F459509

General Info

Members Datasets Scaffolds Average Seq Length
527 217 1054 309

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100112561|Ga0070667_1001125612
Length 362
Sequence MGVDDSGTRFPRDPSRPASIALPKLRSLCGSSMPTRIVSDSAGSVAAPSILSPCDPTASKASIVNPDPRTSTGDRQSLRDVRDLIVVLWWRFFDWLAVVSWKKLVAVSVLGMILAGILRHPLPALMLIIASFIIKVVAGGKRRAELTADVATKRAETEQLERTVVEARMEALQAQIEPHFLFNTLASIDQLIQTDPPRASKMQQSLIRYLRSAMPQMREGGRPTLGQQVNLCTAFLEIMAVRMEGRLRTEVNVPEGLKSAVFPSMMLQTLVENAIKHGLEPKTDGGQLEIGAEIVDGQLAVHVQDTGVGFMPTGEGGVGLANIRDRLKALYRDRAELIISIPATGGTCATIKVPYEIAPASA

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.04
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100112561 3300005367 Bacteria 2361
2 rootL2_10000283 3300003322 Bacteria 27202
3 Ga0070658_10039926 3300005327 Bacteria 3787
4 Ga0070676_10000533 3300005328 Bacteria 18336
5 Ga0070676_10018148 3300005328 Bacteria 3896
6 Ga0070683_100040429 3300005329 Bacteria 4288
7 Ga0070690_100131078 3300005330 Bacteria 1693
8 Ga0070670_100008999 3300005331 Bacteria 8531
9 Ga0070670_100036678 3300005331 Bacteria 4218
10 Ga0070670_100069784 3300005331 Bacteria 3017
11 Ga0070670_100178605 3300005331 Bacteria 1843
12 Ga0070670_100383723 3300005331 Bacteria 1238
13 Ga0070677_10000086 3300005333 Bacteria 29743
14 Ga0070677_10120037 3300005333 Bacteria 1186
15 Ga0068869_100000112 3300005334 Bacteria 38783
16 Ga0068869_100015957 3300005334 Bacteria 5055
17 Ga0068869_100081562 3300005334 Bacteria 2416
18 Ga0070666_10000649 3300005335 Bacteria 20972
19 Ga0070666_10003023 3300005335 Bacteria 10200
20 Ga0070680_100049136 3300005336 Bacteria 3438
21 Ga0070680_100074937 3300005336 Bacteria 2785
22 Ga0070682_100037688 3300005337 Bacteria 2962
23 Ga0068868_100010067 3300005338 Bacteria 6831
24 Ga0068868_100012235 3300005338 Bacteria 6270
25 Ga0068868_100012905 3300005338 Bacteria 6113
26 Ga0068868_100018428 3300005338 Bacteria 5221
27 Ga0068868_100082595 3300005338 Bacteria 2577
28 Ga0070660_100000527 3300005339 Bacteria 25512
29 Ga0070660_100063492 3300005339 Bacteria 2871
30 Ga0070660_100112915 3300005339 Bacteria 2163
31 Ga0070660_100368940 3300005339 Bacteria 1184
32 Ga0070689_100061782 3300005340 Bacteria 2914
33 Ga0070661_100002583 3300005344 Bacteria 12416
34 Ga0070661_100064227 3300005344 Bacteria 2698
35 Ga0070668_100000319 3300005347 Bacteria 31675
36 Ga0070668_100004498 3300005347 Bacteria 10342
37 Ga0070668_100010370 3300005347 Bacteria 6921
38 Ga0070668_100019841 3300005347 Bacteria 5065
39 Ga0070668_100060221 3300005347 Bacteria 2939
40 Ga0070668_100139020 3300005347 Bacteria 1956
41 Ga0070669_100001240 3300005353 Bacteria 18488
42 Ga0070669_100005048 3300005353 Bacteria 9539
43 Ga0070669_100015501 3300005353 Bacteria 5433
44 Ga0070669_100042068 3300005353 Bacteria 3324
45 Ga0070675_100000388 3300005354 Bacteria 29773
46 Ga0070675_100001757 3300005354 Bacteria 15981
47 Ga0070675_100004941 3300005354 Bacteria 10169
48 Ga0070675_100016308 3300005354 Bacteria 5894
49 Ga0070675_100346462 3300005354 Bacteria 1317
50 Ga0070671_100000747 3300005355 Bacteria 23296
51 Ga0070671_100002621 3300005355 Bacteria 13919
52 Ga0070671_100023420 3300005355 Bacteria 5054
53 Ga0070671_100027525 3300005355 Bacteria 4680
54 Ga0070671_100030723 3300005355 Bacteria 4433
55 Ga0070671_100136168 3300005355 Bacteria 2071
56 Ga0070674_100002365 3300005356 Bacteria 10411
57 Ga0070674_100016559 3300005356 Bacteria 4621
58 Ga0070674_100022613 3300005356 Bacteria 4058
59 Ga0070673_100000141 3300005364 Bacteria 34034
60 Ga0070673_100000680 3300005364 Bacteria 18748
61 Ga0070673_100008794 3300005364 Bacteria 6741
62 Ga0070673_100017109 3300005364 Bacteria 5145
63 Ga0070673_100397505 3300005364 Bacteria 1232
64 Ga0070688_100016174 3300005365 Bacteria 4260
65 Ga0070688_100026213 3300005365 Bacteria 3461
66 Ga0070659_100007953 3300005366 Bacteria 7726
67 Ga0070659_100013840 3300005366 Bacteria 6018
68 Ga0070659_100069328 3300005366 Bacteria 2799
69 Ga0070659_100142600 3300005366 Bacteria 1951
70 Ga0070659_100230797 3300005366 Bacteria 1530
71 Ga0070667_100002249 3300005367 Bacteria 16991
72 Ga0070667_100017068 3300005367 Bacteria 6012
