 78
347 3300005834 Ga0068851_10135618 Ga0068851_101356182 78
348 3300005841 Ga0068863_100000108 Ga0068863_10000010882 78
349 3300005842 Ga0068858_100000582 Ga0068858_10000058222 78
350 3300005843 Ga0068860_100000050 Ga0068860_100000050210 78
351 3300005843 Ga0068860_101209191 Ga0068860_1012091912 78
352 3300005844 Ga0068862_100000062 Ga0068862_10000006219 78
353 3300005844 Ga0068862_102108860 Ga0068862_1021088602 78
354 3300006881 Ga0068865_100000021 Ga0068865_10000002113 78
355 3300006931 Ga0097620_100169724 Ga0097620_1001697242 78
356 3300009092 Ga0105250_10036238 Ga0105250_100362382 78
357 3300009093 Ga0105240_10424865 Ga0105240_104248653 78
358 3300009098 Ga0105245_10001778 Ga0105245_1000177814 78
359 3300009148 Ga0105243_12811919 Ga0105243_128119191 78
360 3300009174 Ga0105241_10602281 Ga0105241_106022812 78
361 3300009174 Ga0105241_10815551 Ga0105241_108155512 78
362 3300009176 Ga0105242_10000198 Ga0105242_100001984 78
363 3300009177 Ga0105248_10057834 Ga0105248_100578344 78
364 3300009177 Ga0105248_10088056 Ga0105248_100880562 78
365 3300009545 Ga0105237_10091931 Ga0105237_100919312 78
366 3300009545 Ga0105237_11264326 Ga0105237_112643262 78
367 3300009551 Ga0105238_10074113 Ga0105238_100741132 78
368 3300009553 Ga0105249_10000034 Ga0105249_1000003417 78
369 3300010375 Ga0105239_10345074 Ga0105239_103450742 78
370 3300010375 Ga0105239_11900261 Ga0105239_119002612 78
371 3300011119 Ga0105246_10008205 Ga0105246_100082052 78
372 3300013100 Ga0157373_10417825 Ga0157373_104178251 78
373 3300013102 Ga0157371_10277821 Ga0157371_102778212 78
374 3300013102 Ga0157371_10281042 Ga0157371_102810422 78
375 3300013104 Ga0157370_10000203 Ga0157370_1000020332 78
376 3300013104 Ga0157370_10025393 Ga0157370_100253934 78
377 3300013105 Ga0157369_10060262 Ga0157369_100602624 78
378 3300013306 Ga0163162_10086804 Ga0163162_100868042 78
379 3300013306 Ga0163162_10267707 Ga0163162_102677072 78
380 3300013307 Ga0157372_10255625 Ga0157372_102556253 78
381 3300013307 Ga0157372_10523875 Ga0157372_105238752 78
382 3300014325 Ga0163163_10200655 Ga0163163_102006552 78
383 3300014326 Ga0157380_10002383 Ga0157380_100023838 78
384 3300014968 Ga0157379_10007092 Ga0157379_100070929 78
385 3300017792 Ga0163161_10000051 Ga0163161_10000051135 78
386 3300025223 Ga0207672_1000874 Ga0207672_10008742 78
387 3300025254 Ga0209148_1000061 Ga0209148_1000061256 78
388 3300025272 Ga0209455_1012259 Ga0209455_10122592 78
389 3300025321 Ga0207656_10053333 Ga0207656_100533333 78
390 3300025321 Ga0207656_10430055 Ga0207656_104300552 78
391 3300025711 Ga0207696_1077374 Ga0207696_10773742 78
392 3300025899 Ga0207642_10044275 Ga0207642_100442753 78
393 3300025903 Ga0207680_10000007 Ga0207680_10000007421 78
394 3300025903 Ga0207680_10779963 Ga0207680_107799632 78
395 3300025904 Ga0207647_10001490 Ga0207647_100014909 78
396 3300025907 Ga0207645_10000523 Ga0207645_1000052325 78
397 3300025909 Ga0207705_10000025 Ga0207705_1000002512 78
398 3300025909 Ga0207705_10505140 Ga0207705_105051402 78
399 3300025911 Ga0207654_10008185 Ga0207654_100081855 78
400 3300025911 Ga0207654_10492557 Ga0207654_104925572 78
401 3300025913 Ga0207695_10005706 Ga0207695_100057062 78
402 3300025913 Ga0207695_10006157 Ga0207695_100061579 78
403 3300025914 Ga0207671_10000658 Ga0207671_1000065851 78
404 3300025914 Ga0207671_11381059 Ga0207671_113810592 78
405 3300025919 Ga0207657_10239761 Ga0207657_102397612 78
406 3300025920 Ga0207649_10363768 Ga0207649_103637681 78
407 3300025923 Ga0207681_10000089 Ga0207681_1000008929 78
408 3300025924 Ga0207694_10001347 Ga0207694_1000134722 78
