F459475

General Info

Members Datasets Scaffolds Average Seq Length
526 289 464 200

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0029268|Ga0501033_0029268_171_848
Length 225
Sequence MKEQISHLSRLQAQIYWLHPFTDQAGIMKIVLIGATGFLGSAIAHELGTDHELIPASRSSSSHPVDIRDDASVRALFEKTGAVDAIISAAGRVHFGPLIRMTAEQFNTGLQDKLLGQVRLALIGQDYLLPGGSITLTTGILSDAAIRDGANAMSVNAGIEGFIRAASFELRDRRINAVSPGLLAEAKEAYGNAFPGFEPVPAARAALAFRRSIEGIETGQVYRVW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
5 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
8 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
9 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
10 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
13 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
14 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
15 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
16 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
17 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
18 2643221593 Lysobacter sp. Root690 Isolate Unclassified
19 2643221717 Acidovorax sp. Root267 Isolate Unclassified
20 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
21 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
22 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
23 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
24 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
25 2734482264 Dyella sp. AD052 Isolate Unclassified
26 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
27 2751185917 Enterobacter sp. HK169 Isolate Unclassified
28 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
29 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
30 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
31 2818991452 Burkholderia cepacia 561 Isolate Unclassified
32 2821118458 Enterobacter asburiae 609 Isolate Unclassified
33 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
34 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
35 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
36 2885266251 Ralstonia sp. SET104 Isolate Nodule
37 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
38 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
39 2919085039 Luteibacter sp. 1214 Isolate Unclassified
40 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
41 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
42 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
43 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
44 2928058823 Ralstonia sp. 1138 Isolate Unclassified
45 2928170801 Burkholderia sp. 572 Isolate Unclassified
46 2937539931 Pantoea sp. LS15 Isolate Unclassified
47 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
48 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
49 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
50 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
51 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
52 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
53 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
54 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
55 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
56 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
57 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
60 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
61 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
62 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
64 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
65 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
66 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
67 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
68 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
69 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
70 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
71 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
115 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
116 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
117 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
179 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
180 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
192 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
193 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
194 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
281 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 8018221730 Enterobacter sp. CM29 Isolate Unclassified
284 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
285 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
286 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
287 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
288 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
289 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.07
Metatranscriptomes 1.14
Isolates 11.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.4
Nodule 2.85
Rhizoplane 4.75
Rhizosphere 48.67
Stem 0
Stem Tuber 0
Unclassified 28.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2956067 2162886007 Bacteria 8481
2 SwRhRL2b_contig_368673 2162886007 Bacteria 5429
3 JGI24741J21665_1000029 3300001915 Bacteria 34366
4 JGI24740J21852_10001907 3300001979 Bacteria 9563
5 JGI24740J21852_10004481 3300001979 Bacteria 6011
6 JGI25156J39149_1004467 3300002705 Bacteria 4258
7 JGI25154J39366_1000285 3300002738 Bacteria 30441
8 JGI25151J46595_10000116 3300003187 Bacteria 107172
9 JGI25406J46586_10081719 3300003203 Bacteria 990
10 rootH2_10194572 3300003320 Bacteria 1256
11 rootL2_10116472 3300003322 Bacteria 2560
12 Ga0006562J51391_1178845 3300003578 Bacteria 2400
13 Ga0055538_1005507 3300003751 Bacteria 1304
14 Ga0055538_1005564 3300003751 Bacteria 1294
15 Ga0055539_1000236 3300003752 Bacteria 37511
16 Ga0055533_1001773 3300003756 Bacteria 5471
17 Ga0055533_1002940 3300003756 Bacteria 3657
18 Ga0055533_1005159 3300003756 Bacteria 2164
19 Ga0055532_1000114 3300003758 Bacteria 85635
20 Ga0055532_1000149 3300003758 Bacteria 66954
21 Ga0055532_1000260 3300003758 Bacteria 35442
22 Ga0055525_1001067 3300003759 Bacteria 7003
23 Ga0055527_1000315 3300003760 Bacteria 26071
24 Ga0055527_1001115 3300003760 Bacteria 6204
25 Ga0055535_1000180 3300003761 Bacteria 66954
26 Ga0055535_1000485 3300003761 Bacteria 35896
27 Ga0055542_1000489 3300003762 Bacteria 36510
28 Ga0055542_1000500 3300003762 Bacteria 35962
29 Ga0055542_1001202 3300003762 Bacteria 14673
30 Ga0055542_1015955 3300003762 Bacteria 1194
31 Ga0055529_1000245 3300003763 Bacteria 66949
32 Ga0055529_1000362 3300003763 Bacteria 49543
33 Ga0055526_1001042 3300003771 Bacteria 20255
34 Ga0055536_1001499 3300003781 Bacteria 14038
35 Ga0055528_1000469 3300003790 Bacteria 32307
36 Ga0055528_1002085 3300003790 Bacteria 11109
37 Ga0055541_1002958 3300003841 Bacteria 3274
38 Ga0055541_1005015 3300003841 Bacteria 2352
39 Ga0055541_1008537 3300003841 Bacteria 1627
40 Ga0058692_1002025 3300003856 Bacteria 7033
41 Ga0058692_1002193 3300003856 Bacteria 6661
42 Ga0055543_1005421 3300004625 Bacteria 3259
43 Ga0065165_1000204 3300005262 Bacteria 102828
44 Ga0065704_10000308 3300005289 Bacteria 43047
45 Ga0065704_10001705 3300005289 Bacteria 10059
46 Ga0065704_10199875 3300005289 Bacteria 1149
47 Ga0070661_100000048 3300005344 Bacteria 91068
48 Ga0070669_100310440 3300005353 Bacteria 1271
49 Ga0070659_100001214 3300005366 Bacteria 18706
50 Ga0070659_100076734 3300005366 Bacteria 2664
51 Ga0070663_100000001 3300005455 Bacteria 318372
52 Ga0070665_100000710 3300005548 Bacteria 44344
53 Ga0070665_100078022 3300005548 Bacteria 3319
54 Ga0070664_100000016 3300005564 Bacteria 128509
55 Ga0068857_100000029 3300005577 Bacteria 79677
56 Ga0068857_100010988 3300005577 Bacteria 7881
57 Ga0068857_100976695 3300005577 Bacteria 814
58 Ga0068854_100000124 3300005578 Bacteria 53140
59 Ga0068856_100000047 3300005614 Bacteria 108894
60 Ga0068852_100760821 3300005616 Bacteria 981
61 Ga0075364_10001959 3300006051 Bacteria 11472
62 Ga0075369_10160819 3300006186 Bacteria 1029
63 Ga0075366_10089983 3300006195 Bacteria 1838
64 Ga0079104_1000389 3300006946 Bacteria 50889
65 Ga0079104_1002089 3300006946 Bacteria 11443
66 Ga0079104_1002960 3300006946 Bacteria 8374
67 Ga0079104_1004157 3300006946 Bacteria 6327
68 Ga0079104_1005002 3300006946 Bacteria 5441
69 Ga0079104_1037373 3300006946 Bacteria 1157
70 Ga0105251_10000091 3300009011 Bacteria 87246