73 Ga0070714_100009552 3300005435 Bacteria 7632
74 Ga0070714_100041496 3300005435 Bacteria 3883
75 Ga0070713_100007235 3300005436 Bacteria 7771
76 Ga0070713_100262236 3300005436 Bacteria 1579
77 Ga0070713_100383958 3300005436 Bacteria 1309
78 Ga0070710_10092451 3300005437 Bacteria 1787
79 Ga0070710_10114371 3300005437 Bacteria 1625
80 Ga0070711_100012727 3300005439 Bacteria 5265
81 Ga0070711_100066523 3300005439 Bacteria 2525
82 Ga0070700_100371284 3300005441 Bacteria 1067
83 Ga0070663_100004349 3300005455 Bacteria 8307
84 Ga0070663_100005106 3300005455 Bacteria 7765
85 Ga0070678_100000617 3300005456 Bacteria 17415
86 Ga0070678_100012343 3300005456 Bacteria 5306
87 Ga0070678_100012908 3300005456 Bacteria 5215
88 Ga0070678_100117558 3300005456 Bacteria 2091
89 Ga0070678_100429579 3300005456 Bacteria 1153
90 Ga0070662_100000525 3300005457 Bacteria 23090
91 Ga0070662_100010725 3300005457 Bacteria 6033
92 Ga0070662_100101892 3300005457 Bacteria 2174
93 Ga0070681_10005993 3300005458 Bacteria 11780
94 Ga0070681_10033384 3300005458 Bacteria 5167
95 Ga0068867_100000701 3300005459 Bacteria 22304
96 Ga0068867_100017256 3300005459 Bacteria 5127
97 Ga0068867_100041826 3300005459 Bacteria 3349
98 Ga0070685_10002403 3300005466 Bacteria 9634
99 Ga0070706_100041465 3300005467 Bacteria 4249
100 Ga0070706_100103165 3300005467 Bacteria 2652
101 Ga0070707_100377240 3300005468 Bacteria 1378
102 Ga0070698_100139691 3300005471 Bacteria 2375
103 Ga0070698_100238229 3300005471 Bacteria 1753
104 Ga0070699_100023841 3300005518 Bacteria 5273
105 Ga0070679_100048299 3300005530 Bacteria 4240
106 Ga0070679_100052494 3300005530 Bacteria 4060
107 Ga0070679_100132907 3300005530 Bacteria 2469
108 Ga0070684_100003167 3300005535 Bacteria 12301
109 Ga0070684_100022017 3300005535 Bacteria 5311
110 Ga0070697_100069099 3300005536 Bacteria 2893
111 Ga0070697_100267539 3300005536 Bacteria 1465
112 Ga0068853_100014464 3300005539 Bacteria 6463
113 Ga0068853_100026257 3300005539 Bacteria 4890
114 Ga0068853_100071709 3300005539 Bacteria 3017
115 Ga0068853_100326849 3300005539 Bacteria 1422
116 Ga0070672_100000118 3300005543 Bacteria 40531
117 Ga0070672_100001105 3300005543 Bacteria 16454
118 Ga0070672_100001835 3300005543 Bacteria 13243
119 Ga0070672_100105233 3300005543 Bacteria 2294
120 Ga0070672_100225787 3300005543 Bacteria 1572
121 Ga0070672_100275696 3300005543 Bacteria 1421
122 Ga0070686_100077612 3300005544 Bacteria 2191
123 Ga0070696_100275531 3300005546 Bacteria 1281
124 Ga0070693_100000754 3300005547 Bacteria 14323
125 Ga0070693_100026607 3300005547 Bacteria 3125
126 Ga0070693_100029191 3300005547 Bacteria 3006
127 Ga0070665_100001555 3300005548 Bacteria 26515
128 Ga0070665_100010811 3300005548 Bacteria 9230
129 Ga0070665_100126436 3300005548 Bacteria 2559
130 Ga0070665_100132561 3300005548 Bacteria 2494
131 Ga0070704_100072072 3300005549 Bacteria 2512
132 Ga0070704_100302783 3300005549 Bacteria 1333
133 Ga0068855_100010215 3300005563 Bacteria 11317
134 Ga0068855_100075219 3300005563 Bacteria 3922
135 Ga0068855_100088096 3300005563 Bacteria 3586
136 Ga0070664_100000628 3300005564 Bacteria 27043
137 Ga0070664_100000651 3300005564 Bacteria 26520
138 Ga0068854_100000872 3300005578 Bacteria 18087
139 Ga0068854_100068120 3300005578 Bacteria 2595
140 Ga0068854_100133275 3300005578 Bacteria 1899
141 Ga0068854_100410064 3300005578 Bacteria 1123
142 Ga0068856_100002359 3300005614 Bacteria 19426
143 Ga0068856_100068367 3300005614 Bacteria 3511
144 Ga0068856_100084859 3300005614 Bacteria 3146
145 Ga0068856_100318390 3300005614 Bacteria 1573
146 Ga0070702_100011889 3300005615 Bacteria 4341
147 Ga0068852_100001579 3300005616 Bacteria 15484
148 Ga0068852_100002210 3300005616 Bacteria 13355
149 Ga0068852_100007107 3300005616 Bacteria 8156
150 Ga0068852_100287882 3300005616 Bacteria 1586
151 Ga0068852_100355831 3300005616 Bacteria 1431
152 Ga0068859_100005028 3300005617 Bacteria 13417
153 Ga0068859_100005189 3300005617 Bacteria 13230
154 Ga0068859_100013668 3300005617 Bacteria 8137
155 Ga0068859_100377706 3300005617 Bacteria 1513
