F459479

General Info

Members Datasets Scaffolds Average Seq Length
526 294 1052 333

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0013024|Ga0501043_0013024_238_1398
Length 386
Sequence MRTCIACSSARPNERRRVVVENTFGQSALHEAGLGEEGTVSKGPVNPPAYWYGDLPVPFGARLLSGVYGTLSGLRRGAYRKGWFKRRHPGVPVLVVGNLTAGGAGKTPLTIALVERLRAEGWNPGVASRGYGRDDAGTARWVDTKSDAAQGGDEPVLIAHRTGAPVRVDKDRAAAAGALAQAGCDLVICDDGLQHYRLARDIEIEVVDGRRRYGNGRLLPAGPLRELPERGQTCDFRVVNVGTGGTATGFGEWSMRLVADAVDPMLGGRARKLGSFSGQRVHAVAGIGDPERFFSMLRDFGIAVVPHAFSDHHQYQAGDFEFGSRELPVLMTEKDAVKCAAFADERFFSVPVRAELPEAFWVSLLDRVAAKARQYRDGRASGTKTA

Samples

Sample ID Description Type Environment
1 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
127 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
128 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
129 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
130 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
157 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
164 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
221 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
233 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
234 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
235 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
236 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
237 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
238 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
239 2643221559 Lysobacter sp. Root559 Isolate Unclassified
240 2643221573 Lysobacter sp. Root604 Isolate Unclassified
241 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
242 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
243 2643221586 Lysobacter sp. Root667 Isolate Unclassified
244 2643221593 Lysobacter sp. Root690 Isolate Unclassified
245 2643221612 Lysobacter sp. Root76 Isolate Unclassified
246 2643221695 Lysobacter sp. Root494 Isolate Unclassified
247 2643221720 Lysobacter sp. Root916 Isolate Unclassified
248 2643221727 Lysobacter sp. Root96 Isolate Unclassified
249 2643221728 Lysobacter sp. Root983 Isolate Unclassified
250 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
251 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
252 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
253 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
254 2818991457 Xanthomonas translucens 569 Isolate Unclassified
255 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
256 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
257 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
258 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
259 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
260 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
261 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
262 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
263 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
264 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
265 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
266 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
267 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
268 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
269 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
270 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
271 2919513703 Luteimonas sp. 3794 Isolate Unclassified
272 2919675420 Luteimonas terrae 4099 Isolate Unclassified
273 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
274 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
275 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
276 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
277 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
278 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
279 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
280 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
281 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
282 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
283 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
284 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
285 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
286 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
287 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
288 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
289 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
290 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
291 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
292 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
293 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
294 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.78
Metatranscriptomes 0
Isolates 11.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 19.58
Nodule 0.19
Rhizoplane 3.04
Rhizosphere 54.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501043_0013024 3300049579 Bacteria 6501
2 JGI25152J39213_1000035 3300002773 Bacteria 93806
3 JGI25150J39212_1000236 3300002774 Bacteria 30024
4 JGI25151J46595_10000057 3300003187 Bacteria 151052
5 JGI25151J46595_10000080 3300003187 Bacteria 131551
6 JGI25151J46595_10005659 3300003187 Bacteria 6423
7 JGI25153J46596_10000041 3300003215 Bacteria 162103
8 rootH2_10014268 3300003320 Bacteria 20171
9 rootH1_10127287 3300003323 Bacteria 7746