71 Ga0105251_10000504 3300009011 Bacteria 37013
72 Ga0105251_10005967 3300009011 Bacteria 7865
73 Ga0105251_10006453 3300009011 Bacteria 7465
74 Ga0105251_10076512 3300009011 Bacteria 1553
75 Ga0105251_10211010 3300009011 Bacteria 874
76 Ga0105244_10000009 3300009036 Bacteria 286143
77 Ga0105244_10000388 3300009036 Bacteria 40818
78 Ga0105244_10000397 3300009036 Bacteria 40343
79 Ga0105244_10000600 3300009036 Bacteria 32084
80 Ga0105244_10001687 3300009036 Bacteria 17442
81 Ga0105244_10078398 3300009036 Bacteria 1638
82 Ga0105250_10000081 3300009092 Bacteria 83010
83 Ga0105250_10001507 3300009092 Bacteria 12566
84 Ga0105250_10004569 3300009092 Bacteria 6344
85 Ga0105250_10072594 3300009092 Bacteria 1391
86 Ga0105250_10262394 3300009092 Bacteria 740
87 Ga0105240_10000363 3300009093 Bacteria 85111
88 Ga0105240_10031849 3300009093 Bacteria 6832
89 Ga0105240_10783177 3300009093 Bacteria 1034
90 Ga0105243_10002546 3300009148 Bacteria 15228
91 Ga0105243_10480499 3300009148 Bacteria 1172
92 Ga0105238_10098259 3300009551 Bacteria 2912
93 Ga0105148_100777 3300009978 Bacteria 2391
94 Ga0105239_10179073 3300010375 Bacteria 2371
95 Ga0157373_10001283 3300013100 Bacteria 19190
96 Ga0157373_10278100 3300013100 Bacteria 1186
97 Ga0157373_10312003 3300013100 Bacteria 1118
98 Ga0157371_10000080 3300013102 Bacteria 152121
99 Ga0157371_10000841 3300013102 Bacteria 35126
100 Ga0157370_10000032 3300013104 Bacteria 138963
101 Ga0157370_10000837 3300013104 Bacteria 39048
102 Ga0157370_10003458 3300013104 Bacteria 18521
103 Ga0157370_10033422 3300013104 Bacteria 5015
104 Ga0157369_10004526 3300013105 Bacteria 16359
105 Ga0157372_10004343 3300013307 Bacteria 15138
106 Ga0182008_10034225 3300014497 Bacteria 2547
107 Ga0182006_1000189 3300015261 Bacteria 64215
108 Ga0182006_1010026 3300015261 Bacteria 4226
109 Ga0182006_1030513 3300015261 Bacteria 2178
110 Ga0182006_1089111 3300015261 Bacteria 1113
111 Ga0182007_10001472 3300015262 Bacteria 12616
112 Ga0182007_10002663 3300015262 Bacteria 8769
113 Ga0182007_10023437 3300015262 Bacteria 2170
114 Ga0182007_10053625 3300015262 Bacteria 1327
115 Ga0182005_1000015 3300015265 Bacteria 387565
116 Ga0182005_1014056 3300015265 Bacteria 2245
117 Ga0182005_1102179 3300015265 Bacteria 804
118 Ga0183366_1002 3300015679 Bacteria 791639
119 Ga0183370_1002 3300015680 Bacteria 791639
120 Ga0183369_1002 3300015685 Bacteria 791621
121 Ga0183368_1005 3300015687 Bacteria 791621
122 Ga0206356_11637714 3300020070 Bacteria 857
123 Ga0206351_10740334 3300020077 Bacteria 1263
124 Ga0213876_10000444 3300021384 Bacteria 33655
125 Ga0209784_100006 3300025224 Bacteria 930704
126 Ga0209784_100472 3300025224 Bacteria 16603
127 Ga0209784_100785 3300025224 Bacteria 7603
128 Ga0209566_100002 3300025225 Bacteria 2614868
129 Ga0209566_100274 3300025225 Bacteria 48108
130 Ga0209566_100303 3300025225 Bacteria 44626
131 Ga0209566_101439 3300025225 Bacteria 7035
132 Ga0209674_100010 3300025226 Bacteria 1038638
133 Ga0209674_100176 3300025226 Bacteria 79399
134 Ga0209674_100206 3300025226 Bacteria 59401
135 Ga0209674_100810 3300025226 Bacteria 10420
136 Ga0209674_100840 3300025226 Bacteria 10167
137 Ga0209674_101353 3300025226 Bacteria 6680
138 Ga0209672_100057 3300025228 Bacteria 215485
139 Ga0209672_101773 3300025228 Bacteria 6731
140 Ga0209147_100018 3300025229 Bacteria 515719
141 Ga0209147_100037 3300025229 Bacteria 326977
142 Ga0209147_100047 3300025229 Bacteria 288873
143 Ga0209563_100041 3300025230 Bacteria 407467
144 Ga0209437_103468 3300025233 Bacteria 2853
145 Ga0209258_100028 3300025242 Bacteria 515719
146 Ga0209258_100065 3300025242 Bacteria 288500
147 Ga0207425_1010930 3300025245 Bacteria 2189
148 Ga0209646_1000043 3300025246 Bacteria 343652
149 Ga0209026_1003038 3300025250 Bacteria 5773
150 Ga0209677_100007 3300025253 Bacteria 1021332
151 Ga0209677_103421 3300025253 Bacteria 5178
152 Ga0209148_1000091 3300025254 Bacteria 250913
153 Ga0209148_1000348 3300025254 Bacteria 60117
154 Ga0209148_1001887 3300025254 Bacteria 8660
155 Ga0209759_1002646 3300025256 Bacteria 7700
156 Ga0209759_1009810 3300025256 Bacteria 2864
157 Ga0209759_1016699 3300025256 Bacteria 1841
158 Ga0209455_1000065 3300025272 Bacteria 321272
159 Ga0209455_1000074 3300025272 Bacteria 289143
160 Ga0209455_1000249 3300025272 Bacteria 64535
161 Ga0209673_1000022 3300025273 Bacteria 413125
162 Ga0209673_1000198 3300025273 Bacteria 121230
163 Ga0209675_1018129 3300025291 Bacteria 1979
164 Ga0209676_1000037 3300025292 Bacteria 457562
165 Ga0209025_1000023 3300025294 Bacteria 541307
166 Ga0209564_1000707 3300025295 Bacteria 48703
167 Ga0209758_1034541 3300025297 Bacteria 2009
168 Ga0209256_1001202 3300025299 Bacteria 29012
169 Ga0209257_1054949 3300025304 Bacteria 1106
170 Ga0207696_1000008 3300025711 Bacteria 568181
171 Ga0207696_1000012 3300025711 Bacteria 527363
172 Ga0207696_1000024 3300025711 Bacteria 420123
173 Ga0207696_1002212 3300025711 Bacteria 9734
174 Ga0207655_1000004 3300025728 Bacteria 1021221
175 Ga0207655_1000020 3300025728 Bacteria 524503
176 Ga0207655_1000088 3300025728 Bacteria 205698
177 Ga0207655_1000103 3300025728 Bacteria 185076
178 Ga0207655_1000439 3300025728 Bacteria 55457
179 Ga0207655_1002601 3300025728 Bacteria 14354
180 Ga0207713_1000076 3300025735 Bacteria 178268
181 Ga0207713_1000134 3300025735 Bacteria 112419
182 Ga0207713_1000167 3300025735 Bacteria 95979
183 Ga0207713_1001422 3300025735 Bacteria 19178
184 Ga0207713_1002804 3300025735 Bacteria 12302
185 Ga0207713_1026307 3300025735 Bacteria 2669
186 Ga0207713_1026459 3300025735 Bacteria 2658
187 Ga0207713_1041531 3300025735 Bacteria 1918
188 Ga0207713_1048852 3300025735 Bacteria 1701
189 Ga0207710_10004653 3300025900 Bacteria 5954
190 Ga0207695_10000473 3300025913 Bacteria 87226
191 Ga0207695_10000872 3300025913 Bacteria 54945
192 Ga0207695_10721019 3300025913 Bacteria 877
193 Ga0207649_10000200 3300025920 Bacteria 49831
194 Ga0207681_10253641 3300025923 Bacteria 1374
195 Ga0207694_10047931 3300025924 Bacteria 3305
196 Ga0207690_10003490 3300025932 Bacteria 9376
197 Ga0207690_10055698 3300025932 Bacteria 2664
198 Ga0207709_10001635 3300025935 Bacteria 15227
199 Ga0207709_10171218 3300025935 Bacteria 1524
200 Ga0207679_10000012 3300025945 Bacteria 339773
201 Ga0207640_10000047 3300025981 Bacteria 98563
202 Ga0207678_10000028 3300026067 Bacteria 115277
203 Ga0207702_10000255 3300026078 Bacteria 61384
204 Ga0207674_10000160 3300026116 Bacteria 79959
205 Ga0207674_10007892 3300026116 Bacteria 12363
206 Ga0207674_10164583 3300026116 Bacteria 2172
207 Ga0207698_11250305 3300026142 Bacteria 757
208 Ga0209281_1000056 3300027111 Bacteria 307619
209 Ga0209281_1000193 3300027111 Bacteria 139827
210 Ga0209281_1000353 3300027111 Bacteria 75712
211 Ga0209281_1000529 3300027111 Bacteria 48645
212 Ga0209281_1000531 3300027111 Bacteria 48488
213 Ga0209281_1001215 3300027111 Bacteria 17396
214 Ga0209281_1002041 3300027111 Bacteria 9124
215 Ga0209371_1000013 3300027312 Bacteria 691516
216 Ga0209371_1000144 3300027312 Bacteria 117738
217 Ga0209371_1000333 3300027312 Bacteria 51420
218 Ga0209371_1006459 3300027312 Bacteria 4335
219 Ga0268266_10000211 3300028379 Bacteria 101045
220 Ga0268266_10280426 3300028379 Bacteria 1549
221 Ga0268256_1000014 3300030500 Bacteria 691435
222 Ga0268256_1000145 3300030500 Bacteria 95907
223 Ga0268256_1000375 3300030500 Bacteria 42432
224 Ga0265327_10039590 3300031251 Bacteria 2559
225 Ga0307408_100122220 3300031548 Bacteria 2019
226 Ga0307406_10217454 3300031901 Bacteria 1418
227 Ga0307416_100426643 3300032002 Bacteria 1372
228 Ga0316593_10009566 3300032168 Bacteria 2743
229 Ga0316593_10052379 3300032168 Bacteria 1381
230 Ga0316593_10162091 3300032168 Bacteria 817
231 Ga0395900_0091053 3300037418 Bacteria 3134
232 Ga0395905_0690268 3300037471 Bacteria 923
233 Ga0237819_07221 3300038705 Bacteria 1609
234 Ga0436365_1801698 3300039437 Bacteria 33582
235 Ga0436361_0633524 3300039447 Bacteria 673
236 Ga0436361_0799455 3300039447 Bacteria 1043
237 Ga0439438_003371 3300041405 Bacteria 6468
238 Ga0439465_0038915 3300041413 Bacteria 1533
239 Ga0451835_0639300 3300041492 Bacteria 2437
240 Ga0451837_0931796 3300041494 Bacteria 2274
241 Ga0451845_0259733 3300041501 Bacteria 2264
242 Ga0451849_0367902 3300041505 Bacteria 2167
243 Ga0451851_0649712 3300041507 Bacteria 2436
244 Ga0451843_1251418 3300041509 Bacteria 2322