156 Ga0068864_100002301 3300005618 Bacteria 15798
157 Ga0068864_100003971 3300005618 Bacteria 12173
158 Ga0068864_100009116 3300005618 Bacteria 8180
159 Ga0068864_100098792 3300005618 Bacteria 2586
160 Ga0068864_100114228 3300005618 Bacteria 2408
161 Ga0068864_100119617 3300005618 Bacteria 2354
162 Ga0068866_10002311 3300005718 Bacteria 7896
163 Ga0068861_100010521 3300005719 Bacteria 6420
164 Ga0068861_100108979 3300005719 Bacteria 2216
165 Ga0068851_10003577 3300005834 Bacteria 6924
166 Ga0068851_10037382 3300005834 Bacteria 2433
167 Ga0068851_10051474 3300005834 Bacteria 2093
168 Ga0068870_10014860 3300005840 Bacteria 3685
169 Ga0068863_100000513 3300005841 Bacteria 39390
170 Ga0068863_100001821 3300005841 Bacteria 21167
171 Ga0068863_100008452 3300005841 Bacteria 10053
172 Ga0068863_100034575 3300005841 Bacteria 4813
173 Ga0068863_100088991 3300005841 Bacteria 2927
174 Ga0068863_100112628 3300005841 Bacteria 2591
175 Ga0068863_100232688 3300005841 Bacteria 1777
176 Ga0068858_100000924 3300005842 Bacteria 30445
177 Ga0068858_100005446 3300005842 Bacteria 12459
178 Ga0068858_100005937 3300005842 Bacteria 11925
179 Ga0068858_100007689 3300005842 Bacteria 10405
180 Ga0068858_100119212 3300005842 Bacteria 2467
181 Ga0068858_100148886 3300005842 Bacteria 2200
182 Ga0068860_100002724 3300005843 Bacteria 18384
183 Ga0068860_100048055 3300005843 Bacteria 4067
184 Ga0068860_100093389 3300005843 Bacteria 2867
185 Ga0068860_100131929 3300005843 Bacteria 2398
186 Ga0068860_100177076 3300005843 Bacteria 2061
187 Ga0068862_100004741 3300005844 Bacteria 11445
188 Ga0068862_100040394 3300005844 Bacteria 3965
189 Ga0068862_100041307 3300005844 Bacteria 3923
190 Ga0068862_100188135 3300005844 Bacteria 1856
191 Ga0081539_10008846 3300005985 Bacteria 8610
192 Ga0070712_100057210 3300006175 Bacteria 2738
193 Ga0097621_100003500 3300006237 Bacteria 10839
194 Ga0097621_100004591 3300006237 Bacteria 9640
195 Ga0097621_100017332 3300006237 Bacteria 5468
196 Ga0097621_100064261 3300006237 Bacteria 3018
197 Ga0097621_100097422 3300006237 Bacteria 2469
198 Ga0097621_100457149 3300006237 Bacteria 1151
199 Ga0068871_100001125 3300006358 Bacteria 17953
200 Ga0068871_100024674 3300006358 Bacteria 4665
201 Ga0068871_100028284 3300006358 Bacteria 4394
202 Ga0068871_100032040 3300006358 Bacteria 4148
203 Ga0075428_100085067 3300006844 Bacteria 3450
204 Ga0075428_100344754 3300006844 Bacteria 1599
205 Ga0075433_10019144 3300006852 Bacteria 5696
206 Ga0075434_100118086 3300006871 Bacteria 2666
207 Ga0068865_100071368 3300006881 Bacteria 2463
208 Ga0068865_100158740 3300006881 Bacteria 1723
209 Ga0068865_100268154 3300006881 Bacteria 1354
210 Ga0097620_100005028 3300006931 Bacteria 13417
211 Ga0097620_100005190 3300006931 Bacteria 13230
212 Ga0097620_100013668 3300006931 Bacteria 8137
213 Ga0097620_100044039 3300006931 Bacteria 4485
214 Ga0097620_100377716 3300006931 Bacteria 1513
215 Ga0075435_100053319 3300007076 Bacteria 3261
216 Ga0075435_100115192 3300007076 Bacteria 2238
217 Ga0075435_100200519 3300007076 Bacteria 1691
218 Ga0075435_100241336 3300007076 Bacteria 1537
219 Ga0105240_10003088 3300009093 Bacteria 26186
220 Ga0105240_10047944 3300009093 Bacteria 5403
221 Ga0105245_10088030 3300009098 Bacteria 2851
222 Ga0105245_10134432 3300009098 Bacteria 2323
223 Ga0105247_10045404 3300009101 Bacteria 2695
224 Ga0114129_10152293 3300009147 Bacteria 3164
225 Ga0105241_10007582 3300009174 Bacteria 7978
226 Ga0105241_10073031 3300009174 Bacteria 2668
227 Ga0105241_10163745 3300009174 Bacteria 1831
228 Ga0105242_10288841 3300009176 Bacteria 1492
229 Ga0105248_10111972 3300009177 Bacteria 3079
230 Ga0105248_10143808 3300009177 Bacteria 2691
231 Ga0105248_10198329 3300009177 Bacteria 2261
232 Ga0105248_10217949 3300009177 Bacteria 2149
233 Ga0105237_10010094 3300009545 Bacteria 10071
234 Ga0105237_10118893 3300009545 Bacteria 2636
235 Ga0105237_10269291 3300009545 Bacteria 1706
236 Ga0105238_10020257 3300009551 Bacteria 6770
237 Ga0105238_10060369 3300009551 Bacteria 3796
238 Ga0105238_10268797 3300009551 Bacteria 1685
239 Ga0105249_10149617 3300009553 Bacteria 2246