10 Ga0055526_1000024 3300003771 Bacteria 158479
11 Ga0055526_1000405 3300003771 Bacteria 34858
12 Ga0055537_1000051 3300003773 Bacteria 85079
13 Ga0055537_1000500 3300003773 Bacteria 23689
14 Ga0055524_1000142 3300003775 Bacteria 85070
15 Ga0055524_1007691 3300003775 Bacteria 4552
16 Ga0055536_1004054 3300003781 Bacteria 7628
17 Ga0055536_1005362 3300003781 Bacteria 6289
18 Ga0055536_1005471 3300003781 Bacteria 6197
19 Ga0055536_1006528 3300003781 Bacteria 5421
20 Ga0055536_1009373 3300003781 Bacteria 4052
21 Ga0055534_1000058 3300003784 Bacteria 85079
22 Ga0055534_1000155 3300003784 Bacteria 51103
23 Ga0055528_1000016 3300003790 Bacteria 158479
24 Ga0055528_1000093 3300003790 Bacteria 71453
25 Ga0055530_10002531 3300003791 Bacteria 11650
26 Ga0055530_10003554 3300003791 Bacteria 8779
27 Ga0055530_10003555 3300003791 Bacteria 8776
28 Ga0055531_10006364 3300003794 Bacteria 6717
29 Ga0055531_10006830 3300003794 Bacteria 6367
30 Ga0055531_10008743 3300003794 Bacteria 5284
31 Ga0055531_10008871 3300003794 Bacteria 5224
32 Ga0055531_10010246 3300003794 Bacteria 4685
33 Ga0055531_10010598 3300003794 Bacteria 4558
34 Ga0055531_10012348 3300003794 Bacteria 4027
35 Ga0055531_10027113 3300003794 Bacteria 2021
36 Ga0058692_1000002 3300003856 Bacteria 508401
37 Ga0058692_1000006 3300003856 Bacteria 398109
38 Ga0065714_10132794 3300005288 Bacteria 1235
39 Ga0065704_10071998 3300005289 Bacteria 9420
40 Ga0065704_10074223 3300005289 Bacteria 6427
41 Ga0070670_100016146 3300005331 Bacteria 6409
42 Ga0068869_100298419 3300005334 Bacteria 1300
43 Ga0070680_100022902 3300005336 Bacteria 4977
44 Ga0070680_100155692 3300005336 Bacteria 1920
45 Ga0070680_100159561 3300005336 Bacteria 1894
46 Ga0068868_100325654 3300005338 Bacteria 1310
47 Ga0070660_100011869 3300005339 Bacteria 6209
48 Ga0070668_100017065 3300005347 Bacteria 5431
49 Ga0070669_100069083 3300005353 Bacteria 2609
50 Ga0070669_100078989 3300005353 Bacteria 2446
51 Ga0070675_100194584 3300005354 Bacteria 1758
52 Ga0070671_100116826 3300005355 Bacteria 2243
53 Ga0070667_100000108 3300005367 Bacteria 105301
54 Ga0070667_100229407 3300005367 Bacteria 1655
55 Ga0070714_100235785 3300005435 Bacteria 1687
56 Ga0070700_100003344 3300005441 Bacteria 8270
57 Ga0070663_100000070 3300005455 Bacteria 44357
58 Ga0070663_100077540 3300005455 Bacteria 2433
59 Ga0070663_100123863 3300005455 Bacteria 1956
60 Ga0070681_10043160 3300005458 Bacteria 4518
61 Ga0070681_10074311 3300005458 Bacteria 3360
62 Ga0068867_100060721 3300005459 Bacteria 2805
63 Ga0068867_100086219 3300005459 Bacteria 2375
64 Ga0070679_100076945 3300005530 Bacteria 3325
65 Ga0070679_100147247 3300005530 Bacteria 2332
66 Ga0068853_100002884 3300005539 Bacteria 13042
67 Ga0068853_100004551 3300005539 Bacteria 10759
68 Ga0068853_100028903 3300005539 Bacteria 4667
69 Ga0070672_100019135 3300005543 Bacteria 4964
70 Ga0070696_100036036 3300005546 Bacteria 3409
71 Ga0070665_100038534 3300005548 Bacteria 4805
72 Ga0070664_100325434 3300005564 Bacteria 1394
73 Ga0068856_100009238 3300005614 Bacteria 9587
74 Ga0068864_100024810 3300005618 Bacteria 5043
75 Ga0068863_100002876 3300005841 Bacteria 17046
76 Ga0068858_100235280 3300005842 Bacteria 1737
77 Ga0068860_100130283 3300005843 Bacteria 2413
78 Ga0068862_100153024 3300005844 Bacteria 2054
79 Ga0075364_10000141 3300006051 Bacteria 31242
80 Ga0075364_10325110 3300006051 Bacteria 1047
81 Ga0075367_10064513 3300006178 Bacteria 2191
82 Ga0068871_100099970 3300006358 Bacteria 2429
83 Ga0105251_10000261 3300009011 Bacteria 52880
84 Ga0105244_10115220 3300009036 Bacteria 1305
85 Ga0105250_10000006 3300009092 Bacteria 390071
86 Ga0105240_10005759 3300009093 Bacteria 18377
87 Ga0105243_10003831 3300009148 Bacteria 12028
88 Ga0105243_10015888 3300009148 Bacteria 5693
89 Ga0105243_10049201 3300009148 Bacteria 3324
90 Ga0105248_10002649 3300009177 Bacteria 19869
91 Ga0105248_10383497 3300009177 Bacteria 1582
92 Ga0105237_10001198 3300009545 Bacteria 34705
93 Ga0105237_10008213 3300009545 Bacteria 11339
94 Ga0105237_10040038 3300009545 Bacteria 4728
95 Ga0105249_10000426 3300009553 Bacteria 40153
96 Ga0105032_101928 3300009979 Bacteria 1874
97 Ga0105239_10006000 3300010375 Bacteria 14138
98 Ga0105239_10012655 3300010375 Bacteria 9387
99 Ga0157318_1000419 3300012482 Bacteria 1787
100 Ga0157373_10145519 3300013100 Bacteria 1667
101 Ga0157371_10000314 3300013102 Bacteria 63006
102 Ga0157371_10009804 3300013102 Bacteria 7513
103 Ga0157371_10021425 3300013102 Bacteria 4746
104 Ga0157371_10125848 3300013102 Bacteria 1822
105 Ga0157371_10181806 3300013102 Bacteria 1504
106 Ga0157370_10038859 3300013104 Bacteria 4603
107 Ga0157370_10042796 3300013104 Bacteria 4362
108 Ga0157370_10291476 3300013104 Bacteria 1507
109 Ga0157369_10037066 3300013105 Bacteria 5340
110 Ga0157369_10199750 3300013105 Bacteria 2099
111 Ga0157378_10252466 3300013297 Bacteria 1689
112 Ga0157372_10037434 3300013307 Bacteria 5352
113 Ga0157380_10193384 3300014326 Bacteria 1798
114 Ga0182008_10000264 3300014497 Bacteria 41157
115 Ga0182008_10024516 3300014497 Bacteria 3070
116 Ga0157379_10000087 3300014968 Bacteria 61431
117 Ga0182006_1012761 3300015261 Bacteria 3669
118 Ga0182007_10000111 3300015262 Bacteria 55925
119 Ga0182005_1000255 3300015265 Bacteria 33823
120 Ga0182005_1003003 3300015265 Bacteria 5831
121 Ga0183360_10001 3300015689 Bacteria 3943671