245 Ga0451853_3574735 3300041512 Bacteria 6195
246 Ga0439452_000052 3300042010 Bacteria 116502
247 Ga0439452_000094 3300042010 Bacteria 75452
248 Ga0439463_001437 3300042016 Bacteria 6324
249 Ga0450906_031925 3300042145 Bacteria 931
250 Ga0450908_000008 3300042184 Bacteria 54808
251 Ga0439464_0003641 3300042439 Bacteria 3906
252 Ga0466986_0028249 3300044650 Bacteria 3785
253 Ga0466969_0097830 3300044656 Bacteria 1384
254 Ga0466969_0296791 3300044656 Bacteria 731
255 Ga0466972_0005336 3300044658 Bacteria 6438
256 Ga0466977_0020550 3300044666 Bacteria 4072
257 Ga0466981_0000036 3300044669 Bacteria 60421
258 Ga0466978_0145178 3300044671 Bacteria 1451
259 Ga0466982_0000041 3300044672 Bacteria 40889
260 Ga0466965_0025283 3300044683 Bacteria 2874
261 Ga0466965_0145420 3300044683 Bacteria 1237
262 Ga0466961_0000722 3300044693 Bacteria 20781
263 Ga0466961_0038824 3300044693 Bacteria 3053
264 Ga0466964_0002950 3300044706 Bacteria 6147
265 Ga0466971_0021273 3300044719 Bacteria 2887
266 Ga0466968_0069804 3300044735 Bacteria 1527
267 Ga0466970_0000986 3300044765 Bacteria 13695
268 Ga0466970_0047942 3300044765 Bacteria 2277
269 Ga0466957_0053279 3300044842 Bacteria 2466
270 Ga0466957_0228718 3300044842 Bacteria 1230
271 Ga0466959_0001982 3300045049 Bacteria 12897
272 Ga0466959_0016007 3300045049 Bacteria 5472
273 Ga0466958_0002254 3300045836 Bacteria 9606
274 Ga0466967_0047763 3300045976 Bacteria 3733
275 Ga0495627_057099 3300046453 Bacteria 1162
276 Ga0495590_0013260 3300046457 Bacteria 3036
277 Ga0495591_000115 3300046458 Bacteria 92705
278 Ga0495591_001555 3300046458 Bacteria 14006
279 Ga0495638_0000278 3300046460 Bacteria 69374
280 Ga0495638_0002796 3300046460 Bacteria 14002
281 Ga0495651_0002782 3300046462 Bacteria 13570
282 Ga0495653_0002742 3300046463 Bacteria 14035
283 Ga0495650_0000059 3300046471 Bacteria 296253
284 Ga0495650_0002065 3300046471 Bacteria 17411
285 Ga0495650_0009178 3300046471 Bacteria 5663
286 Ga0495650_0143050 3300046471 Bacteria 864
287 Ga0495605_0117844 3300046474 Bacteria 1206
288 Ga0495584_0076176 3300046491 Bacteria 1687
289 Ga0495585_0001919 3300046492 Bacteria 15568
290 Ga0495585_0076579 3300046492 Bacteria 1817
291 Ga0495607_0000117 3300046501 Bacteria 83890
292 Ga0495607_0003514 3300046501 Bacteria 11972
293 Ga0495583_0031245 3300046506 Bacteria 2583
294 Ga0495606_0083544 3300046507 Bacteria 1980
295 Ga0495608_0012300 3300046511 Bacteria 5945
296 Ga0495620_0001348 3300046515 Bacteria 14884
297 Ga0495628_0003625 3300046516 Bacteria 13799
298 Ga0495631_0102231 3300046518 Bacteria 1233
299 Ga0495632_0008732 3300046519 Bacteria 6178
300 Ga0495632_0014038 3300046519 Bacteria 4547
301 Ga0495632_0229143 3300046519 Bacteria 838
302 Ga0495637_0014001 3300046520 Bacteria 3794
303 Ga0495643_0009799 3300046522 Bacteria 5927
304 Ga0495663_0002968 3300046525 Bacteria 4989
305 Ga0495652_0016504 3300046529 Bacteria 6605
306 Ga0495654_0022222 3300046530 Bacteria 3295
307 Ga0495609_0002720 3300046538 Bacteria 10669
308 Ga0495609_0199591 3300046538 Bacteria 836
309 Ga0495633_0012640 3300046558 Bacteria 4481
310 Ga0495668_0001645 3300046616 Bacteria 20849
311 Ga0495611_0000059 3300046648 Bacteria 78609
312 Ga0495625_0000288 3300046660 Bacteria 77990
313 Ga0495625_0202086 3300046660 Bacteria 1311
314 Ga0495661_0000907 3300046665 Bacteria 27196
315 Ga0495661_0008669 3300046665 Bacteria 7027
316 Ga0495661_0030309 3300046665 Bacteria 3445
317 Ga0495623_0018755 3300046679 Bacteria 4467
318 Ga0495670_0019455 3300046691 Bacteria 3346
319 Ga0495670_0045778 3300046691 Bacteria 2184
320 Ga0495671_0001225 3300046692 Bacteria 17565
321 Ga0495671_0138670 3300046692 Bacteria 1185
322 Ga0495649_0006594 3300046694 Bacteria 7217
323 Ga0495589_0000056 3300046794 Bacteria 109990
324 Ga0495660_0000295 3300046810 Bacteria 45627
325 Ga0495660_0000304 3300046810 Bacteria 44534
326 Ga0495672_0027062 3300047320 Plasmid 3650
327 Ga0495679_000010 3300047446 Bacteria 337760
328 Ga0495679_007930 3300047446 Bacteria 4370
329 Ga0495679_019356 3300047446 Bacteria 2393
330 Ga0495673_0000176 3300047469 Bacteria 103274
331 Ga0495673_0000240 3300047469 Bacteria 77586
332 Ga0495673_0000244 3300047469 Bacteria 76503
333 Ga0495673_0032813 3300047469 Bacteria 2416
334 Ga0495681_0013022 3300047470 Bacteria 4854
335 Ga0495686_0000311 3300047472 Bacteria 82066
336 Ga0495602_0201498 3300048088 Bacteria 1518
337 Ga0496100_0273673 3300048903 Bacteria 1256
338 Ga0496101_0313357 3300048904 Bacteria 1230
339 Ga0496102_0797338 3300048905 Bacteria 867
340 Ga0496104_0000192 3300048907 Bacteria 55129
341 Ga0496104_0067664 3300048907 Bacteria 3394
342 Ga0496104_0281400 3300048907 Bacteria 1576
343 Ga0496105_0002705 3300048908 Bacteria 12924
344 Ga0496105_0002749 3300048908 Bacteria 12838
345 Ga0496106_0000285 3300048909 Bacteria 35780
346 Ga0496112_0007838 3300048915 Bacteria 9506
347 Ga0496113_0723045 3300048916 Bacteria 794
348 Ga0496116_0002472 3300048919 Bacteria 19364
349 Ga0496116_0013787 3300048919 Bacteria 6492
350 Ga0496116_0037127 3300048919 Bacteria 3400
351 Ga0496116_0081347 3300048919 Bacteria 2008
352 Ga0496116_0105493 3300048919 Bacteria 1671
353 Ga0496117_0001355 3300048920 Bacteria 35859
354 Ga0496117_0002873 3300048920 Bacteria 20920
355 Ga0496117_0013220 3300048920 Bacteria 7215
356 Ga0496117_0018060 3300048920 Bacteria 5864
357 Ga0496117_0033095 3300048920 Bacteria 3914
358 Ga0496117_0044699 3300048920 Bacteria 3205
359 Ga0496117_0051120 3300048920 Bacteria 2924
360 Ga0496118_0001069 3300048921 Bacteria 42748
361 Ga0496118_0001374 3300048921 Bacteria 36687
362 Ga0496118_0001482 3300048921 Bacteria 35136
363 Ga0496118_0008581 3300048921 Bacteria 10517
364 Ga0496118_0035322 3300048921 Bacteria 4060
365 Ga0496118_0176629 3300048921 Bacteria 1296
366 Ga0496118_0186376 3300048921 Bacteria 1246
367 Ga0496118_0367483 3300048921 Bacteria 760
368 Ga0496119_0001027 3300048922 Bacteria 35766
369 Ga0496119_0001235 3300048922 Bacteria 31828
370 Ga0496119_0004779 3300048922 Bacteria 13294
371 Ga0496119_0007076 3300048922 Bacteria 10203
372 Ga0496119_0011298 3300048922 Bacteria 7416
373 Ga0496119_0045153 3300048922 Bacteria 2765
374 Ga0496119_0050488 3300048922 Bacteria 2563
375 Ga0496119_0050662 3300048922 Bacteria 2557
376 Ga0496120_0000585 3300048923 Bacteria 55383
377 Ga0496120_0000898 3300048923 Bacteria 41805
378 Ga0496120_0002600 3300048923 Bacteria 17912
379 Ga0496120_0002816 3300048923 Bacteria 16798
380 Ga0496120_0004130 3300048923 Bacteria 12503
381 Ga0496120_0014121 3300048923 Bacteria 5334
382 Ga0496120_0042109 3300048923 Bacteria 2668
383 Ga0496120_0097006 3300048923 Bacteria 1564
384 Ga0496120_0217994 3300048923 Bacteria 913
385 Ga0496121_0000358 3300048924 Bacteria 93865
386 Ga0496121_0000403 3300048924 Bacteria 86293
387 Ga0496121_0000756 3300048924 Bacteria 59448
388 Ga0496121_0001449 3300048924 Bacteria 40031
389 Ga0496121_0001508 3300048924 Bacteria 39115
390 Ga0496121_0009137 3300048924 Bacteria 11465
391 Ga0496121_0011108 3300048924 Bacteria 10049
392 Ga0496121_0012494 3300048924 Bacteria 9248
393 Ga0496121_0021422 3300048924 Bacteria 6330
394 Ga0496121_0039996 3300048924 Bacteria 4120
395 Ga0496121_0169938 3300048924 Bacteria 1585
396 Ga0496121_0283847 3300048924 Bacteria 1131
397 Ga0496121_0406121 3300048924 Bacteria 890
398 Ga0496122_0000170 3300048925 Bacteria 154389
399 Ga0496122_0002886 3300048925 Bacteria 23509
400 Ga0496122_0010356 3300048925 Bacteria 9634
401 Ga0496122_0011293 3300048925 Bacteria 9068
402 Ga0496122_0014236 3300048925 Bacteria 7706
403 Ga0496122_0029091 3300048925 Bacteria 4670
404 Ga0496122_0047465 3300048925 Bacteria 3315
405 Ga0496122_0077489 3300048925 Bacteria 2333
406 Ga0496122_0200485 3300048925 Bacteria 1167
407 Ga0496122_0227828 3300048925 Bacteria 1062
408 Ga0496122_0227831 3300048925 Bacteria 1062
409 Ga0496123_0000058 3300048926 Bacteria 226832
410 Ga0496123_0000416 3300048926 Bacteria 77660
411 Ga0496123_0000809 3300048926 Bacteria 50499
412 Ga0496123_0006754 3300048926 Bacteria 11030
413 Ga0496123_0006761 3300048926 Bacteria 11022
414 Ga0496123_0015526 3300048926 Bacteria 6240
415 Ga0496123_0026469 3300048926 Bacteria 4342
416 Ga0496123_0051056 3300048926 Bacteria 2757
417 Ga0496123_0057050 3300048926 Bacteria 2546
418 Ga0496123_0066951 3300048926 Bacteria 2271
419 Ga0496123_0190171 3300048926 Bacteria 1062
420 Ga0496123_0264093 3300048926 Bacteria 841