240 Ga0105239_10015405 3300010375 Bacteria 8471
241 Ga0105239_10118961 3300010375 Bacteria 2932
242 Ga0105246_10033633 3300011119 Bacteria 3410
243 Ga0157373_10000491 3300013100 Bacteria 31272
244 Ga0157373_10001552 3300013100 Bacteria 17506
245 Ga0157373_10357390 3300013100 Bacteria 1042
246 Ga0157371_10012527 3300013102 Bacteria 6478
247 Ga0157370_10015403 3300013104 Bacteria 7773
248 Ga0157370_10040216 3300013104 Bacteria 4515
249 Ga0157370_10122944 3300013104 Bacteria 2423
250 Ga0157369_10092641 3300013105 Bacteria 3225
251 Ga0157369_10133782 3300013105 Bacteria 2626
252 Ga0157374_10000367 3300013296 Bacteria 41665
253 Ga0157374_10002439 3300013296 Bacteria 15685
254 Ga0157374_10011589 3300013296 Bacteria 7643
255 Ga0157374_10016852 3300013296 Bacteria 6428
256 Ga0157374_10086171 3300013296 Bacteria 2988
257 Ga0157378_10005945 3300013297 Bacteria 10695
258 Ga0157378_10011555 3300013297 Bacteria 7732
259 Ga0157378_10084086 3300013297 Bacteria 2881
260 Ga0163162_10112396 3300013306 Bacteria 2822
261 Ga0163162_10205477 3300013306 Bacteria 2099
262 Ga0163162_10226635 3300013306 Bacteria 1999
263 Ga0163162_10371595 3300013306 Bacteria 1563
264 Ga0157372_10008701 3300013307 Bacteria 10779
265 Ga0157372_10009674 3300013307 Bacteria 10248
266 Ga0157372_10020925 3300013307 Bacteria 7062
267 Ga0157372_10588210 3300013307 Bacteria 1297
268 Ga0157375_10002167 3300013308 Bacteria 16978
269 Ga0157375_10002391 3300013308 Bacteria 16241
270 Ga0157375_10002818 3300013308 Bacteria 15049
271 Ga0157375_10033124 3300013308 Bacteria 4907
272 Ga0157375_10070739 3300013308 Bacteria 3500
273 Ga0157375_10205738 3300013308 Bacteria 2124
274 Ga0163163_10002255 3300014325 Bacteria 16251
275 Ga0163163_10005262 3300014325 Bacteria 11161
276 Ga0163163_10153861 3300014325 Bacteria 2343
277 Ga0157380_10179158 3300014326 Bacteria 1860
278 Ga0157379_10000105 3300014968 Bacteria 57976
279 Ga0157379_10003805 3300014968 Bacteria 12859
280 Ga0157379_10015914 3300014968 Bacteria 6612
281 Ga0157376_10059176 3300014969 Bacteria 3212
282 Ga0157376_10116062 3300014969 Bacteria 2364
283 Ga0157376_10227444 3300014969 Bacteria 1731
284 Ga0163161_10018465 3300017792 Bacteria 4887
285 Ga0163161_10027245 3300017792 Bacteria 4053
286 Ga0163161_10243563 3300017792 Bacteria 1399
287 Ga0206354_10886907 3300020081 Bacteria 2162
288 Ga0213872_10007354 3300021361 Bacteria 5430
289 Ga0207697_10036595 3300025315 Bacteria 2010
290 Ga0207656_10017019 3300025321 Bacteria 2841
291 Ga0207656_10031275 3300025321 Bacteria 2204
292 Ga0207682_10000817 3300025893 Bacteria 14404
293 Ga0207692_10012709 3300025898 Bacteria 3624
294 Ga0207688_10145437 3300025901 Bacteria 1397
295 Ga0207680_10131561 3300025903 Bacteria 1650
296 Ga0207685_10073630 3300025905 Bacteria 1392
297 Ga0207645_10003482 3300025907 Bacteria 11922
298 Ga0207645_10010696 3300025907 Bacteria 6292
299 Ga0207645_10024425 3300025907 Bacteria 3919
300 Ga0207643_10008611 3300025908 Bacteria 5470
301 Ga0207643_10166710 3300025908 Bacteria 1327
302 Ga0207705_10021804 3300025909 Bacteria 4570
303 Ga0207705_10123476 3300025909 Bacteria 1923
304 Ga0207684_10134518 3300025910 Bacteria 2122
305 Ga0207654_10035017 3300025911 Bacteria 2794
306 Ga0207707_10009857 3300025912 Bacteria 8280
307 Ga0207695_10016581 3300025913 Bacteria 8613
308 Ga0207695_10066116 3300025913 Bacteria 3715
309 Ga0207663_10086996 3300025916 Bacteria 2062
310 Ga0207660_10063106 3300025917 Bacteria 2670
311 Ga0207662_10043458 3300025918 Bacteria 2650
312 Ga0207657_10002392 3300025919 Bacteria 20288
313 Ga0207657_10003769 3300025919 Bacteria 16109
314 Ga0207657_10015488 3300025919 Bacteria 7386
315 Ga0207657_10091516 3300025919 Bacteria 2536
316 Ga0207657_10277614 3300025919 Bacteria 1331
317 Ga0207649_10010975 3300025920 Bacteria 4983
318 Ga0207649_10011419 3300025920 Bacteria 4898
319 Ga0207649_10034824 3300025920 Bacteria 3020
320 Ga0207652_10099395 3300025921 Bacteria 2567
321 Ga0207652_10111584 3300025921 Bacteria 2425
322 Ga0207646_10051195 3300025922 Bacteria 3695
323 Ga0207681_10001450 3300025923 Bacteria 15264
324 Ga0207681_10006599 3300025923 Bacteria 7127