122 Ga0163161_10005943 3300017792 Bacteria 8460
123 Ga0163161_10013091 3300017792 Bacteria 5765
124 Ga0163161_10036670 3300017792 Bacteria 3512
125 Ga0207425_1000044 3300025245 Bacteria 195202
126 Ga0209026_1000158 3300025250 Bacteria 106333
127 Ga0209759_1005506 3300025256 Bacteria 4419
128 Ga0209129_1000044 3300025258 Bacteria 298971
129 Ga0209565_1000001 3300025263 Bacteria 2950419
130 Ga0209565_1000014 3300025263 Bacteria 530302
131 Ga0209455_1001416 3300025272 Bacteria 10865
132 Ga0209673_1000001 3300025273 Bacteria 3176258
133 Ga0209673_1000570 3300025273 Bacteria 58750
134 Ga0209673_1001811 3300025273 Bacteria 17554
135 Ga0209130_1003727 3300025284 Bacteria 6241
136 Ga0209675_1000001 3300025291 Bacteria 2950293
137 Ga0209675_1000021 3300025291 Bacteria 334833
138 Ga0209675_1009024 3300025291 Bacteria 3577
139 Ga0209676_1000024 3300025292 Bacteria 578839
140 Ga0209676_1000047 3300025292 Bacteria 408645
141 Ga0209676_1000079 3300025292 Bacteria 290447
142 Ga0209676_1001617 3300025292 Bacteria 19932
143 Ga0209676_1002237 3300025292 Bacteria 14284
144 Ga0209676_1002587 3300025292 Bacteria 12450
145 Ga0209676_1003153 3300025292 Bacteria 10529
146 Ga0209676_1004292 3300025292 Bacteria 8035
147 Ga0209676_1010370 3300025292 Bacteria 3895
148 Ga0209676_1013373 3300025292 Bacteria 3159
149 Ga0209025_1000012 3300025294 Bacteria 924362
150 Ga0209025_1000015 3300025294 Bacteria 808120
151 Ga0209025_1001739 3300025294 Bacteria 26163
152 Ga0209025_1029027 3300025294 Bacteria 2691
153 Ga0209025_1029972 3300025294 Bacteria 2616
154 Ga0209025_1035259 3300025294 Bacteria 2264
155 Ga0209025_1041550 3300025294 Bacteria 1967
156 Ga0209564_1000001 3300025295 Bacteria 3176258
157 Ga0209564_1000990 3300025295 Bacteria 35493
158 Ga0209564_1007773 3300025295 Bacteria 5444
159 Ga0209758_1000018 3300025297 Bacteria 753320
160 Ga0209758_1006183 3300025297 Bacteria 8754
161 Ga0209758_1020298 3300025297 Bacteria 3151
162 Ga0209758_1035302 3300025297 Bacteria 1973
163 Ga0209050_1000153 3300025298 Bacteria 160851
164 Ga0209050_1000311 3300025298 Bacteria 98948
165 Ga0209050_1002075 3300025298 Bacteria 18403
166 Ga0209050_1009393 3300025298 Bacteria 5013
167 Ga0209050_1009397 3300025298 Bacteria 5011
168 Ga0209256_1000002 3300025299 Bacteria 1906740
169 Ga0209256_1000890 3300025299 Bacteria 36781
170 Ga0209256_1000896 3300025299 Bacteria 36605
171 Ga0209256_1001492 3300025299 Bacteria 23795
172 Ga0209256_1002854 3300025299 Bacteria 13160
173 Ga0209051_1000458 3300025303 Bacteria 53808
174 Ga0209051_1011731 3300025303 Bacteria 4302
175 Ga0209257_1000080 3300025304 Bacteria 312038
176 Ga0209257_1000081 3300025304 Bacteria 306577
177 Ga0209257_1000122 3300025304 Bacteria 219678
178 Ga0209257_1001214 3300025304 Bacteria 32372
179 Ga0209257_1001644 3300025304 Bacteria 25517
180 Ga0209257_1001670 3300025304 Bacteria 25081
181 Ga0209257_1002094 3300025304 Bacteria 20980
182 Ga0209257_1002725 3300025304 Bacteria 16789
183 Ga0209257_1003816 3300025304 Bacteria 12372
184 Ga0209257_1012717 3300025304 Bacteria 3849
185 Ga0207696_1000333 3300025711 Bacteria 49519
186 Ga0207713_1000598 3300025735 Bacteria 35526
187 Ga0207707_10181706 3300025912 Bacteria 1836
188 Ga0207695_10002149 3300025913 Bacteria 29878
189 Ga0207671_10002319 3300025914 Bacteria 20536
190 Ga0207671_10003475 3300025914 Bacteria 15671
191 Ga0207660_10059885 3300025917 Bacteria 2735
192 Ga0207660_10409297 3300025917 Bacteria 1093
193 Ga0207657_10005785 3300025919 Bacteria 12892
194 Ga0207652_10102277 3300025921 Bacteria 2532
195 Ga0207681_10405023 3300025923 Bacteria 1102
196 Ga0207650_10002277 3300025925 Bacteria 13392
197 Ga0207659_10129103 3300025926 Bacteria 1948
198 Ga0207664_10314264 3300025929 Bacteria 1381
199 Ga0207706_10135253 3300025933 Bacteria 2168
200 Ga0207709_10000767 3300025935 Bacteria 25291
201 Ga0207709_10028069 3300025935 Bacteria 3250
202 Ga0207691_10001092 3300025940 Bacteria 26983
203 Ga0207667_10139931 3300025949 Bacteria 2492
204 Ga0207712_10000363 3300025961 Bacteria 40122
205 Ga0207668_10018993 3300025972 Bacteria 4335
206 Ga0207658_10000093 3300025986 Bacteria 98928
207 Ga0207658_10087686 3300025986 Bacteria 2404
208 Ga0207703_10334370 3300026035 Bacteria 1390
209 Ga0207639_10001135 3300026041 Bacteria 18080
210 Ga0207639_10084754 3300026041 Bacteria 2518
211 Ga0207678_10030184 3300026067 Bacteria 4733
212 Ga0207678_10033888 3300026067 Bacteria 4448
213 Ga0207708_10002841 3300026075 Bacteria 12741
214 Ga0207702_10000290 3300026078 Bacteria 58330
215 Ga0207641_10161011 3300026088 Bacteria 2040
216 Ga0207648_10043250 3300026089 Bacteria 3954
217 Ga0207648_10067367 3300026089 Bacteria 3121
218 Ga0207676_10043278 3300026095 Bacteria 3467
219 Ga0207674_10009737 3300026116 Bacteria 10949
220 Ga0209371_1000004 3300027312 Bacteria 1098197
221 Ga0209371_1000016 3300027312 Bacteria 646301
222 Ga0209970_1004953 3300027614 Bacteria 2202
223 Ga0209983_1004093 3300027665 Bacteria 3078
224 Ga0209971_1001280 3300027682 Bacteria 6267
225 Ga0268266_10011472 3300028379 Bacteria 7698
226 Ga0268266_10305283 3300028379 Bacteria 1486
227 Ga0268265_10037052 3300028380 Bacteria 3576
228 Ga0268265_10077648 3300028380 Bacteria 2609
229 Ga0268265_10105775 3300028380 Bacteria 2284
230 Ga0268264_10240386 3300028381 Bacteria 1677
231 Ga0268256_1000005 3300030500 Bacteria 1082342