421 Ga0496124_0000347 3300048927 Bacteria 84802
422 Ga0496124_0002694 3300048927 Bacteria 22715
423 Ga0496124_0073724 3300048927 Bacteria 2823
424 Ga0496124_0357461 3300048927 Bacteria 1030
425 Ga0496125_0000303 3300048928 Bacteria 96733
426 Ga0496125_0000369 3300048928 Bacteria 84710
427 Ga0496125_0002308 3300048928 Bacteria 25172
428 Ga0496125_0006735 3300048928 Bacteria 12348
429 Ga0496125_0026542 3300048928 Bacteria 5273
430 Ga0496125_0028369 3300048928 Bacteria 5057
431 Ga0496125_0113498 3300048928 Bacteria 1954
432 Ga0496125_0150750 3300048928 Bacteria 1597
433 Ga0496125_0156147 3300048928 Bacteria 1558
434 Ga0496125_0162154 3300048928 Bacteria 1517
435 Ga0496125_0295960 3300048928 Bacteria 994
436 Ga0496125_0361601 3300048928 Bacteria 862
437 Ga0496126_0000385 3300048929 Bacteria 91311
438 Ga0496126_0000729 3300048929 Bacteria 59744
439 Ga0496126_0011288 3300048929 Bacteria 9267
440 Ga0496126_0028476 3300048929 Bacteria 5322
441 Ga0496126_0145881 3300048929 Bacteria 2032
442 Ga0496126_0189556 3300048929 Bacteria 1742
443 Ga0496126_0248636 3300048929 Bacteria 1482
444 Ga0496126_0522852 3300048929 Bacteria 945
445 Ga0495678_000211 3300049459 Bacteria 67511
446 Ga0495682_0039668 3300049460 Bacteria 1728
447 Ga0501033_0029268 3300049570 Bacteria 4139
448 Ga0501034_0014521 3300049571 Bacteria 8110
449 Ga0501036_0276780 3300049572 Bacteria 1405
450 Ga0501039_0706636 3300049575 Bacteria 788
451 Ga0501047_0004365 3300049581 Bacteria 13305
452 Ga0501076_0584567 3300049592 Bacteria 921
453 Ga0501035_0002928 3300049822 Bacteria 16434
454 Ga0501044_0014152 3300049823 Bacteria 8613
455 nmdc:mga00v17_124370_c1 3300050491 Bacteria 1645
456 nmdc:mga00v17_3016_c1 3300050491 Bacteria 8654
457 nmdc:mga0k408_83556_c1 3300050493 Bacteria 1872
458 nmdc:mga0sz30_150652_c1 3300050516 Bacteria 1029
459 Ga0500643_000051 3300053087 Bacteria 145619
460 Ga0500555_000311 3300053103 Bacteria 20959
461 Ga0500623_216256 3300053127 Bacteria 685
462 Ga0500600_0144292 3300053149 Bacteria 1194
463 Ga0466962_0058692 3300061719 Bacteria 1836
464 Ga0466962_0132706 3300061719 Bacteria 1204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053127 Ga0500623_216256 Ga0500623_216256_151_675 174
2 3300048924 Ga0496121_0000756 Ga0496121_0000756_28403_29002 180
3 3300046471 Ga0495650_0009178 Ga0495650_0009178_1167_1766 182
4 3300046474 Ga0495605_0117844 Ga0495605_0117844_496_1095 182
5 3300047469 Ga0495673_0032813 Ga0495673_0032813_884_1483 182
6 3300046519 Ga0495632_0008732 Ga0495632_0008732_371_970 183
7 3300039447 Ga0436361_0633524 Ga0436361_0633524_90_659 184
8 3300046665 Ga0495661_0000907 Ga0495661_0000907_4343_4942 186
9 3300005353 Ga0070669_100310440 Ga0070669_1003104402 188
10 3300006946 Ga0079104_1002960 Ga0079104_10029604 188
11 3300025923 Ga0207681_10253641 Ga0207681_102536412 188
12 3300027111 Ga0209281_1001215 Ga0209281_10012154 188
13 3300046458 Ga0495591_001555 Ga0495591_001555_11310_11918 188
14 3300046460 Ga0495638_0002796 Ga0495638_0002796_7567_8175 188
15 3300046694 Ga0495649_0006594 Ga0495649_0006594_4479_5087 188
16 3300047446 Ga0495679_019356 Ga0495679_019356_647_1255 188
17 3300046515 Ga0495620_0001348 Ga0495620_0001348_7921_8529 189
18 iso_pu_bacteria 2596583598 2597029510 193
19 iso_pu_bacteria 2946024296 2946027565 193
20 iso_pu_bacteria 2643221593 2643973746 194
21 iso_pu_bacteria 2995948881 2995953203 194
22 iso_pu_bacteria 2593339238 2595449277 195
23 iso_pu_bacteria 2593339239 2595450565 195
24 iso_pu_bacteria 2599185178 2599448276 195
25 iso_pu_bacteria 2718218334 2721029303 195
26 iso_pu_bacteria 2734482264 2735835099 195
27 iso_pu_bacteria 2747842428 2747947881 195
28 iso_pu_bacteria 2765235840 2765577957 195
29 iso_pu_bacteria 2885266251 2885268676 195
30 iso_pu_bacteria 2900577576 2900578972 195
31 iso_pu_bacteria 2919085039 2919088888 195
32 iso_pu_bacteria 2928058823 2928060604 195
33 iso_pu_bacteria 2515154122 2515684243 196
34 iso_pu_bacteria 2547132416 2548652232 196
35 iso_pu_bacteria 2554235234 2555258722 196
36 iso_pu_bacteria 2599185239 2599738998 196
37 iso_pu_bacteria 2599185240 2599747403 196
38 iso_pu_bacteria 2599185355 2600208972 196
39 iso_pu_bacteria 2602042047 2603643838 196
40 iso_pu_bacteria 2602042066 2603700982 196
41 iso_pu_bacteria 2602042067 2603704332 196
42 iso_pu_bacteria 2602042109 2603865509 196
43 iso_pu_bacteria 2609459761 2609913097 196
44 iso_pu_bacteria 2667528172 2671104129 196
45 iso_pu_bacteria 2675903129 2676745000 196
46 iso_pu_bacteria 2681812866 2681998618 196
47 iso_pu_bacteria 2681812869 2682007689 196
48 iso_pu_bacteria 2751185917 2753857254 196
49 iso_pu_bacteria 2765235842 2765590323 196
50 iso_pu_bacteria 2775506706 2775539876 196
51 iso_pu_bacteria 2818991452 2819631569 196
52 iso_pu_bacteria 2821118458 2821120178 196
53 iso_pu_bacteria 2823373977 2823375985 196
54 iso_pu_bacteria 2844425489 2844428676 196
55 iso_pu_bacteria 2863421361 2863423768 196
56 iso_pu_bacteria 2902682994 2902687491 196
57 iso_pu_bacteria 2919108558 2919110594 196
58 iso_pu_bacteria 2919481497 2919482894 196
59 iso_pu_bacteria 2923634449 2923636219 196
60 iso_pu_bacteria 2927833300 2927837295 196
61 iso_pu_bacteria 2928170801 2928175956 196
62 iso_pu_bacteria 2937539931 2937543877 196
63 iso_pu_bacteria 2939568625 2939570996 196
64 iso_pu_bacteria 2939573065 2939577289 196
65 iso_pu_bacteria 2939607340 2939610041 196
66 iso_pu_bacteria 2939642701 2939645099 196
67 iso_pu_bacteria 2945874760 2945876427 196
68 iso_pu_bacteria 2968128360 2968134030 196
69 iso_pu_bacteria 2971820967 2971821718 196
70 iso_pu_bacteria 2974310843 2974315466 196
71 iso_pu_bacteria 8018221730 8018225967 196
72 iso_pu_bacteria 8018405270 8018405419 196
73 iso_pu_bacteria 8018845410 8018847289 196
74 iso_pu_bacteria 8021120328 8021125958 196
75 iso_pu_bacteria 8055087960 8055088405 196
76 iso_pu_bacteria 8055092621 8055096980 196
77 iso_pu_bacteria 8055097453 8055100951 196
78 3300003322 rootL2_10116472 rootL2_101164722 197
79 3300031901 Ga0307406_10217454 Ga0307406_102174541 197
80 3300032002 Ga0307416_100426643 Ga0307416_1004266431 197
81 3300049592 Ga0501076_0584567 Ga0501076_0584567_268_861 197
82 iso_pu_bacteria 2547132374 2548497697 197
83 iso_pu_bacteria 2643221717 2644645104 197
84 3300003187 JGI25151J46595_10000116 JGI25151J46595_1000011677 198
85 3300014497 Ga0182008_10034225 Ga0182008_100342252 198
86 3300015265 Ga0182005_1102179 Ga0182005_11021791 198
87 3300025245 Ga0207425_1010930 Ga0207425_10109302 198
88 3300025294 Ga0209025_1000023 Ga0209025_1000023431 198
89 3300025297 Ga0209758_1034541 Ga0209758_10345412 198
90 3300032168 Ga0316593_10009566 Ga0316593_100095663 198
91 3300032168 Ga0316593_10052379 Ga0316593_100523791 198
92 3300032168 Ga0316593_10162091 Ga0316593_101620911 198
93 3300046463 Ga0495653_0002742 Ga0495653_0002742_3837_4439 198
94 3300046491 Ga0495584_0076176 Ga0495584_0076176_114_716 198
95 3300046492 Ga0495585_0076579 Ga0495585_0076579_909_1511 198
96 3300046518 Ga0495631_0102231 Ga0495631_0102231_224_826 198
97 3300046558 Ga0495633_0012640 Ga0495633_0012640_3326_3928 198
98 3300046665 Ga0495661_0008669 Ga0495661_0008669_467_1069 198
99 3300049570 Ga0501033_0029268 Ga0501033_0029268_171_848 198
100 3300049571 Ga0501034_0014521 Ga0501034_0014521_2639_3316 198
101 3300049572 Ga0501036_0276780 Ga0501036_0276780_606_1202 198
102 3300049575 Ga0501039_0706636 Ga0501039_0706636_59_655 198
103 3300049581 Ga0501047_0004365 Ga0501047_0004365_11616_12293 198
104 3300049822 Ga0501035_0002928 Ga0501035_0002928_1142_1738 198
105 3300049823 Ga0501044_0014152 Ga0501044_0014152_1904_2581 198
106 3300001915 JGI24741J21665_1000029 JGI24741J21665_100002919 199
107 3300001979 JGI24740J21852_10001907 JGI24740J21852_100019076 199
108 3300001979 JGI24740J21852_10004481 JGI24740J21852_100044812 199
109 3300002705 JGI25156J39149_1004467 JGI25156J39149_10044672 199
110 3300002738 JGI25154J39366_1000285 JGI25154J39366_100028533 199
111 3300003203 JGI25406J46586_10081719 JGI25406J46586_100817191 199
112 3300003320 rootH2_10194572 rootH2_101945722 199
113 3300003578 Ga0006562J51391_1178845 Ga0006562J51391_11788453 199
114 3300003751 Ga0055538_1005507 Ga0055538_10055072 199
115 3300003751 Ga0055538_1005564 Ga0055538_10055642 199
116 3300003752 Ga0055539_1000236 Ga0055539_100023632 199
117 3300003756 Ga0055533_1001773 Ga0055533_10017733 199
118 3300003756 Ga0055533_1002940 Ga0055533_10029405 199