325 Ga0207681_10036742 3300025923 Bacteria 3233
326 Ga0207681_10086704 3300025923 Bacteria 2225
327 Ga0207681_10095138 3300025923 Bacteria 2136
328 Ga0207694_10014158 3300025924 Bacteria 6014
329 Ga0207650_10023909 3300025925 Bacteria 4338
330 Ga0207650_10177021 3300025925 Bacteria 1698
331 Ga0207650_10262530 3300025925 Bacteria 1401
332 Ga0207650_10399913 3300025925 Bacteria 1137
333 Ga0207659_10002562 3300025926 Bacteria 10815
334 Ga0207659_10041203 3300025926 Bacteria 3234
335 Ga0207659_10107797 3300025926 Bacteria 2112
336 Ga0207687_10344933 3300025927 Bacteria 1212
337 Ga0207700_10010733 3300025928 Bacteria 5801
338 Ga0207664_10000571 3300025929 Bacteria 25842
339 Ga0207664_10040430 3300025929 Bacteria 3626
340 Ga0207664_10097621 3300025929 Bacteria 2421
341 Ga0207644_10018570 3300025931 Bacteria 4707
342 Ga0207644_10022032 3300025931 Bacteria 4347
343 Ga0207644_10027270 3300025931 Bacteria 3945
344 Ga0207644_10124501 3300025931 Bacteria 1966
345 Ga0207690_10015068 3300025932 Bacteria 4679
346 Ga0207690_10048301 3300025932 Bacteria 2829
347 Ga0207690_10103947 3300025932 Bacteria 2034
348 Ga0207706_10000847 3300025933 Bacteria 31461
349 Ga0207706_10009529 3300025933 Bacteria 8917
350 Ga0207686_10028272 3300025934 Bacteria 3294
351 Ga0207669_10001390 3300025937 Bacteria 10294
352 Ga0207669_10021013 3300025937 Bacteria 3436
353 Ga0207704_10052413 3300025938 Bacteria 2473
354 Ga0207704_10054018 3300025938 Bacteria 2446
355 Ga0207665_10081788 3300025939 Bacteria 2225
356 Ga0207691_10000384 3300025940 Bacteria 44354
357 Ga0207691_10002018 3300025940 Bacteria 19886
358 Ga0207691_10002155 3300025940 Bacteria 19256
359 Ga0207691_10129171 3300025940 Bacteria 2233
360 Ga0207691_10187814 3300025940 Bacteria 1803
361 Ga0207691_10198986 3300025940 Bacteria 1744
362 Ga0207691_10329086 3300025940 Bacteria 1309
363 Ga0207711_10001714 3300025941 Bacteria 20150
364 Ga0207711_10092694 3300025941 Bacteria 2659
365 Ga0207711_10114741 3300025941 Bacteria 2399
366 Ga0207689_10000147 3300025942 Bacteria 60540
367 Ga0207689_10015321 3300025942 Bacteria 6489
368 Ga0207689_10025691 3300025942 Bacteria 4934
369 Ga0207689_10046172 3300025942 Bacteria 3601
370 Ga0207689_10166746 3300025942 Bacteria 1815
371 Ga0207661_10012848 3300025944 Bacteria 6102
372 Ga0207661_10012971 3300025944 Bacteria 6081
373 Ga0207679_10016468 3300025945 Bacteria 4911
374 Ga0207679_10029760 3300025945 Bacteria 3805
375 Ga0207679_10052494 3300025945 Bacteria 2990
376 Ga0207679_10053241 3300025945 Bacteria 2973
377 Ga0207679_10317293 3300025945 Bacteria 1348
378 Ga0207667_10004877 3300025949 Bacteria 16384
379 Ga0207667_10194894 3300025949 Bacteria 2079
380 Ga0207667_10209598 3300025949 Bacteria 1997
381 Ga0207667_10210850 3300025949 Bacteria 1991
382 Ga0207651_10005772 3300025960 Bacteria 6392
383 Ga0207651_10376461 3300025960 Bacteria 1202
384 Ga0207712_10165938 3300025961 Bacteria 1721
385 Ga0207712_10178696 3300025961 Bacteria 1665
386 Ga0207712_10488415 3300025961 Bacteria 1051
387 Ga0207668_10006070 3300025972 Bacteria 7122
388 Ga0207668_10019722 3300025972 Bacteria 4269
389 Ga0207668_10034738 3300025972 Bacteria 3350
390 Ga0207668_10037262 3300025972 Bacteria 3253
391 Ga0207668_10064566 3300025972 Bacteria 2587
392 Ga0207668_10069866 3300025972 Bacteria 2502
393 Ga0207668_10086076 3300025972 Bacteria 2295
394 Ga0207640_10030716 3300025981 Bacteria 3311
395 Ga0207640_10104426 3300025981 Bacteria 1994
396 Ga0207640_10130872 3300025981 Bacteria 1814
397 Ga0207658_10001437 3300025986 Bacteria 18570
398 Ga0207658_10005873 3300025986 Bacteria 8393
399 Ga0207658_10010364 3300025986 Bacteria 6331
400 Ga0207658_10106433 3300025986 Bacteria 2208
401 Ga0207677_10000387 3300026023 Bacteria 30319
402 Ga0207677_10008889 3300026023 Bacteria 5632
403 Ga0207677_10082442 3300026023 Bacteria 2311
404 Ga0207677_10214618 3300026023 Bacteria 1539
405 Ga0207677_10407271 3300026023 Bacteria 1155
406 Ga0207703_10005893 3300026035 Bacteria 9823
407 Ga0207703_10017003 3300026035 Bacteria 5672
408 Ga0207703_10027845 3300026035 Bacteria 4451
409 Ga0207703_10078368 3300026035 Bacteria 2745