409 3300025924 Ga0207694_10052477 Ga0207694_100524773 78
410 3300025925 Ga0207650_10724279 Ga0207650_107242792 78
411 3300025926 Ga0207659_11516175 Ga0207659_115161751 78
412 3300025927 Ga0207687_10005128 Ga0207687_100051287 78
413 3300025931 Ga0207644_10000657 Ga0207644_100006573 78
414 3300025931 Ga0207644_10032222 Ga0207644_100322221 78
415 3300025931 Ga0207644_10159545 Ga0207644_101595453 78
416 3300025932 Ga0207690_10212213 Ga0207690_102122132 78
417 3300025932 Ga0207690_11068417 Ga0207690_110684172 78
418 3300025933 Ga0207706_10129163 Ga0207706_101291632 78
419 3300025933 Ga0207706_10667468 Ga0207706_106674682 78
420 3300025933 Ga0207706_10667469 Ga0207706_106674692 78
421 3300025933 Ga0207706_10723415 Ga0207706_107234151 78
422 3300025934 Ga0207686_10006212 Ga0207686_100062124 78
423 3300025935 Ga0207709_10000118 Ga0207709_1000011817 78
424 3300025936 Ga0207670_10041724 Ga0207670_100417241 78
425 3300025937 Ga0207669_10111353 Ga0207669_101113533 78
426 3300025938 Ga0207704_10000027 Ga0207704_1000002717 78
427 3300025941 Ga0207711_10019349 Ga0207711_100193492 78
428 3300025941 Ga0207711_10451845 Ga0207711_104518452 78
429 3300025942 Ga0207689_10000584 Ga0207689_1000058410 78
430 3300025945 Ga0207679_11085738 Ga0207679_110857382 78
431 3300025949 Ga0207667_10000035 Ga0207667_10000035115 78
432 3300025949 Ga0207667_10004684 Ga0207667_1000468411 78
433 3300025949 Ga0207667_11139837 Ga0207667_111398371 78
434 3300025960 Ga0207651_10000016 Ga0207651_1000001617 78
435 3300025961 Ga0207712_10000004 Ga0207712_10000004409 78
436 3300025961 Ga0207712_10002574 Ga0207712_100025743 78
437 3300025972 Ga0207668_10012930 Ga0207668_100129302 78
438 3300025972 Ga0207668_10026592 Ga0207668_100265924 78
439 3300025981 Ga0207640_10068931 Ga0207640_100689312 78
440 3300025981 Ga0207640_10144012 Ga0207640_101440122 78
441 3300025986 Ga0207658_10000921 Ga0207658_1000092112 78
442 3300025986 Ga0207658_10167617 Ga0207658_101676172 78
443 3300026023 Ga0207677_10000192 Ga0207677_1000019217 78
444 3300026035 Ga0207703_10001141 Ga0207703_1000114117 78
445 3300026041 Ga0207639_10034891 Ga0207639_100348915 78
446 3300026041 Ga0207639_10070443 Ga0207639_100704434 78
447 3300026041 Ga0207639_10421089 Ga0207639_104210892 78
448 3300026067 Ga0207678_10052501 Ga0207678_100525012 78
449 3300026078 Ga0207702_10007774 Ga0207702_100077748 78
450 3300026078 Ga0207702_10009067 Ga0207702_100090677 78
451 3300026088 Ga0207641_10000428 Ga0207641_1000042835 78
452 3300026089 Ga0207648_10000116 Ga0207648_1000011659 78
453 3300026089 Ga0207648_10750664 Ga0207648_107506641 78
454 3300026095 Ga0207676_10069883 Ga0207676_100698832 78
455 3300026116 Ga0207674_10839814 Ga0207674_108398142 78
456 3300026116 Ga0207674_11097988 Ga0207674_110979881 78
457 3300026118 Ga0207675_100000449 Ga0207675_10000044944 78
458 3300026142 Ga0207698_10001220 Ga0207698_100012207 78
459 3300026142 Ga0207698_10152084 Ga0207698_101520842 78
460 3300026142 Ga0207698_10330596 Ga0207698_103305962 78
461 3300026142 Ga0207698_10876840 Ga0207698_108768402 78
462 3300026142 Ga0207698_11267645 Ga0207698_112676452 78
463 3300028379 Ga0268266_10000225 Ga0268266_1000022518 78
464 3300028380 Ga0268265_10000086 Ga0268265_10000086125 78
465 3300028381 Ga0268264_10000003 Ga0268264_10000003423 78
466 3300028381 Ga0268264_10723527 Ga0268264_107235272 78
467 3300037471 Ga0395905_0132640 Ga0395905_0132640_922_1167 78
468 3300038443 Ga0395901_1163034 Ga0395901_1163034_315_560 78
469 3300041452 Ga0451793_1648096 Ga0451793_1648096_60_305 78
470 3300041460 Ga0451802_2102928 Ga0451802_2102928_209_454 78