119 3300003756 Ga0055533_1005159 Ga0055533_10051591 199
120 3300003758 Ga0055532_1000149 Ga0055532_100014936 199
121 3300003759 Ga0055525_1001067 Ga0055525_10010675 199
122 3300003760 Ga0055527_1001115 Ga0055527_10011152 199
123 3300003761 Ga0055535_1000180 Ga0055535_100018035 199
124 3300003762 Ga0055542_1000489 Ga0055542_100048936 199
125 3300003762 Ga0055542_1001202 Ga0055542_10012027 199
126 3300003762 Ga0055542_1015955 Ga0055542_10159553 199
127 3300003763 Ga0055529_1000245 Ga0055529_100024535 199
128 3300003781 Ga0055536_1001499 Ga0055536_100149911 199
129 3300003841 Ga0055541_1002958 Ga0055541_10029582 199
130 3300003841 Ga0055541_1005015 Ga0055541_10050152 199
131 3300003841 Ga0055541_1008537 Ga0055541_10085371 199
132 3300004625 Ga0055543_1005421 Ga0055543_10054214 199
133 3300005262 Ga0065165_1000204 Ga0065165_100020432 199
134 3300005344 Ga0070661_100000048 Ga0070661_10000004871 199
135 3300005366 Ga0070659_100001214 Ga0070659_10000121415 199
136 3300005455 Ga0070663_100000001 Ga0070663_10000000135 199
137 3300005564 Ga0070664_100000016 Ga0070664_10000001638 199
138 3300005577 Ga0068857_100010988 Ga0068857_1000109885 199
139 3300005577 Ga0068857_100976695 Ga0068857_1009766951 199
140 3300005578 Ga0068854_100000124 Ga0068854_10000012414 199
141 3300005614 Ga0068856_100000047 Ga0068856_1000000479 199
142 3300005616 Ga0068852_100760821 Ga0068852_1007608212 199
143 3300006186 Ga0075369_10160819 Ga0075369_101608192 199
144 3300009093 Ga0105240_10031849 Ga0105240_100318492 199
145 3300009093 Ga0105240_10783177 Ga0105240_107831772 199
146 3300009551 Ga0105238_10098259 Ga0105238_100982592 199
147 3300009978 Ga0105148_100777 Ga0105148_1007772 199
148 3300010375 Ga0105239_10179073 Ga0105239_101790733 199
149 3300013100 Ga0157373_10001283 Ga0157373_1000128321 199
150 3300013100 Ga0157373_10312003 Ga0157373_103120031 199
151 3300013102 Ga0157371_10000080 Ga0157371_10000080140 199
152 3300013104 Ga0157370_10000032 Ga0157370_1000003211 199
153 3300013104 Ga0157370_10000837 Ga0157370_1000083725 199
154 3300013105 Ga0157369_10004526 Ga0157369_100045267 199
155 3300013307 Ga0157372_10004343 Ga0157372_1000434312 199
156 3300015261 Ga0182006_1000189 Ga0182006_100018921 199
157 3300015261 Ga0182006_1030513 Ga0182006_10305133 199
158 3300015262 Ga0182007_10002663 Ga0182007_1000266312 199
159 3300015262 Ga0182007_10023437 Ga0182007_100234371 199
160 3300015262 Ga0182007_10053625 Ga0182007_100536251 199
161 3300015265 Ga0182005_1000015 Ga0182005_1000015279 199
162 3300015265 Ga0182005_1014056 Ga0182005_10140562 199
163 3300020070 Ga0206356_11637714 Ga0206356_116377141 199
164 3300020077 Ga0206351_10740334 Ga0206351_107403342 199
165 3300025224 Ga0209784_100006 Ga0209784_100006246 199
166 3300025224 Ga0209784_100472 Ga0209784_10047218 199
167 3300025224 Ga0209784_100785 Ga0209784_1007856 199
168 3300025225 Ga0209566_100002 Ga0209566_100002246 199
169 3300025225 Ga0209566_100303 Ga0209566_10030337 199
170 3300025225 Ga0209566_101439 Ga0209566_1014393 199
171 3300025226 Ga0209674_100010 Ga0209674_100010891 199
172 3300025226 Ga0209674_100176 Ga0209674_10017616 199
173 3300025226 Ga0209674_100206 Ga0209674_10020613 199
174 3300025226 Ga0209674_100810 Ga0209674_1008104 199
175 3300025226 Ga0209674_101353 Ga0209674_1013531 199
176 3300025228 Ga0209672_101773 Ga0209672_1017733 199
177 3300025229 Ga0209147_100018 Ga0209147_100018259 199
178 3300025230 Ga0209563_100041 Ga0209563_100041226 199
179 3300025233 Ga0209437_103468 Ga0209437_1034683 199
180 3300025242 Ga0209258_100028 Ga0209258_100028259 199
181 3300025246 Ga0209646_1000043 Ga0209646_1000043275 199
182 3300025250 Ga0209026_1003038 Ga0209026_10030387 199
183 3300025253 Ga0209677_100007 Ga0209677_100007246 199
184 3300025253 Ga0209677_103421 Ga0209677_1034215 199
185 3300025254 Ga0209148_1000348 Ga0209148_100034814 199
186 3300025254 Ga0209148_1001887 Ga0209148_10018873 199
187 3300025256 Ga0209759_1002646 Ga0209759_100264611 199
188 3300025256 Ga0209759_1009810 Ga0209759_10098101 199
189 3300025256 Ga0209759_1016699 Ga0209759_10166992 199
190 3300025272 Ga0209455_1000065 Ga0209455_1000065259 199
191 3300025292 Ga0209676_1000037 Ga0209676_1000037346 199
192 3300025304 Ga0209257_1054949 Ga0209257_10549491 199
193 3300025900 Ga0207710_10004653 Ga0207710_100046536 199
194 3300025913 Ga0207695_10000872 Ga0207695_1000087245 199
195 3300025913 Ga0207695_10721019 Ga0207695_107210191 199
196 3300025920 Ga0207649_10000200 Ga0207649_1000020016 199
197 3300025924 Ga0207694_10047931 Ga0207694_100479313 199
198 3300025932 Ga0207690_10003490 Ga0207690_100034904 199
199 3300025945 Ga0207679_10000012 Ga0207679_10000012266 199
200 3300025981 Ga0207640_10000047 Ga0207640_1000004748 199
201 3300026067 Ga0207678_10000028 Ga0207678_1000002835 199
202 3300026078 Ga0207702_10000255 Ga0207702_1000025535 199
203 3300026116 Ga0207674_10007892 Ga0207674_100078929 199
204 3300026116 Ga0207674_10164583 Ga0207674_101645831 199
205 3300026142 Ga0207698_11250305 Ga0207698_112503051 199
206 3300037418 Ga0395900_0091053 Ga0395900_0091053_177_797 199
207 3300037471 Ga0395905_0690268 Ga0395905_0690268_94_699 199
208 3300038705 Ga0237819_07221 Ga0237819_07221_848_1450 199
209 3300042184 Ga0450908_000008 Ga0450908_000008_33437_34036 199
210 3300044650 Ga0466986_0028249 Ga0466986_0028249_2808_3413 199
211 3300044656 Ga0466969_0097830 Ga0466969_0097830_609_1214 199
212 3300044656 Ga0466969_0296791 Ga0466969_0296791_116_715 199
213 3300044658 Ga0466972_0005336 Ga0466972_0005336_4884_5489 199
214 3300044666 Ga0466977_0020550 Ga0466977_0020550_2805_3404 199
215 3300044671 Ga0466978_0145178 Ga0466978_0145178_253_858 199
216 3300044672 Ga0466982_0000041 Ga0466982_0000041_8596_9195 199
217 3300044683 Ga0466965_0025283 Ga0466965_0025283_2196_2801 199
218 3300044693 Ga0466961_0000722 Ga0466961_0000722_10420_11025 199
219 3300044719 Ga0466971_0021273 Ga0466971_0021273_390_995 199
220 3300044735 Ga0466968_0069804 Ga0466968_0069804_888_1493 199
221 3300044765 Ga0466970_0000986 Ga0466970_0000986_8780_9385 199
222 3300044842 Ga0466957_0228718 Ga0466957_0228718_23_628 199
223 3300045049 Ga0466959_0001982 Ga0466959_0001982_11814_12419 199
224 3300045976 Ga0466967_0047763 Ga0466967_0047763_184_789 199
225 3300046457 Ga0495590_0013260 Ga0495590_0013260_1307_1906 199
226 3300046460 Ga0495638_0000278 Ga0495638_0000278_11704_12303 199
227 3300046492 Ga0495585_0001919 Ga0495585_0001919_4273_4872 199
228 3300046501 Ga0495607_0000117 Ga0495607_0000117_21024_21623 199
229 3300046501 Ga0495607_0003514 Ga0495607_0003514_905_1504 199
230 3300046506 Ga0495583_0031245 Ga0495583_0031245_1753_2352 199
231 3300046507 Ga0495606_0083544 Ga0495606_0083544_866_1465 199
232 3300046519 Ga0495632_0014038 Ga0495632_0014038_1206_1805 199
233 3300046520 Ga0495637_0014001 Ga0495637_0014001_60_659 199
234 3300046525 Ga0495663_0002968 Ga0495663_0002968_1742_2344 199
235 3300046538 Ga0495609_0002720 Ga0495609_0002720_3220_3819 199
236 3300046616 Ga0495668_0001645 Ga0495668_0001645_1517_2116 199
237 3300046648 Ga0495611_0000059 Ga0495611_0000059_57009_57608 199
238 3300046660 Ga0495625_0000288 Ga0495625_0000288_20427_21026 199
239 3300046665 Ga0495661_0030309 Ga0495661_0030309_1943_2542 199
240 3300046691 Ga0495670_0019455 Ga0495670_0019455_78_677 199
241 3300046691 Ga0495670_0045778 Ga0495670_0045778_161_760 199
242 3300046692 Ga0495671_0001225 Ga0495671_0001225_4410_5009 199
243 3300046794 Ga0495589_0000056 Ga0495589_0000056_52495_53094 199
244 3300046810 Ga0495660_0000295 Ga0495660_0000295_19985_20584 199
245 3300046810 Ga0495660_0000304 Ga0495660_0000304_20962_21561 199
246 3300047320 Ga0495672_0027062 Ga0495672_0027062_946_1545 199
247 3300047446 Ga0495679_000010 Ga0495679_000010_280090_280689 199
248 3300047469 Ga0495673_0000240 Ga0495673_0000240_22007_22606 199
249 3300047469 Ga0495673_0000244 Ga0495673_0000244_57012_57611 199
250 3300047472 Ga0495686_0000311 Ga0495686_0000311_54408_55007 199
251 3300048905 Ga0496102_0797338 Ga0496102_0797338_41_640 199
252 3300048909 Ga0496106_0000285 Ga0496106_0000285_10294_10893 199
253 3300048924 Ga0496121_0000403 Ga0496121_0000403_56364_56963 199
254 3300049459 Ga0495678_000211 Ga0495678_000211_23007_23606 199
255 3300049460 Ga0495682_0039668 Ga0495682_0039668_654_1253 199
256 3300050516 nmdc:mga0sz30_150652_c1 nmdc:mga0sz30_150652_c1_229_828 199