410 Ga0207639_10116921 3300026041 Bacteria 2184
411 Ga0207678_10002049 3300026067 Bacteria 18283
412 Ga0207678_10004036 3300026067 Bacteria 13206
413 Ga0207678_10009018 3300026067 Bacteria 8780
414 Ga0207702_10005967 3300026078 Bacteria 10580
415 Ga0207702_10006709 3300026078 Bacteria 9891
416 Ga0207702_10110472 3300026078 Bacteria 2443
417 Ga0207702_10217330 3300026078 Bacteria 1780
418 Ga0207641_10001895 3300026088 Bacteria 20073
419 Ga0207641_10020302 3300026088 Bacteria 5457
420 Ga0207641_10035599 3300026088 Bacteria 4149
421 Ga0207641_10054235 3300026088 Bacteria 3401
422 Ga0207641_10073112 3300026088 Bacteria 2954
423 Ga0207641_10097444 3300026088 Bacteria 2585
424 Ga0207641_10284827 3300026088 Bacteria 1556
425 Ga0207641_10312648 3300026088 Bacteria 1487
426 Ga0207648_10000689 3300026089 Bacteria 37824
427 Ga0207648_10001063 3300026089 Bacteria 30753
428 Ga0207648_10003724 3300026089 Bacteria 15958
429 Ga0207648_10097821 3300026089 Bacteria 2569
430 Ga0207676_10002124 3300026095 Bacteria 14347
431 Ga0207676_10002162 3300026095 Bacteria 14186
432 Ga0207676_10007815 3300026095 Bacteria 7607
433 Ga0207676_10014275 3300026095 Bacteria 5711
434 Ga0207676_10081298 3300026095 Bacteria 2632
435 Ga0207676_10081493 3300026095 Bacteria 2629
436 Ga0207676_10091044 3300026095 Bacteria 2505
437 Ga0207674_10003913 3300026116 Bacteria 18122
438 Ga0207674_10009830 3300026116 Bacteria 10893
439 Ga0207675_100001839 3300026118 Bacteria 21299
440 Ga0207675_100576868 3300026118 Bacteria 1126
441 Ga0207683_10000306 3300026121 Bacteria 44304
442 Ga0207683_10000346 3300026121 Bacteria 42218
443 Ga0207683_10137489 3300026121 Bacteria 2200
444 Ga0207683_10307265 3300026121 Bacteria 1451
445 Ga0207698_10011134 3300026142 Bacteria 5816
446 Ga0207698_10025708 3300026142 Bacteria 4152
447 Ga0207698_10035243 3300026142 Bacteria 3658
448 Ga0207698_10047728 3300026142 Bacteria 3246
449 Ga0207698_10088870 3300026142 Bacteria 2521
450 Ga0209974_10032154 3300027876 Bacteria 1738
451 Ga0268266_10012888 3300028379 Bacteria 7217
452 Ga0268266_10014464 3300028379 Bacteria 6784
453 Ga0268266_10030657 3300028379 Bacteria 4568
454 Ga0268266_10089110 3300028379 Bacteria 2701
455 Ga0268265_10004349 3300028380 Bacteria 9847
456 Ga0268265_10030690 3300028380 Bacteria 3874
457 Ga0268264_10003678 3300028381 Bacteria 13160
458 Ga0268264_10007952 3300028381 Bacteria 8823
459 Ga0268264_10011710 3300028381 Bacteria 7233
460 Ga0268264_10036848 3300028381 Bacteria 4030
461 Ga0307408_100379822 3300031548 Bacteria 1207
462 Ga0307405_10012596 3300031731 Bacteria 4485
463 Ga0307413_10002936 3300031824 Bacteria 7047
464 Ga0307410_10005196 3300031852 Bacteria 6859
465 Ga0307407_10012112 3300031903 Bacteria 4134
466 Ga0307412_10012204 3300031911 Bacteria 4997
467 Ga0307409_100008907 3300031995 Bacteria 6128
468 Ga0307414_10035327 3300032004 Bacteria 3325
469 Ga0307411_10020677 3300032005 Bacteria 3834
470 Ga0307415_100006342 3300032126 Bacteria 6369
471 Ga0373923_0057141 3300035111 Bacteria 1649
472 Ga0373945_0054704 3300035116 Bacteria 1476
473 Ga0373954_0008265 3300035118 Bacteria 4564
474 Ga0373957_0039591 3300035120 Bacteria 1768
475 Ga0373946_0021924 3300035171 Bacteria 2482
476 Ga0373946_0023101 3300035171 Bacteria 2427
477 Ga0373955_0021975 3300035172 Bacteria 3228
478 Ga0373935_0022085 3300035692 Bacteria 3898
479 Ga0373927_0008354 3300035695 Bacteria 6969
480 Ga0373927_0017070 3300035695 Bacteria 4782
481 Ga0373927_0019653 3300035695 Bacteria 4429
482 Ga0373933_0008700 3300035724 Bacteria 5535
483 Ga0373947_0028261 3300035725 Bacteria 3286
484 Ga0373937_0066632 3300036401 Bacteria 3316
485 Ga0373925_0000590 3300037068 Bacteria 34985
486 Ga0373925_0268643 3300037068 Bacteria 1371
487 Ga0395900_0144360 3300037418 Bacteria 2435
488 Ga0436361_0307946 3300039447 Bacteria 5938
489 Ga0436361_0754638 3300039447 Bacteria 3044
490 Ga0436361_0856436 3300039447 Bacteria 79246
491 Ga0436361_1183287 3300039447 Bacteria 3069
492 Ga0466958_0054942 3300045836 Bacteria 2416
493 Ga0495629_0068714 3300046459 Bacteria 2472
494 Ga0495580_0004800 3300046472 Bacteria 11320