232 Ga0268256_1000015 3300030500 Bacteria 646300
233 Ga0316177_1042085 3300030731 Bacteria 2227
234 Ga0316176_1019534 3300030732 Bacteria 1940
235 Ga0316176_1165582 3300030732 Bacteria 5946
236 Ga0314311_1184420 3300030733 Bacteria 4554
237 Ga0316183_1123718 3300030742 Bacteria 4353
238 Ga0307513_10004763 3300031456 Bacteria 18017
239 Ga0307408_100351360 3300031548 Bacteria 1251
240 Ga0307405_10119429 3300031731 Bacteria 1801
241 Ga0307413_10002372 3300031824 Bacteria 7643
242 Ga0307410_10276870 3300031852 Bacteria 1315
243 Ga0307406_10022304 3300031901 Bacteria 3755
244 Ga0307407_10040456 3300031903 Bacteria 2599
245 Ga0307412_10000115 3300031911 Bacteria 61620
246 Ga0307414_10003669 3300032004 Bacteria 8228
247 Ga0307414_10009845 3300032004 Bacteria 5510
248 Ga0307414_10010133 3300032004 Bacteria 5451
249 Ga0307414_10104409 3300032004 Bacteria 2140
250 Ga0307414_10130437 3300032004 Bacteria 1950
251 Ga0307414_10163979 3300032004 Bacteria 1769
252 Ga0307414_10172519 3300032004 Bacteria 1730
253 Ga0307411_10096481 3300032005 Bacteria 2078
254 Ga0373960_0014119 3300035121 Bacteria 2018
255 Ga0395899_0005871 3300037312 Bacteria 9528
256 Ga0395899_0069674 3300037312 Bacteria 2575
257 Ga0395900_0001828 3300037418 Bacteria 24288
258 Ga0395900_0462862 3300037418 Bacteria 1223
259 Ga0395898_0334377 3300037466 Bacteria 1444
260 Ga0395905_0001042 3300037471 Bacteria 35110
261 Ga0395905_0275723 3300037471 Bacteria 1567
262 Ga0395901_0061175 3300038443 Bacteria 3918
263 Ga0237819_00245 3300038705 Bacteria 19768
264 Ga0237819_09465 3300038705 Bacteria 1306
265 Ga0439436_0004573 3300041404 Bacteria 4241
266 Ga0439436_0031546 3300041404 Bacteria 1538
267 Ga0439436_0039942 3300041404 Bacteria 1346
268 Ga0439447_005127 3300041407 Bacteria 4396
269 Ga0439465_0000027 3300041413 Bacteria 29319
270 Ga0439465_0002863 3300041413 Bacteria 5650
271 Ga0439465_0025392 3300041413 Bacteria 1870
272 Ga0451791_1488951 3300041451 Bacteria 1378
273 Ga0451793_0311360 3300041452 Bacteria 2808
274 Ga0451793_0603339 3300041452 Bacteria 2003
275 Ga0451797_0254407 3300041453 Bacteria 1431
276 Ga0451798_0509102 3300041458 Bacteria 1860
277 Ga0451807_0176940 3300041486 Bacteria 1448
278 Ga0451807_1026026 3300041486 Bacteria 3941
279 Ga0451841_0931635 3300041498 Bacteria 1518
280 Ga0451847_0753956 3300041503 Bacteria 1760
281 Ga0451849_0742676 3300041505 Bacteria 1506
282 Ga0451843_0088182 3300041509 Bacteria 1233
283 Ga0451853_0870536 3300041512 Bacteria 1575
284 Ga0439432_003034 3300042006 Bacteria 6252
285 Ga0439432_017675 3300042006 Bacteria 2391
286 Ga0439449_0000093 3300042007 Bacteria 28815
287 Ga0439449_0027914 3300042007 Bacteria 2105
288 Ga0439449_0034219 3300042007 Bacteria 1891
289 Ga0439449_0040916 3300042007 Bacteria 1723
290 Ga0439449_0100209 3300042007 Bacteria 1071
291 Ga0439452_008963 3300042010 Bacteria 2979
292 Ga0450901_002690 3300042533 Bacteria 1895
293 Ga0451577_0018280 3300042876 Bacteria 6459
294 Ga0495627_033463 3300046453 Bacteria 1611
295 Ga0495638_0011107 3300046460 Bacteria 6224
296 Ga0495607_0005959 3300046501 Bacteria 8643
297 Ga0495606_0008762 3300046507 Bacteria 8692
298 Ga0495610_0009775 3300046512 Bacteria 6026
299 Ga0495616_0012826 3300046513 Bacteria 4742
300 Ga0495631_0001216 3300046518 Bacteria 15899
301 Ga0495632_0053195 3300046519 Bacteria 1989
302 Ga0495643_0002561 3300046522 Bacteria 14201
303 Ga0495663_0001531 3300046525 Bacteria 7267
304 Ga0495663_0002073 3300046525 Bacteria 6130
305 Ga0495663_0003516 3300046525 Bacteria 4514
306 Ga0495663_0011852 3300046525 Bacteria 2429
307 Ga0495598_0000769 3300046537 Bacteria 6112
308 Ga0495621_0005091 3300046539 Bacteria 3751
309 Ga0495633_0020789 3300046558 Bacteria 3295
310 Ga0495656_0002051 3300046615 Bacteria 6643
311 Ga0495656_0003135 3300046615 Bacteria 5561
312 Ga0495668_0001007 3300046616 Bacteria 30277
313 Ga0495625_0083212 3300046660 Bacteria 2224
314 Ga0495625_0105148 3300046660 Bacteria 1934
315 Ga0495670_0050511 3300046691 Bacteria 2082
316 Ga0495671_0004376 3300046692 Bacteria 8464
317 Ga0495636_0003114 3300047318 Bacteria 6434
318 Ga0495672_0000134 3300047320 Bacteria 110142
319 Ga0495672_0062459 3300047320 Bacteria 2142
320 Ga0495681_0094090 3300047470 Bacteria 1319
321 Ga0495686_0006280 3300047472 Bacteria 9141
322 Ga0495686_0010513 3300047472 Bacteria 6577
323 Ga0495686_0022413 3300047472 Bacteria 4180
324 Ga0496101_0164445 3300048904 Bacteria 1703
325 Ga0496105_0102454 3300048908 Bacteria 2364
326 Ga0496106_0177986 3300048909 Bacteria 1688
327 Ga0496107_0196068 3300048910 Bacteria 1501
328 Ga0496108_0236891 3300048911 Bacteria 1587
329 Ga0496109_0025862 3300048912 Bacteria 5232
330 Ga0496110_0110397 3300048913 Bacteria 2471
331 Ga0496113_0061694 3300048916 Bacteria 2829
332 Ga0496114_0002418 3300048917 Bacteria 14241
333 Ga0496116_0000379 3300048919 Bacteria 66179
334 Ga0496116_0004882 3300048919 Bacteria 12649
335 Ga0496116_0048604 3300048919 Bacteria 2845
336 Ga0496117_0002130 3300048920 Bacteria 25899
337 Ga0496117_0003468 3300048920 Bacteria 18312
338 Ga0496117_0004169 3300048920 Bacteria 16159
339 Ga0496117_0024962 3300048920 Bacteria 4708
340 Ga0496117_0027916 3300048920 Bacteria 4380
341 Ga0496117_0049132 3300048920 Bacteria 3004
342 Ga0496117_0077420 3300048920 Bacteria 2201
343 Ga0496117_0084608 3300048920 Bacteria 2068
344 Ga0496118_0000145 3300048921 Bacteria 123886