471 3300041462 Ga0451806_677182 Ga0451806_677182_481_726 78
472 3300041486 Ga0451807_0002806 Ga0451807_0002806_1450_1695 78
473 3300041492 Ga0451835_0931463 Ga0451835_0931463_39_284 78
474 3300041512 Ga0451853_0066861 Ga0451853_0066861_215_460 78
475 3300042005 Ga0439448_0069177 Ga0439448_0069177_795_1040 78
476 3300044658 Ga0466972_0009310 Ga0466972_0009310_4331_4576 78
477 3300044683 Ga0466965_0198251 Ga0466965_0198251_670_915 78
478 3300044706 Ga0466964_0317573 Ga0466964_0317573_87_332 78
479 3300044735 Ga0466968_0031985 Ga0466968_0031985_1674_1919 78
480 3300044765 Ga0466970_0398999 Ga0466970_0398999_44_289 78
481 3300045976 Ga0466967_1513300 Ga0466967_1513300_352_588 78
482 3300046460 Ga0495638_0011356 Ga0495638_0011356_736_984 78
483 3300046506 Ga0495583_0000212 Ga0495583_0000212_48809_49057 78
484 3300046507 Ga0495606_0001173 Ga0495606_0001173_28516_28755 78
485 3300046512 Ga0495610_0148564 Ga0495610_0148564_73_318 78
486 3300046665 Ga0495661_0402718 Ga0495661_0402718_26_274 78
487 3300046691 Ga0495670_0006695 Ga0495670_0006695_1696_1944 78
488 3300048904 Ga0496101_0952762 Ga0496101_0952762_189_434 78
489 3300048904 Ga0496101_1148843 Ga0496101_1148843_215_451 78
490 3300048905 Ga0496102_0000100 Ga0496102_0000100_86382_86627 78
491 3300048905 Ga0496102_0004941 Ga0496102_0004941_7642_7878 78
492 3300048906 Ga0496103_0000070 Ga0496103_0000070_86363_86608 78
493 3300048906 Ga0496103_0001574 Ga0496103_0001574_9400_9636 78
494 3300048907 Ga0496104_0720331 Ga0496104_0720331_278_514 78
495 3300048908 Ga0496105_0225332 Ga0496105_0225332_292_528 78
496 3300048909 Ga0496106_0506783 Ga0496106_0506783_569_805 78
497 3300048910 Ga0496107_0121756 Ga0496107_0121756_1140_1376 78
498 3300048914 Ga0496111_0078104 Ga0496111_0078104_1572_1808 78
499 3300048919 Ga0496116_0001752 Ga0496116_0001752_15457_15702 78
500 3300048919 Ga0496116_0024938 Ga0496116_0024938_245_481 78
501 3300048920 Ga0496117_0000194 Ga0496117_0000194_86382_86627 78
502 3300048920 Ga0496117_0005305 Ga0496117_0005305_4953_5195 78
503 3300048920 Ga0496117_0006563 Ga0496117_0006563_2106_2342 78
504 3300048920 Ga0496117_0090371 Ga0496117_0090371_306_581 78
505 3300048920 Ga0496117_0137219 Ga0496117_0137219_111_347 78
506 3300048921 Ga0496118_0000146 Ga0496118_0000146_86382_86627 78
507 3300048921 Ga0496118_0001200 Ga0496118_0001200_21577_21819 78
508 3300048921 Ga0496118_0017907 Ga0496118_0017907_3074_3310 78
509 3300048921 Ga0496118_0109080 Ga0496118_0109080_1546_1782 78
510 3300048921 Ga0496118_0271653 Ga0496118_0271653_608_862 78
511 3300048921 Ga0496118_0352023 Ga0496118_0352023_206_481 78
512 3300048922 Ga0496119_0068394 Ga0496119_0068394_953_1198 78
513 3300048923 Ga0496120_0148537 Ga0496120_0148537_772_1017 78
514 3300048924 Ga0496121_0028649 Ga0496121_0028649_2139_2381 78
515 3300048924 Ga0496121_0154276 Ga0496121_0154276_1201_1476 78
516 3300048926 Ga0496123_0023294 Ga0496123_0023294_20_295 78
517 3300048927 Ga0496124_0000185 Ga0496124_0000185_36905_37150 78
518 3300048927 Ga0496124_0081232 Ga0496124_0081232_1618_1860 78
519 3300048927 Ga0496124_0618646 Ga0496124_0618646_259_495 78
520 3300048929 Ga0496126_0509332 Ga0496126_0509332_349_594 78
521 3300049460 Ga0495682_0014769 Ga0495682_0014769_141_389 78
522 3300049570 Ga0501033_0549341 Ga0501033_0549341_480_716 78
523 3300049822 Ga0501035_0114070 Ga0501035_0114070_1930_2166 78
524 3300053103 Ga0500555_000216 Ga0500555_000216_5066_5314 78
525 3300053125 Ga0500618_028148 Ga0500618_028148_552_797 78
526 3300053140 Ga0500573_0486957 Ga0500573_0486957_69_311 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13467