257 3300053087 Ga0500643_000051 Ga0500643_000051_87966_88565 199
258 3300053103 Ga0500555_000311 Ga0500555_000311_8044_8643 199
259 3300061719 Ga0466962_0058692 Ga0466962_0058692_78_683 199
260 2162886007 SwRhRL2b_contig_2956067 SwRhRL2b_0214.00006030 200
261 2162886007 SwRhRL2b_contig_368673 SwRhRL2b_0419.00003260 200
262 3300003758 Ga0055532_1000114 Ga0055532_100011450 200
263 3300003758 Ga0055532_1000260 Ga0055532_100026021 200
264 3300003760 Ga0055527_1000315 Ga0055527_100031511 200
265 3300003761 Ga0055535_1000485 Ga0055535_100048521 200
266 3300003762 Ga0055542_1000500 Ga0055542_100050014 200
267 3300003763 Ga0055529_1000362 Ga0055529_100036222 200
268 3300003771 Ga0055526_1001042 Ga0055526_10010426 200
269 3300003790 Ga0055528_1000469 Ga0055528_100046921 200
270 3300003790 Ga0055528_1002085 Ga0055528_10020858 200
271 3300003856 Ga0058692_1002025 Ga0058692_10020256 200
272 3300003856 Ga0058692_1002193 Ga0058692_10021935 200
273 3300005289 Ga0065704_10000308 Ga0065704_100003088 200
274 3300005289 Ga0065704_10001705 Ga0065704_100017054 200
275 3300005289 Ga0065704_10199875 Ga0065704_101998751 200
276 3300005366 Ga0070659_100076734 Ga0070659_1000767342 200
277 3300005548 Ga0070665_100000710 Ga0070665_1000007108 200
278 3300005548 Ga0070665_100078022 Ga0070665_1000780224 200
279 3300005577 Ga0068857_100000029 Ga0068857_10000002969 200
280 3300006051 Ga0075364_10001959 Ga0075364_100019595 200
281 3300006195 Ga0075366_10089983 Ga0075366_100899832 200
282 3300006946 Ga0079104_1000389 Ga0079104_10003895 200
283 3300006946 Ga0079104_1002089 Ga0079104_100208910 200
284 3300006946 Ga0079104_1004157 Ga0079104_10041572 200
285 3300006946 Ga0079104_1005002 Ga0079104_10050025 200
286 3300006946 Ga0079104_1037373 Ga0079104_10373732 200
287 3300009011 Ga0105251_10000091 Ga0105251_1000009162 200
288 3300009011 Ga0105251_10000504 Ga0105251_100005046 200
289 3300009011 Ga0105251_10005967 Ga0105251_100059673 200
290 3300009011 Ga0105251_10006453 Ga0105251_100064535 200
291 3300009011 Ga0105251_10076512 Ga0105251_100765122 200
292 3300009011 Ga0105251_10211010 Ga0105251_102110102 200
293 3300009036 Ga0105244_10000009 Ga0105244_10000009193 200
294 3300009036 Ga0105244_10000388 Ga0105244_1000038840 200
295 3300009036 Ga0105244_10000397 Ga0105244_1000039716 200
296 3300009036 Ga0105244_10000600 Ga0105244_1000060018 200
297 3300009036 Ga0105244_10001687 Ga0105244_100016872 200
298 3300009036 Ga0105244_10078398 Ga0105244_100783982 200
299 3300009092 Ga0105250_10000081 Ga0105250_1000008159 200
300 3300009092 Ga0105250_10001507 Ga0105250_1000150711 200
301 3300009092 Ga0105250_10004569 Ga0105250_100045694 200
302 3300009092 Ga0105250_10072594 Ga0105250_100725942 200
303 3300009092 Ga0105250_10262394 Ga0105250_102623942 200
304 3300009093 Ga0105240_10000363 Ga0105240_1000036343 200
305 3300009148 Ga0105243_10002546 Ga0105243_100025464 200
306 3300009148 Ga0105243_10480499 Ga0105243_104804992 200
307 3300013100 Ga0157373_10278100 Ga0157373_102781002 200
308 3300013102 Ga0157371_10000841 Ga0157371_1000084126 200
309 3300013104 Ga0157370_10003458 Ga0157370_100034582 200
310 3300013104 Ga0157370_10033422 Ga0157370_100334223 200
311 3300015261 Ga0182006_1010026 Ga0182006_10100261 200
312 3300015261 Ga0182006_1089111 Ga0182006_10891112 200
313 3300015262 Ga0182007_10001472 Ga0182007_100014723 200
314 3300015679 Ga0183366_1002 Ga0183366_1002121 200
315 3300015680 Ga0183370_1002 Ga0183370_1002121 200
316 3300015685 Ga0183369_1002 Ga0183369_1002121 200
317 3300015687 Ga0183368_1005 Ga0183368_1005121 200
318 3300021384 Ga0213876_10000444 Ga0213876_100004445 200
319 3300025225 Ga0209566_100274 Ga0209566_10027411 200
320 3300025226 Ga0209674_100840 Ga0209674_1008406 200
321 3300025228 Ga0209672_100057 Ga0209672_100057111 200
322 3300025229 Ga0209147_100037 Ga0209147_10003778 200
323 3300025229 Ga0209147_100047 Ga0209147_10004796 200
324 3300025242 Ga0209258_100065 Ga0209258_100065184 200
325 3300025254 Ga0209148_1000091 Ga0209148_1000091161 200
326 3300025272 Ga0209455_1000074 Ga0209455_100007496 200
327 3300025272 Ga0209455_1000249 Ga0209455_100024921 200
328 3300025273 Ga0209673_1000022 Ga0209673_1000022122 200
329 3300025273 Ga0209673_1000198 Ga0209673_100019884 200
330 3300025291 Ga0209675_1018129 Ga0209675_10181292 200
331 3300025295 Ga0209564_1000707 Ga0209564_100070720 200
332 3300025299 Ga0209256_1001202 Ga0209256_100120213 200
333 3300025711 Ga0207696_1000008 Ga0207696_1000008479 200
334 3300025711 Ga0207696_1000012 Ga0207696_100001259 200
335 3300025711 Ga0207696_1000024 Ga0207696_1000024348 200
336 3300025711 Ga0207696_1002212 Ga0207696_10022125 200
337 3300025728 Ga0207655_1000004 Ga0207655_1000004306 200
338 3300025728 Ga0207655_1000020 Ga0207655_1000020385 200
339 3300025728 Ga0207655_1000088 Ga0207655_1000088189 200
340 3300025728 Ga0207655_1000103 Ga0207655_100010352 200
341 3300025728 Ga0207655_1000439 Ga0207655_100043930 200
342 3300025728 Ga0207655_1002601 Ga0207655_10026013 200
343 3300025735 Ga0207713_1000076 Ga0207713_1000076126 200
344 3300025735 Ga0207713_1000134 Ga0207713_1000134103 200
345 3300025735 Ga0207713_1000167 Ga0207713_100016755 200
346 3300025735 Ga0207713_1001422 Ga0207713_100142220 200
347 3300025735 Ga0207713_1002804 Ga0207713_10028043 200
348 3300025735 Ga0207713_1026307 Ga0207713_10263071 200
349 3300025735 Ga0207713_1026459 Ga0207713_10264593 200
350 3300025735 Ga0207713_1041531 Ga0207713_10415312 200
351 3300025735 Ga0207713_1048852 Ga0207713_10488522 200
352 3300025913 Ga0207695_10000473 Ga0207695_1000047364 200
353 3300025932 Ga0207690_10055698 Ga0207690_100556983 200
354 3300025935 Ga0207709_10001635 Ga0207709_100016354 200
355 3300025935 Ga0207709_10171218 Ga0207709_101712183 200
356 3300026116 Ga0207674_10000160 Ga0207674_100001605 200
357 3300027111 Ga0209281_1000056 Ga0209281_1000056235 200
358 3300027111 Ga0209281_1000193 Ga0209281_100019352 200
359 3300027111 Ga0209281_1000353 Ga0209281_100035336 200
360 3300027111 Ga0209281_1000529 Ga0209281_100052926 200
361 3300027111 Ga0209281_1000531 Ga0209281_100053126 200
362 3300027111 Ga0209281_1002041 Ga0209281_10020416 200
363 3300027312 Ga0209371_1000013 Ga0209371_100001362 200
364 3300027312 Ga0209371_1000144 Ga0209371_100014427 200
365 3300027312 Ga0209371_1000333 Ga0209371_100033315 200
366 3300027312 Ga0209371_1006459 Ga0209371_10064595 200
367 3300028379 Ga0268266_10000211 Ga0268266_1000021146 200
368 3300028379 Ga0268266_10280426 Ga0268266_102804262 200
369 3300030500 Ga0268256_1000014 Ga0268256_1000014616 200
370 3300030500 Ga0268256_1000145 Ga0268256_100014559 200
371 3300030500 Ga0268256_1000375 Ga0268256_100037522 200
372 3300031251 Ga0265327_10039590 Ga0265327_100395903 200
373 3300031548 Ga0307408_100122220 Ga0307408_1001222202 200
374 3300039437 Ga0436365_1801698 Ga0436365_1801698_31247_31852 200
375 3300039447 Ga0436361_0799455 Ga0436361_0799455_48_656 200
376 3300041405 Ga0439438_003371 Ga0439438_003371_67_669 200
377 3300041413 Ga0439465_0038915 Ga0439465_0038915_330_938 200
378 3300041492 Ga0451835_0639300 Ga0451835_0639300_512_1120 200
379 3300041494 Ga0451837_0931796 Ga0451837_0931796_1241_1849 200
380 3300041501 Ga0451845_0259733 Ga0451845_0259733_1295_1903 200
381 3300041505 Ga0451849_0367902 Ga0451849_0367902_1537_2145 200
382 3300041507 Ga0451851_0649712 Ga0451851_0649712_1581_2189 200
383 3300041509 Ga0451843_1251418 Ga0451843_1251418_1366_1974 200
384 3300041512 Ga0451853_3574735 Ga0451853_3574735_534_1136 200
385 3300042010 Ga0439452_000052 Ga0439452_000052_17570_18172 200
386 3300042010 Ga0439452_000094 Ga0439452_000094_37848_38450 200
387 3300042016 Ga0439463_001437 Ga0439463_001437_4375_4983 200
388 3300042145 Ga0450906_031925 Ga0450906_031925_23_631 200
389 3300042439 Ga0439464_0003641 Ga0439464_0003641_523_1125 200
390 3300044669 Ga0466981_0000036 Ga0466981_0000036_25342_25944 200
391 3300044683 Ga0466965_0145420 Ga0466965_0145420_313_921 200
392 3300044693 Ga0466961_0038824 Ga0466961_0038824_308_916 200
393 3300044706 Ga0466964_0002950 Ga0466964_0002950_3631_4239 200
394 3300044765 Ga0466970_0047942 Ga0466970_0047942_569_1222 200
395 3300044842 Ga0466957_0053279 Ga0466957_0053279_1561_2214 200
396 3300045049 Ga0466959_0016007 Ga0466959_0016007_565_1173 200
397 3300045836 Ga0466958_0002254 Ga0466958_0002254_3233_3841 200
398 3300046453 Ga0495627_057099 Ga0495627_057099_105_707 200