345 Ga0496118_0000166 3300048921 Bacteria 119204
346 Ga0496118_0000573 3300048921 Bacteria 60932
347 Ga0496118_0022049 3300048921 Bacteria 5583
348 Ga0496118_0027038 3300048921 Bacteria 4866
349 Ga0496118_0039516 3300048921 Bacteria 3763
350 Ga0496118_0077296 3300048921 Bacteria 2361
351 Ga0496118_0085457 3300048921 Bacteria 2197
352 Ga0496119_0000211 3300048922 Bacteria 83064
353 Ga0496119_0000550 3300048922 Bacteria 51088
354 Ga0496119_0019937 3300048922 Bacteria 4912
355 Ga0496120_0000432 3300048923 Bacteria 66285
356 Ga0496120_0004047 3300048923 Bacteria 12694
357 Ga0496121_0007855 3300048924 Bacteria 12757
358 Ga0496121_0018930 3300048924 Bacteria 6909
359 Ga0496121_0026218 3300048924 Bacteria 5500
360 Ga0496121_0034397 3300048924 Bacteria 4561
361 Ga0496121_0055823 3300048924 Bacteria 3287
362 Ga0496121_0112477 3300048924 Bacteria 2074
363 Ga0496121_0163728 3300048924 Bacteria 1623
364 Ga0496122_0000158 3300048925 Bacteria 159352
365 Ga0496122_0001084 3300048925 Bacteria 47272
366 Ga0496122_0001279 3300048925 Bacteria 41853
367 Ga0496122_0006292 3300048925 Bacteria 13689
368 Ga0496122_0012051 3300048925 Bacteria 8668
369 Ga0496122_0035673 3300048925 Bacteria 4040
370 Ga0496122_0037021 3300048925 Bacteria 3935
371 Ga0496122_0042863 3300048925 Bacteria 3554
372 Ga0496122_0044515 3300048925 Bacteria 3461
373 Ga0496122_0047560 3300048925 Bacteria 3311
374 Ga0496122_0103483 3300048925 Bacteria 1894
375 Ga0496123_0000120 3300048926 Bacteria 159406
376 Ga0496123_0002035 3300048926 Bacteria 26128
377 Ga0496123_0004739 3300048926 Bacteria 14079
378 Ga0496123_0005462 3300048926 Bacteria 12794
379 Ga0496123_0018827 3300048926 Bacteria 5472
380 Ga0496123_0020303 3300048926 Bacteria 5201
381 Ga0496123_0029301 3300048926 Bacteria 4056
382 Ga0496123_0036030 3300048926 Bacteria 3515
383 Ga0496123_0037707 3300048926 Bacteria 3409
384 Ga0496124_0000009 3300048927 Bacteria 734820
385 Ga0496124_0000255 3300048927 Bacteria 102645
386 Ga0496124_0000700 3300048927 Bacteria 54959
387 Ga0496124_0010152 3300048927 Bacteria 9580
388 Ga0496124_0011563 3300048927 Bacteria 8808
389 Ga0496124_0012194 3300048927 Bacteria 8504
390 Ga0496124_0020070 3300048927 Bacteria 6189
391 Ga0496124_0032446 3300048927 Bacteria 4610
392 Ga0496124_0076106 3300048927 Bacteria 2771
393 Ga0496124_0117953 3300048927 Bacteria 2125
394 Ga0496124_0143116 3300048927 Bacteria 1884
395 Ga0496124_0227914 3300048927 Bacteria 1395
396 Ga0496124_0327243 3300048927 Bacteria 1094
397 Ga0496124_0348530 3300048927 Bacteria 1048
398 Ga0496125_0001909 3300048928 Bacteria 28515
399 Ga0496125_0013398 3300048928 Bacteria 8063
400 Ga0496125_0016061 3300048928 Bacteria 7207
401 Ga0496125_0019874 3300048928 Bacteria 6318
402 Ga0496125_0044544 3300048928 Bacteria 3750
403 Ga0496125_0086287 3300048928 Bacteria 2374
404 Ga0496126_0000806 3300048929 Bacteria 56104
405 Ga0496126_0017421 3300048929 Bacteria 7158
406 Ga0501031_0007389 3300049568 Bacteria 7160
407 Ga0501031_0034121 3300049568 Bacteria 3321
408 Ga0501032_0001852 3300049569 Bacteria 16730
409 Ga0501032_0022563 3300049569 Bacteria 4362
410 Ga0501032_0031644 3300049569 Bacteria 3627
411 Ga0501032_0182851 3300049569 Bacteria 1372
412 Ga0501033_0001325 3300049570 Bacteria 22021
413 Ga0501033_0004497 3300049570 Bacteria 11158
414 Ga0501033_0148984 3300049570 Bacteria 1689
415 Ga0501034_0000415 3300049571 Bacteria 71688
416 Ga0501034_0000431 3300049571 Bacteria 69520
417 Ga0501034_0006842 3300049571 Bacteria 12199
418 Ga0501034_0009734 3300049571 Bacteria 10048
419 Ga0501034_0013640 3300049571 Bacteria 8357
420 Ga0501036_0025497 3300049572 Bacteria 4988
421 Ga0501036_0045063 3300049572 Bacteria 3737
422 Ga0501037_0002636 3300049573 Bacteria 12927
423 Ga0501037_0006365 3300049573 Bacteria 8634
424 Ga0501038_0000372 3300049574 Bacteria 38621
425 Ga0501038_0056930 3300049574 Bacteria 3357
426 Ga0501039_0040530 3300049575 Bacteria 3595
427 Ga0501039_0051701 3300049575 Bacteria 3179
428 Ga0501039_0371412 3300049575 Bacteria 1124
429 Ga0501043_0028687 3300049579 Bacteria 4368
430 Ga0501043_0110393 3300049579 Bacteria 2159
431 Ga0501043_0133466 3300049579 Bacteria 1946
432 Ga0501046_0000242 3300049580 Bacteria 56090
433 Ga0501047_0012320 3300049581 Bacteria 8094
434 Ga0501047_0049579 3300049581 Bacteria 4054
435 Ga0501047_0071060 3300049581 Bacteria 3351
436 Ga0501047_0299157 3300049581 Bacteria 1452
437 Ga0501070_0032812 3300049586 Bacteria 4344
438 Ga0501070_0065520 3300049586 Bacteria 3008
439 Ga0501070_0091295 3300049586 Bacteria 2521
440 Ga0501073_0011860 3300049589 Bacteria 6363
441 Ga0501073_0020523 3300049589 Bacteria 4765
442 Ga0501223_008954 3300049663 Bacteria 2035
443 Ga0501257_026183 3300049686 Bacteria 1391
444 Ga0501080_0036995 3300049742 Bacteria 4557
445 Ga0501083_0036594 3300049744 Bacteria 3347
446 Ga0501270_001588 3300049767 Bacteria 2205
447 Ga0501035_0002161 3300049822 Bacteria 19514
448 Ga0501035_0009933 3300049822 Bacteria 8837
449 Ga0501035_0029548 3300049822 Bacteria 4999
450 Ga0501035_0198994 3300049822 Bacteria 1719
451 Ga0501044_0014154 3300049823 Bacteria 8612
452 Ga0501044_0015037 3300049823 Bacteria 8343
453 Ga0501044_0042529 3300049823 Bacteria 4725
454 Ga0501044_0049041 3300049823 Bacteria 4358
455 nmdc:mga00v17_152487_c1 3300050491 Bacteria 1485
456 nmdc:mga00v17_31706_c1 3300050491 Bacteria 3119