RHH_4

Ribbon-helix-helix domain

4

71

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3i-assembly1.cif.gz_A non-ribosomal pcp-c didomain (thioether stabilised glycolic acid) acceptor bound state 0.9485 18 49
4ucb-assembly2.cif.gz_A n-terminal globular domain of the rsv nucleoprotein in complex with c- terminal peptide of the phosphoprotein 0.8982 4 20
3kk4-assembly2.cif.gz_D uncharacterized protein bp1543 from bordetella pertussis tohama i 0.833 3 76
4uc6-assembly2.cif.gz_B n-terminal globular domain of the rsv nucleoprotein 0.8319 4 20
6sbw-assembly1.cif.gz_A cdba form one 0.83 14 52
ID Description Score Start End Superfamily
af_A0A1D6M1N2_58_455_3.40.50.12710 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8495 2 31 3.40.50.12710
1ea4G00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8201 16 53 1.10.1220.10
3kk4B01 Mainly Alpha;Orthogonal Bundle;Ribbon-helix-helix fold;protein bp1543 0.812 3 76 1.10.3990.20
af_Q95QW4_449_561_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.8056 4 21 3.30.70.1350
1ea4E00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8041 16 55 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A2G2GC88-F1-model_v4 Aryl-sulfate sulfotransferase 0.9956 4 73 GO:0016740
AF-A0A4R1WDK9-F1-model_v4 Putative DNA-binding ribbon-helix-helix protein 0.9937 3 71 GO:0003677
AF-A0A2T5G237-F1-model_v4 Ribbon-helix-helix domain-containing protein 0.993 3 77
AF-A0A1X7G7D1-F1-model_v4 Ribbon-helix-helix domain-containing protein 0.9919 3 71
AF-A0A845AAI2-F1-model_v4 Aryl-sulfate sulfotransferase 0.9909 3 77 GO:0016740

Feature Viewer

pLDDT pTM Quality
84.41 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map