399 3300046458 Ga0495591_000115 Ga0495591_000115_60206_60838 200
400 3300046462 Ga0495651_0002782 Ga0495651_0002782_8227_8829 200
401 3300046471 Ga0495650_0000059 Ga0495650_0000059_257624_258226 200
402 3300046471 Ga0495650_0002065 Ga0495650_0002065_14776_15378 200
403 3300046471 Ga0495650_0143050 Ga0495650_0143050_92_694 200
404 3300046511 Ga0495608_0012300 Ga0495608_0012300_1706_2308 200
405 3300046516 Ga0495628_0003625 Ga0495628_0003625_3181_3783 200
406 3300046519 Ga0495632_0229143 Ga0495632_0229143_194_802 200
407 3300046522 Ga0495643_0009799 Ga0495643_0009799_838_1446 200
408 3300046529 Ga0495652_0016504 Ga0495652_0016504_3319_3921 200
409 3300046530 Ga0495654_0022222 Ga0495654_0022222_1517_2149 200
410 3300046538 Ga0495609_0199591 Ga0495609_0199591_96_698 200
411 3300046660 Ga0495625_0202086 Ga0495625_0202086_544_1152 200
412 3300046679 Ga0495623_0018755 Ga0495623_0018755_3602_4204 200
413 3300046692 Ga0495671_0138670 Ga0495671_0138670_210_812 200
414 3300047446 Ga0495679_007930 Ga0495679_007930_2388_2990 200
415 3300047469 Ga0495673_0000176 Ga0495673_0000176_101396_102028 200
416 3300047470 Ga0495681_0013022 Ga0495681_0013022_1656_2264 200
417 3300048088 Ga0495602_0201498 Ga0495602_0201498_746_1348 200
418 3300048903 Ga0496100_0273673 Ga0496100_0273673_323_925 200
419 3300048904 Ga0496101_0313357 Ga0496101_0313357_134_736 200
420 3300048907 Ga0496104_0000192 Ga0496104_0000192_30858_31460 200
421 3300048907 Ga0496104_0067664 Ga0496104_0067664_610_1212 200
422 3300048907 Ga0496104_0281400 Ga0496104_0281400_811_1413 200
423 3300048908 Ga0496105_0002705 Ga0496105_0002705_6990_7592 200
424 3300048908 Ga0496105_0002749 Ga0496105_0002749_2552_3154 200
425 3300048915 Ga0496112_0007838 Ga0496112_0007838_5279_5941 200
426 3300048916 Ga0496113_0723045 Ga0496113_0723045_176_778 200
427 3300048919 Ga0496116_0002472 Ga0496116_0002472_912_1520 200
428 3300048919 Ga0496116_0013787 Ga0496116_0013787_4783_5385 200
429 3300048919 Ga0496116_0037127 Ga0496116_0037127_2760_3362 200
430 3300048919 Ga0496116_0081347 Ga0496116_0081347_562_1194 200
431 3300048919 Ga0496116_0105493 Ga0496116_0105493_33_635 200
432 3300048920 Ga0496117_0001355 Ga0496117_0001355_16142_16744 200
433 3300048920 Ga0496117_0002873 Ga0496117_0002873_17442_18044 200
434 3300048920 Ga0496117_0013220 Ga0496117_0013220_4998_5600 200
435 3300048920 Ga0496117_0018060 Ga0496117_0018060_1862_2464 200
436 3300048920 Ga0496117_0033095 Ga0496117_0033095_250_882 200
437 3300048920 Ga0496117_0044699 Ga0496117_0044699_1054_1656 200
438 3300048920 Ga0496117_0051120 Ga0496117_0051120_1064_1666 200
439 3300048921 Ga0496118_0001069 Ga0496118_0001069_37638_38240 200
440 3300048921 Ga0496118_0001374 Ga0496118_0001374_15253_15855 200
441 3300048921 Ga0496118_0001482 Ga0496118_0001482_32790_33398 200
442 3300048921 Ga0496118_0008581 Ga0496118_0008581_8051_8653 200
443 3300048921 Ga0496118_0035322 Ga0496118_0035322_3214_3846 200
444 3300048921 Ga0496118_0176629 Ga0496118_0176629_523_1125 200
445 3300048921 Ga0496118_0186376 Ga0496118_0186376_215_847 200
446 3300048921 Ga0496118_0367483 Ga0496118_0367483_78_680 200
447 3300048922 Ga0496119_0001027 Ga0496119_0001027_17747_18349 200
448 3300048922 Ga0496119_0001235 Ga0496119_0001235_4539_5141 200
449 3300048922 Ga0496119_0004779 Ga0496119_0004779_7536_8138 200
450 3300048922 Ga0496119_0007076 Ga0496119_0007076_5529_6131 200
451 3300048922 Ga0496119_0011298 Ga0496119_0011298_4671_5273 200
452 3300048922 Ga0496119_0045153 Ga0496119_0045153_1067_1669 200
453 3300048922 Ga0496119_0050488 Ga0496119_0050488_820_1422 200
454 3300048922 Ga0496119_0050662 Ga0496119_0050662_1111_1713 200
455 3300048923 Ga0496120_0000585 Ga0496120_0000585_32911_33513 200
456 3300048923 Ga0496120_0000898 Ga0496120_0000898_23615_24217 200
457 3300048923 Ga0496120_0002600 Ga0496120_0002600_7101_7703 200
458 3300048923 Ga0496120_0002816 Ga0496120_0002816_2764_3366 200
459 3300048923 Ga0496120_0004130 Ga0496120_0004130_4366_4968 200
460 3300048923 Ga0496120_0014121 Ga0496120_0014121_1620_2252 200
461 3300048923 Ga0496120_0042109 Ga0496120_0042109_463_1065 200
462 3300048923 Ga0496120_0097006 Ga0496120_0097006_13_615 200
463 3300048923 Ga0496120_0217994 Ga0496120_0217994_154_756 200
464 3300048924 Ga0496121_0000358 Ga0496121_0000358_17214_17816 200
465 3300048924 Ga0496121_0001449 Ga0496121_0001449_4724_5326 200
466 3300048924 Ga0496121_0001508 Ga0496121_0001508_5750_6352 200
467 3300048924 Ga0496121_0009137 Ga0496121_0009137_9912_10514 200
468 3300048924 Ga0496121_0011108 Ga0496121_0011108_8289_8891 200
469 3300048924 Ga0496121_0012494 Ga0496121_0012494_4784_5386 200
470 3300048924 Ga0496121_0021422 Ga0496121_0021422_3750_4352 200
471 3300048924 Ga0496121_0039996 Ga0496121_0039996_2574_3176 200
472 3300048924 Ga0496121_0169938 Ga0496121_0169938_491_1099 200
473 3300048924 Ga0496121_0283847 Ga0496121_0283847_452_1054 200
474 3300048924 Ga0496121_0406121 Ga0496121_0406121_263_865 200
475 3300048925 Ga0496122_0000170 Ga0496122_0000170_122208_122840 200
476 3300048925 Ga0496122_0002886 Ga0496122_0002886_15424_16029 200
477 3300048925 Ga0496122_0010356 Ga0496122_0010356_5061_5663 200
478 3300048925 Ga0496122_0011293 Ga0496122_0011293_1688_2290 200
479 3300048925 Ga0496122_0014236 Ga0496122_0014236_4671_5273 200
480 3300048925 Ga0496122_0029091 Ga0496122_0029091_1897_2499 200
481 3300048925 Ga0496122_0047465 Ga0496122_0047465_2598_3200 200
482 3300048925 Ga0496122_0077489 Ga0496122_0077489_813_1415 200
483 3300048925 Ga0496122_0200485 Ga0496122_0200485_215_817 200
484 3300048925 Ga0496122_0227828 Ga0496122_0227828_388_990 200
485 3300048925 Ga0496122_0227831 Ga0496122_0227831_388_990 200
486 3300048926 Ga0496123_0000058 Ga0496123_0000058_103776_104408 200
487 3300048926 Ga0496123_0000416 Ga0496123_0000416_7481_8086 200
488 3300048926 Ga0496123_0000809 Ga0496123_0000809_17427_18029 200
489 3300048926 Ga0496123_0006754 Ga0496123_0006754_73_675 200
490 3300048926 Ga0496123_0006761 Ga0496123_0006761_3728_4330 200
491 3300048926 Ga0496123_0015526 Ga0496123_0015526_513_1115 200
492 3300048926 Ga0496123_0026469 Ga0496123_0026469_1844_2446 200
493 3300048926 Ga0496123_0051056 Ga0496123_0051056_904_1506 200
494 3300048926 Ga0496123_0057050 Ga0496123_0057050_645_1247 200
495 3300048926 Ga0496123_0066951 Ga0496123_0066951_783_1385 200
496 3300048926 Ga0496123_0190171 Ga0496123_0190171_388_990 200
497 3300048926 Ga0496123_0264093 Ga0496123_0264093_170_772 200
498 3300048927 Ga0496124_0000347 Ga0496124_0000347_17756_18358 200
499 3300048927 Ga0496124_0002694 Ga0496124_0002694_12057_12659 200
500 3300048927 Ga0496124_0073724 Ga0496124_0073724_2138_2740 200
501 3300048927 Ga0496124_0357461 Ga0496124_0357461_222_824 200
502 3300048928 Ga0496125_0000303 Ga0496125_0000303_64467_65069 200
503 3300048928 Ga0496125_0000369 Ga0496125_0000369_66440_67042 200
504 3300048928 Ga0496125_0002308 Ga0496125_0002308_24530_25132 200
505 3300048928 Ga0496125_0006735 Ga0496125_0006735_803_1405 200
506 3300048928 Ga0496125_0026542 Ga0496125_0026542_21_653 200
507 3300048928 Ga0496125_0028369 Ga0496125_0028369_3027_3629 200
508 3300048928 Ga0496125_0113498 Ga0496125_0113498_437_1039 200
509 3300048928 Ga0496125_0150750 Ga0496125_0150750_930_1532 200
510 3300048928 Ga0496125_0156147 Ga0496125_0156147_154_756 200
511 3300048928 Ga0496125_0162154 Ga0496125_0162154_261_863 200
512 3300048928 Ga0496125_0295960 Ga0496125_0295960_266_871 200
513 3300048928 Ga0496125_0361601 Ga0496125_0361601_122_724 200
514 3300048929 Ga0496126_0000385 Ga0496126_0000385_22399_23001 200
515 3300048929 Ga0496126_0000729 Ga0496126_0000729_35470_36072 200
516 3300048929 Ga0496126_0011288 Ga0496126_0011288_1344_1946 200
517 3300048929 Ga0496126_0028476 Ga0496126_0028476_1651_2283 200
518 3300048929 Ga0496126_0145881 Ga0496126_0145881_832_1434 200
519 3300048929 Ga0496126_0189556 Ga0496126_0189556_728_1330 200
520 3300048929 Ga0496126_0248636 Ga0496126_0248636_730_1332 200
521 3300048929 Ga0496126_0522852 Ga0496126_0522852_248_850 200
522 3300050491 nmdc:mga00v17_124370_c1 nmdc:mga00v17_124370_c1_487_1089 200
523 3300050491 nmdc:mga00v17_3016_c1 nmdc:mga00v17_3016_c1_2932_3564 200
524 3300050493 nmdc:mga0k408_83556_c1 nmdc:mga0k408_83556_c1_855_1457 200
525 3300053149 Ga0500600_0144292 Ga0500600_0144292_266_871 200
526 3300061719 Ga0466962_0132706 Ga0466962_0132706_28_636 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