457 nmdc:mga00v17_39924_c1 3300050491 Bacteria 2813
458 nmdc:mga00v17_88_c1 3300050491 Bacteria 56091
459 nmdc:mga0qj67_36311_c1 3300050509 Bacteria 3855
460 nmdc:mga08x19_104484_c1 3300050514 Bacteria 1882
461 nmdc:mga08x19_71295_c1 3300050514 Bacteria 2265
462 Ga0500610_0006571 3300053079 Bacteria 4887
463 Ga0500651_0110217 3300053093 Bacteria 1680
464 Ga0500597_000184 3300053120 Bacteria 12796
465 Ga0500626_060569 3300053128 Bacteria 1693
466 Ga0500634_0000036 3300053161 Bacteria 64860
467 Ga0500661_015331 3300055283 Bacteria 1375
468 2547500927 2547132130 Bacteria 4660562
469 2572255185 2571042365 Bacteria 3289345
470 2578458890 2576861471 Bacteria 4648976
471 2643817576 2643221559 Bacteria 4424915
472 2643878779 2643221573 Bacteria 4784121
473 2643908490 2643221579 Bacteria 4443405
474 2643916330 2643221581 Bacteria 3893603
475 2643940230 2643221586 Bacteria 4446529
476 2643974146 2643221593 Bacteria 6296053
477 2644079358 2643221612 Bacteria 4361984
478 2644530043 2643221695 Bacteria 3441323
479 2644660096 2643221720 Bacteria 4694283
480 2644694802 2643221727 Bacteria 4415595
481 2644697396 2643221728 Bacteria 4797149
482 2747948784 2747842428 Bacteria 4689383
483 2748016169 2747842501 Bacteria 5293829
484 2765578483 2765235840 Bacteria 4663337
485 2816516501 2816332141 Bacteria 4436036
486 2819659861 2818991457 Bacteria 5323295
487 2842392783 2842391507 Bacteria 4486072
488 2842758573 2842757796 Bacteria 3981385
489 2842781008 2842780639 Bacteria 4337790
490 2852651241 2852649853 Bacteria 4036942
491 2852685313 2852684882 Bacteria 5463342
492 2857446366 2857442823 Bacteria 4562550
493 2874221110 2874220319 Bacteria 4594709
494 2891634634 2891633521 Bacteria 4602265
495 2894416234 2894414249 Bacteria 4405451
496 2895504020 2895498888 Bacteria 5283788
497 2895515368 2895511927 Bacteria 6802080
498 2895525115 2895522137 Bacteria 3284416
499 2895527852 2895525241 Bacteria 3388457
500 2919091320 2919089067 Bacteria 4560942
501 2919131430 2919130084 Bacteria 5301837
502 2919136341 2919134579 Bacteria 4480386
503 2919516349 2919513703 Bacteria 3844312
504 2919676812 2919675420 Bacteria 3969095
505 2923518113 2923516293 Bacteria 3716336
506 2928497952 2928496128 Bacteria 4631123
507 2929198148 2929195423 Bacteria 5325372
508 2931381245 2931380184 Bacteria 4455911
509 2937611932 2937610967 Bacteria 4618818
510 2939590600 2939589442 Bacteria 4214238
511 2939622768 2939622612 Bacteria 4698046
512 2939629663 2939626828 Bacteria 4695272
513 2941477817 2941475908 Bacteria 4145589
514 2941494223 2941489479 Bacteria 6313767
515 2961047875 2961047084 Bacteria 4594415
516 2961067213 2961064222 Bacteria 4749990
517 2974309352 2974307012 Bacteria 4172388
518 2977250073 2977247770 Bacteria 4160543
519 2984515437 2984514374 Bacteria 4172479
520 2987607338 2987605356 Bacteria 4187822
521 2995951203 2995948881 Bacteria 6358104
522 8002871993 8002869464 Bacteria 3588529
523 8003016052 8003014200 Bacteria 4059994
524 8021624754 8021622325 Bacteria 4844743
525 8021629968 8021626552 Bacteria 4665214
526 8021651359 8021648035 Bacteria 4772378
527 Ga0501043_0013024
528 JGI25152J39213_1000035
529 JGI25150J39212_1000236
530 JGI25151J46595_10000057
531 JGI25151J46595_10000080
532 JGI25151J46595_10005659
533 JGI25153J46596_10000041
534 rootH2_10014268
535 rootH1_10127287
536 Ga0055526_1000024
537 Ga0055526_1000405
538 Ga0055537_1000051
539 Ga0055537_1000500
540 Ga0055524_1000142
541 Ga0055524_1007691
542 Ga0055536_1004054
543 Ga0055536_1005362
544 Ga0055536_1005471
545 Ga0055536_1006528
546 Ga0055536_1009373
547 Ga0055534_1000058
548 Ga0055534_1000155
549 Ga0055528_1000016
550 Ga0055528_1000093
551 Ga0055530_10002531
552 Ga0055530_10003554
553 Ga0055530_10003555
554 Ga0055531_10006364
555 Ga0055531_10006830
556 Ga0055531_10008743
557 Ga0055531_10008871
558 Ga0055531_10010246
559 Ga0055531_10010598
560 Ga0055531_10012348
561 Ga0055531_10027113
562 Ga0058692_1000002
563 Ga0058692_1000006
564 Ga0065714_10132794
565 Ga0065704_10071998
566 Ga0065704_10074223
567 Ga0070670_100016146
568 Ga0068869_100298419
569 Ga0070680_100022902
570 Ga0070680_100155692
571 Ga0070680_100159561
572 Ga0068868_100325654
573 Ga0070660_100011869
574 Ga0070668_100017065
575 Ga0070669_100069083
576 Ga0070669_100078989
577 Ga0070675_100194584
578 Ga0070671_100116826
579 Ga0070667_100000108
580 Ga0070667_100229407
581 Ga0070714_100235785
582 Ga0070700_100003344
583 Ga0070663_100000070
584 Ga0070663_100077540
585 Ga0070663_100123863
586 Ga0070681_10043160
587 Ga0070681_10074311
588 Ga0068867_100060721
589 Ga0068867_100086219
590 Ga0070679_100076945
591 Ga0070679_100147247
592 Ga0068853_100002884
593 Ga0068853_100004551
594 Ga0068853_100028903
595 Ga0070672_100019135
596 Ga0070696_100036036
597 Ga0070665_100038534
598 Ga0070664_100325434
599 Ga0068856_100009238
600 Ga0068864_100024810
601 Ga0068863_100002876
602 Ga0068858_100235280
603 Ga0068860_100130283
604 Ga0068862_100153024
605 Ga0075364_10000141
606 Ga0075364_10325110
607 Ga0075367_10064513
608 Ga0068871_100099970
609 Ga0105251_10000261
610 Ga0105244_10115220
611 Ga0105250_10000006
612 Ga0105240_10005759
613 Ga0105243_10003831
614 Ga0105243_10015888
615 Ga0105243_10049201
616 Ga0105248_10002649
617 Ga0105248_10383497
618 Ga0105237_10001198
619 Ga0105237_10008213
620 Ga0105237_10040038
621 Ga0105249_10000426
622 Ga0105032_101928