495 Ga0495580_0052974 3300046472 Bacteria 2865
496 Ga0495582_0003342 3300046473 Bacteria 9019
497 Ga0495594_0146957 3300046499 Bacteria 1338
498 Ga0495587_0104625 3300046536 Bacteria 1629
499 Ga0495647_0004222 3300046681 Bacteria 4652
500 Ga0495680_0041826 3300047322 Bacteria 3640
501 Ga0495684_0002449 3300047471 Bacteria 14818
502 Ga0496100_0133913 3300048903 Bacteria 1749
503 Ga0496102_0023360 3300048905 Bacteria 5491
504 Ga0496103_0087858 3300048906 Bacteria 1960
505 Ga0496104_0001874 3300048907 Bacteria 18207
506 Ga0496106_0010350 3300048909 Bacteria 6892
507 Ga0496107_0016181 3300048910 Bacteria 5234
508 Ga0496108_0036218 3300048911 Bacteria 4105
509 Ga0496109_0191539 3300048912 Bacteria 1922
510 Ga0496110_0152753 3300048913 Bacteria 2091
511 Ga0496112_0006765 3300048915 Bacteria 10101
512 Ga0496112_0006881 3300048915 Bacteria 10027
513 Ga0496112_0117740 3300048915 Bacteria 2627
514 Ga0496113_0005959 3300048916 Bacteria 7666
515 Ga0496113_0290951 3300048916 Bacteria 1307
516 Ga0496114_0121891 3300048917 Bacteria 2243
517 Ga0496115_0021603 3300048918 Bacteria 4974
518 nmdc:mga05p37_134643_c1 3300050507 Bacteria 3031
519 nmdc:mga0n895_169752_c1 3300050512 Bacteria 2213
520 nmdc:mga0n895_27844_c1 3300050512 Bacteria 5371
521 nmdc:mga0n895_581678_c1 3300050512 Bacteria 1123
522 nmdc:mga0rr50_148311_c1 3300050513 Bacteria 1893
523 nmdc:mga0rr50_151836_c1 3300050513 Bacteria 1872
524 nmdc:mga0a205_39514_c1 3300050515 Bacteria 4541
525 Ga0495601_0141748 3300053077 Bacteria 1568
526 Ga0495619_0003805 3300053085 Bacteria 9709
527 Ga0495619_0258981 3300053085 Bacteria 1206
528 Ga0070667_100112561
529 rootL2_10000283
530 Ga0070658_10039926
531 Ga0070676_10000533
532 Ga0070676_10018148
533 Ga0070683_100040429
534 Ga0070690_100131078
535 Ga0070670_100008999
536 Ga0070670_100036678
537 Ga0070670_100069784
538 Ga0070670_100178605
539 Ga0070670_100383723
540 Ga0070677_10000086
541 Ga0070677_10120037
542 Ga0068869_100000112
543 Ga0068869_100015957
544 Ga0068869_100081562
545 Ga0070666_10000649
546 Ga0070666_10003023
547 Ga0070680_100049136
548 Ga0070680_100074937
549 Ga0070682_100037688
550 Ga0068868_100010067
551 Ga0068868_100012235
552 Ga0068868_100012905
553 Ga0068868_100018428
554 Ga0068868_100082595
555 Ga0070660_100000527
556 Ga0070660_100063492
557 Ga0070660_100112915
558 Ga0070660_100368940
559 Ga0070689_100061782
560 Ga0070661_100002583
561 Ga0070661_100064227
562 Ga0070668_100000319
563 Ga0070668_100004498
564 Ga0070668_100010370
565 Ga0070668_100019841
566 Ga0070668_100060221
567 Ga0070668_100139020
568 Ga0070669_100001240
569 Ga0070669_100005048
570 Ga0070669_100015501
571 Ga0070669_100042068
572 Ga0070675_100000388
573 Ga0070675_100001757
574 Ga0070675_100004941
575 Ga0070675_100016308
576 Ga0070675_100346462
577 Ga0070671_100000747
578 Ga0070671_100002621
579 Ga0070671_100023420
580 Ga0070671_100027525
581 Ga0070671_100030723
582 Ga0070671_100136168
583 Ga0070674_100002365
584 Ga0070674_100016559
585 Ga0070674_100022613
586 Ga0070673_100000141
587 Ga0070673_100000680
588 Ga0070673_100008794
589 Ga0070673_100017109
590 Ga0070673_100397505
591 Ga0070688_100016174
592 Ga0070688_100026213
593 Ga0070659_100007953
594 Ga0070659_100013840
595 Ga0070659_100069328
596 Ga0070659_100142600
597 Ga0070659_100230797
598 Ga0070667_100002249
599 Ga0070667_100017068
600 Ga0070714_100009552
601 Ga0070714_100041496
602 Ga0070713_100007235
603 Ga0070713_100262236
604 Ga0070713_100383958
605 Ga0070710_10092451
606 Ga0070710_10114371
607 Ga0070711_100012727
608 Ga0070711_100066523
609 Ga0070700_100371284
610 Ga0070663_100004349
611 Ga0070663_100005106
612 Ga0070678_100000617
613 Ga0070678_100012343
614 Ga0070678_100012908
615 Ga0070678_100117558
616 Ga0070678_100429579
617 Ga0070662_100000525
618 Ga0070662_100010725
619 Ga0070662_100101892
620 Ga0070681_10005993
621 Ga0070681_10033384
622 Ga0068867_100000701
623 Ga0068867_100017256
624 Ga0068867_100041826
625 Ga0070685_10002403
626 Ga0070706_100041465
627 Ga0070706_100103165
628 Ga0070707_100377240
629 Ga0070698_100139691
630 Ga0070698_100238229
631 Ga0070699_100023841
632 Ga0070679_100048299