28

190

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

30

121

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

222

0.83

PF23441

65

224

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7l-assembly4.cif.gz_B the crystal structure of the protein lin1944 from listeria innocua . 0.9882 1 198
3ucf-assembly1.cif.gz_A crystal structure of a small-chain dehydrogenase 0.9459 1 199
3ucf-assembly1.cif.gz_D crystal structure of a small-chain dehydrogenase 0.933 1 198
3ucf-assembly1.cif.gz_B crystal structure of a small-chain dehydrogenase 0.9284 1 199
3uce-assembly1.cif.gz_A crystal structure of a small-chain dehydrogenase in complex with nadph 0.9085 1 199
ID Description Score Start End Superfamily
3d7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9856 2 198 3.40.50.720
3d7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9657 2 198 3.40.50.720
3ucfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9284 1 199 3.40.50.720
af_Q9VWP2_2_241_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9178 2 198 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9062 2 199 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N4Z6P1-F1-model_v4 Short chain dehydrogenase 1.003 1 151 GO:0016491
AF-A0A7G3EQS7-F1-model_v4 deleted 0.999 1 119
AF-A0A8B4LPH4-F1-model_v4 deleted 0.9983 1 200
AF-A0A3N2EF81-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.998 1 200 GO:0016491
AF-A0A6S4Y095-F1-model_v4 deleted 0.9971 1 200

Feature Viewer

pLDDT pTM Quality
96 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map