623 Ga0105239_10006000
624 Ga0105239_10012655
625 Ga0157318_1000419
626 Ga0157373_10145519
627 Ga0157371_10000314
628 Ga0157371_10009804
629 Ga0157371_10021425
630 Ga0157371_10125848
631 Ga0157371_10181806
632 Ga0157370_10038859
633 Ga0157370_10042796
634 Ga0157370_10291476
635 Ga0157369_10037066
636 Ga0157369_10199750
637 Ga0157378_10252466
638 Ga0157372_10037434
639 Ga0157380_10193384
640 Ga0182008_10000264
641 Ga0182008_10024516
642 Ga0157379_10000087
643 Ga0182006_1012761
644 Ga0182007_10000111
645 Ga0182005_1000255
646 Ga0182005_1003003
647 Ga0183360_10001
648 Ga0163161_10005943
649 Ga0163161_10013091
650 Ga0163161_10036670
651 Ga0207425_1000044
652 Ga0209026_1000158
653 Ga0209759_1005506
654 Ga0209129_1000044
655 Ga0209565_1000001
656 Ga0209565_1000014
657 Ga0209455_1001416
658 Ga0209673_1000001
659 Ga0209673_1000570
660 Ga0209673_1001811
661 Ga0209130_1003727
662 Ga0209675_1000001
663 Ga0209675_1000021
664 Ga0209675_1009024
665 Ga0209676_1000024
666 Ga0209676_1000047
667 Ga0209676_1000079
668 Ga0209676_1001617
669 Ga0209676_1002237
670 Ga0209676_1002587
671 Ga0209676_1003153
672 Ga0209676_1004292
673 Ga0209676_1010370
674 Ga0209676_1013373
675 Ga0209025_1000012
676 Ga0209025_1000015
677 Ga0209025_1001739
678 Ga0209025_1029027
679 Ga0209025_1029972
680 Ga0209025_1035259
681 Ga0209025_1041550
682 Ga0209564_1000001
683 Ga0209564_1000990
684 Ga0209564_1007773
685 Ga0209758_1000018
686 Ga0209758_1006183
687 Ga0209758_1020298
688 Ga0209758_1035302
689 Ga0209050_1000153
690 Ga0209050_1000311
691 Ga0209050_1002075
692 Ga0209050_1009393
693 Ga0209050_1009397
694 Ga0209256_1000002
695 Ga0209256_1000890
696 Ga0209256_1000896
697 Ga0209256_1001492
698 Ga0209256_1002854
699 Ga0209051_1000458
700 Ga0209051_1011731
701 Ga0209257_1000080
702 Ga0209257_1000081
703 Ga0209257_1000122
704 Ga0209257_1001214
705 Ga0209257_1001644
706 Ga0209257_1001670
707 Ga0209257_1002094
708 Ga0209257_1002725
709 Ga0209257_1003816
710 Ga0209257_1012717
711 Ga0207696_1000333
712 Ga0207713_1000598
713 Ga0207707_10181706
714 Ga0207695_10002149
715 Ga0207671_10002319
716 Ga0207671_10003475
717 Ga0207660_10059885
718 Ga0207660_10409297
719 Ga0207657_10005785
720 Ga0207652_10102277
721 Ga0207681_10405023
722 Ga0207650_10002277
723 Ga0207659_10129103
724 Ga0207664_10314264
725 Ga0207706_10135253
726 Ga0207709_10000767
727 Ga0207709_10028069
728 Ga0207691_10001092
729 Ga0207667_10139931
730 Ga0207712_10000363
731 Ga0207668_10018993
732 Ga0207658_10000093
733 Ga0207658_10087686
734 Ga0207703_10334370
735 Ga0207639_10001135
736 Ga0207639_10084754
737 Ga0207678_10030184
738 Ga0207678_10033888
739 Ga0207708_10002841
740 Ga0207702_10000290
741 Ga0207641_10161011
742 Ga0207648_10043250
743 Ga0207648_10067367
744 Ga0207676_10043278
745 Ga0207674_10009737
746 Ga0209371_1000004
747 Ga0209371_1000016
748 Ga0209970_1004953
749 Ga0209983_1004093
750 Ga0209971_1001280
751 Ga0268266_10011472
752 Ga0268266_10305283
753 Ga0268265_10037052
754 Ga0268265_10077648
755 Ga0268265_10105775
756 Ga0268264_10240386
757 Ga0268256_1000005
758 Ga0268256_1000015
759 Ga0316177_1042085
760 Ga0316176_1019534
761 Ga0316176_1165582
762 Ga0314311_1184420
763 Ga0316183_1123718
764 Ga0307513_10004763
765 Ga0307408_100351360
766 Ga0307405_10119429
767 Ga0307413_10002372
768 Ga0307410_10276870
769 Ga0307406_10022304
770 Ga0307407_10040456
771 Ga0307412_10000115
772 Ga0307414_10003669
773 Ga0307414_10009845
774 Ga0307414_10010133
775 Ga0307414_10104409
776 Ga0307414_10130437
777 Ga0307414_10163979
778 Ga0307414_10172519
779 Ga0307411_10096481
780 Ga0373960_0014119
781 Ga0395899_0005871
782 Ga0395899_0069674
783 Ga0395900_0001828
784 Ga0395900_0462862
785 Ga0395898_0334377
786 Ga0395905_0001042
787 Ga0395905_0275723
788 Ga0395901_0061175
789 Ga0237819_00245
790 Ga0237819_09465
791 Ga0439436_0004573
792 Ga0439436_0031546
793 Ga0439436_0039942
794 Ga0439447_005127
795 Ga0439465_0000027
796 Ga0439465_0002863
797 Ga0439465_0025392
798 Ga0451791_1488951
799 Ga0451793_0311360
800 Ga0451793_0603339
801 Ga0451797_0254407
802 Ga0451798_0509102
803 Ga0451807_0176940
804 Ga0451807_1026026
805 Ga0451841_0931635
806 Ga0451847_0753956
807 Ga0451849_0742676
808 Ga0451843_0088182
809 Ga0451853_0870536
810 Ga0439432_003034
811 Ga0439432_017675
812 Ga0439449_0000093
813 Ga0439449_0027914
814 Ga0439449_0034219
815 Ga0439449_0040916
816 Ga0439449_0100209
817 Ga0439452_008963
818 Ga0450901_002690
819 Ga0451577_0018280
820 Ga0495627_033463
821 Ga0495638_0011107
822 Ga0495607_0005959
823 Ga0495606_0008762
824 Ga0495610_0009775
825 Ga0495616_0012826
826 Ga0495631_0001216
827 Ga0495632_0053195
828 Ga0495643_0002561
829 Ga0495663_0001531
830 Ga0495663_0002073
831 Ga0495663_0003516
832 Ga0495663_0011852
833 Ga0495598_0000769
834 Ga0495621_0005091
835 Ga0495633_0020789
836 Ga0495656_0002051
837 Ga0495656_0003135
838 Ga0495668_0001007
839 Ga0495625_0083212
840 Ga0495625_0105148
841 Ga0495670_0050511
842 Ga0495671_0004376
843 Ga0495636_0003114
844 Ga0495672_0000134
845 Ga0495672_0062459
846 Ga0495681_0094090
847 Ga0495686_0006280
848 Ga0495686_0010513
849 Ga0495686_0022413
850 Ga0496101_0164445
851 Ga0496105_0102454
852 Ga0496106_0177986
853 Ga0496107_0196068
854 Ga0496108_0236891
855 Ga0496109_0025862
856 Ga0496110_0110397
857 Ga0496113_0061694
858 Ga0496114_0002418
859 Ga0496116_0000379
860 Ga0496116_0004882
861 Ga0496116_0048604
862 Ga0496117_0002130
863 Ga0496117_0003468
864 Ga0496117_0004169
865 Ga0496117_0024962
866 Ga0496117_0027916
867 Ga0496117_0049132
868 Ga0496117_0077420
869 Ga0496117_0084608
870 Ga0496118_0000145
871 Ga0496118_0000166
872 Ga0496118_0000573
873 Ga0496118_0022049
874 Ga0496118_0027038
875 Ga0496118_0039516
876 Ga0496118_0077296
877 Ga0496118_0085457
878 Ga0496119_0000211
879 Ga0496119_0000550
880 Ga0496119_0019937
881 Ga0496120_0000432
882 Ga0496120_0004047
883 Ga0496121_0007855
884 Ga0496121_0018930
885 Ga0496121_0026218
886 Ga0496121_0034397
887 Ga0496121_0055823
888 Ga0496121_0112477
889 Ga0496121_0163728
890 Ga0496122_0000158
891 Ga0496122_0001084
892 Ga0496122_0001279
893 Ga0496122_0006292
894 Ga0496122_0012051
895 Ga0496122_0035673
896 Ga0496122_0037021
897 Ga0496122_0042863
898 Ga0496122_0044515
899 Ga0496122_0047560
900 Ga0496122_0103483
901 Ga0496123_0000120
902 Ga0496123_0002035
903 Ga0496123_0004739
904 Ga0496123_0005462
905 Ga0496123_0018827
906 Ga0496123_0020303
907 Ga0496123_0029301
908 Ga0496123_0036030
909 Ga0496123_0037707
910 Ga0496124_0000009
911 Ga0496124_0000255
912 Ga0496124_0000700
913 Ga0496124_0010152
914 Ga0496124_0011563
915 Ga0496124_0012194
916 Ga0496124_0020070
917 Ga0496124_0032446
918 Ga0496124_0076106
919 Ga0496124_0117953
920 Ga0496124_0143116
921 Ga0496124_0227914
922 Ga0496124_0327243
923 Ga0496124_0348530
924 Ga0496125_0001909
925 Ga0496125_0013398
926 Ga0496125_0016061
927 Ga0496125_0019874
928 Ga0496125_0044544
929 Ga0496125_0086287
930 Ga0496126_0000806
931 Ga0496126_0017421
932 Ga0501031_0007389
933 Ga0501031_0034121
934 Ga0501032_0001852
935 Ga0501032_0022563
936 Ga0501032_0031644
937 Ga0501032_0182851
938 Ga0501033_0001325
939 Ga0501033_0004497
940 Ga0501033_0148984
941 Ga0501034_0000415
942 Ga0501034_0000431
943 Ga0501034_0006842
944 Ga0501034_0009734
945 Ga0501034_0013640
946 Ga0501036_0025497
947 Ga0501036_0045063
948 Ga0501037_0002636
949 Ga0501037_0006365
950 Ga0501038_0000372
951 Ga0501038_0056930
952 Ga0501039_0040530
953 Ga0501039_0051701
954 Ga0501039_0371412
955 Ga0501043_0028687
956 Ga0501043_0110393
957 Ga0501043_0133466
958 Ga0501046_0000242
959 Ga0501047_0012320
960 Ga0501047_0049579
961 Ga0501047_0071060
962 Ga0501047_0299157
963 Ga0501070_0032812
964 Ga0501070_0065520
965 Ga0501070_0091295
966 Ga0501073_0011860
967 Ga0501073_0020523
968 Ga0501223_008954
969 Ga0501257_026183
970 Ga0501080_0036995
971 Ga0501083_0036594
972 Ga0501270_001588
973 Ga0501035_0002161
974 Ga0501035_0009933
975 Ga0501035_0029548
976 Ga0501035_0198994
977 Ga0501044_0014154
978 Ga0501044_0015037
979 Ga0501044_0042529
980 Ga0501044_0049041
981 nmdc:mga00v17_152487_c1
982 nmdc:mga00v17_31706_c1
983 nmdc:mga00v17_39924_c1
984 nmdc:mga00v17_88_c1
985 nmdc:mga0qj67_36311_c1
986 nmdc:mga08x19_104484_c1
987 nmdc:mga08x19_71295_c1
988 Ga0500610_0006571
989 Ga0500651_0110217
990 Ga0500597_000184
991 Ga0500626_060569
992 Ga0500634_0000036
993 Ga0500661_015331
994 2547500927
995 2572255185
996 2578458890
997 2643817576
998 2643878779
999 2643908490
1000 2643916330
1001 2643940230
1002 2643974146
1003 2644079358
1004 2644530043
1005 2644660096
1006 2644694802
1007 2644697396
1008 2747948784
1009 2748016169
1010 2765578483
1011 2816516501
1012 2819659861
1013 2842392783
1014 2842758573
1015 2842781008
1016 2852651241
1017 2852685313
1018 2857446366
1019 2874221110
1020 2891634634
1021 2894416234
1022 2895504020
1023 2895515368
1024 2895525115
1025 2895527852
1026 2919091320
1027 2919131430
1028 2919136341
1029 2919516349
1030 2919676812
1031 2923518113
1032 2928497952
1033 2929198148
1034 2931381245
1035 2937611932
1036 2939590600
1037 2939622768
1038 2939629663
1039 2941477817
1040 2941494223
1041 2961047875
1042 2961067213
1043 2974309352
1044 2977250073
1045 2984515437
1046 2987607338
1047 2995951203
1048 8002871993
1049 8003016052
1050 8021624754
1051 8021629968
1052 8021651359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

60

369

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8316 23 333
8elf-assembly1.cif.gz_A structure of get3d, a homolog of get3, from arabidopsis thaliana 0.827 52 89
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8103 23 333
5a5g-assembly1.cif.gz_A crystal structure of fthfs2 from t.acetoxydans re1 0.7503 52 93
5a5g-assembly1.cif.gz_B crystal structure of fthfs2 from t.acetoxydans re1 0.749 52 93
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.935 23 333 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9233 23 333 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.843 21 333 3.40.50.300
af_A0A0P0X1P5_1_135_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8211 86 211 3.40.50.300
af_A0A1D6KF80_27_384_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7953 27 322 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4V5ZQK2-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9878 1 333 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2A3LK26-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9829 7 336 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A356JHA0-F1-model_v4 deleted 0.9815 1 304
AF-B4SQP9-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.98 1 337 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A2P1PPD5-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9753 10 338 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245

Map