633 Ga0070679_100052494
634 Ga0070679_100132907
635 Ga0070684_100003167
636 Ga0070684_100022017
637 Ga0070697_100069099
638 Ga0070697_100267539
639 Ga0068853_100014464
640 Ga0068853_100026257
641 Ga0068853_100071709
642 Ga0068853_100326849
643 Ga0070672_100000118
644 Ga0070672_100001105
645 Ga0070672_100001835
646 Ga0070672_100105233
647 Ga0070672_100225787
648 Ga0070672_100275696
649 Ga0070686_100077612
650 Ga0070696_100275531
651 Ga0070693_100000754
652 Ga0070693_100026607
653 Ga0070693_100029191
654 Ga0070665_100001555
655 Ga0070665_100010811
656 Ga0070665_100126436
657 Ga0070665_100132561
658 Ga0070704_100072072
659 Ga0070704_100302783
660 Ga0068855_100010215
661 Ga0068855_100075219
662 Ga0068855_100088096
663 Ga0070664_100000628
664 Ga0070664_100000651
665 Ga0068854_100000872
666 Ga0068854_100068120
667 Ga0068854_100133275
668 Ga0068854_100410064
669 Ga0068856_100002359
670 Ga0068856_100068367
671 Ga0068856_100084859
672 Ga0068856_100318390
673 Ga0070702_100011889
674 Ga0068852_100001579
675 Ga0068852_100002210
676 Ga0068852_100007107
677 Ga0068852_100287882
678 Ga0068852_100355831
679 Ga0068859_100005028
680 Ga0068859_100005189
681 Ga0068859_100013668
682 Ga0068859_100377706
683 Ga0068864_100002301
684 Ga0068864_100003971
685 Ga0068864_100009116
686 Ga0068864_100098792
687 Ga0068864_100114228
688 Ga0068864_100119617
689 Ga0068866_10002311
690 Ga0068861_100010521
691 Ga0068861_100108979
692 Ga0068851_10003577
693 Ga0068851_10037382
694 Ga0068851_10051474
695 Ga0068870_10014860
696 Ga0068863_100000513
697 Ga0068863_100001821
698 Ga0068863_100008452
699 Ga0068863_100034575
700 Ga0068863_100088991
701 Ga0068863_100112628
702 Ga0068863_100232688
703 Ga0068858_100000924
704 Ga0068858_100005446
705 Ga0068858_100005937
706 Ga0068858_100007689
707 Ga0068858_100119212
708 Ga0068858_100148886
709 Ga0068860_100002724
710 Ga0068860_100048055
711 Ga0068860_100093389
712 Ga0068860_100131929
713 Ga0068860_100177076
714 Ga0068862_100004741
715 Ga0068862_100040394
716 Ga0068862_100041307
717 Ga0068862_100188135
718 Ga0081539_10008846
719 Ga0070712_100057210
720 Ga0097621_100003500
721 Ga0097621_100004591
722 Ga0097621_100017332
723 Ga0097621_100064261
724 Ga0097621_100097422
725 Ga0097621_100457149
726 Ga0068871_100001125
727 Ga0068871_100024674
728 Ga0068871_100028284
729 Ga0068871_100032040
730 Ga0075428_100085067
731 Ga0075428_100344754
732 Ga0075433_10019144
733 Ga0075434_100118086
734 Ga0068865_100071368
735 Ga0068865_100158740
736 Ga0068865_100268154
737 Ga0097620_100005028
738 Ga0097620_100005190
739 Ga0097620_100013668
740 Ga0097620_100044039
741 Ga0097620_100377716
742 Ga0075435_100053319
743 Ga0075435_100115192
744 Ga0075435_100200519
745 Ga0075435_100241336
746 Ga0105240_10003088
747 Ga0105240_10047944
748 Ga0105245_10088030
749 Ga0105245_10134432
750 Ga0105247_10045404
751 Ga0114129_10152293
752 Ga0105241_10007582
753 Ga0105241_10073031
754 Ga0105241_10163745
755 Ga0105242_10288841
756 Ga0105248_10111972
757 Ga0105248_10143808
758 Ga0105248_10198329
759 Ga0105248_10217949
760 Ga0105237_10010094
761 Ga0105237_10118893
762 Ga0105237_10269291
763 Ga0105238_10020257
764 Ga0105238_10060369
765 Ga0105238_10268797
766 Ga0105249_10149617
767 Ga0105239_10015405
768 Ga0105239_10118961
769 Ga0105246_10033633
770 Ga0157373_10000491
771 Ga0157373_10001552
772 Ga0157373_10357390
773 Ga0157371_10012527
774 Ga0157370_10015403
775 Ga0157370_10040216
776 Ga0157370_10122944
777 Ga0157369_10092641
778 Ga0157369_10133782
779 Ga0157374_10000367
780 Ga0157374_10002439
781 Ga0157374_10011589
782 Ga0157374_10016852
783 Ga0157374_10086171
784 Ga0157378_10005945
785 Ga0157378_10011555
786 Ga0157378_10084086
787 Ga0163162_10112396
788 Ga0163162_10205477
789 Ga0163162_10226635
790 Ga0163162_10371595
791 Ga0157372_10008701
792 Ga0157372_10009674
793 Ga0157372_10020925
794 Ga0157372_10588210
795 Ga0157375_10002167
796 Ga0157375_10002391
797 Ga0157375_10002818
798 Ga0157375_10033124
799 Ga0157375_10070739
800 Ga0157375_10205738
801 Ga0163163_10002255
802 Ga0163163_10005262
803 Ga0163163_10153861
804 Ga0157380_10179158
805 Ga0157379_10000105
806 Ga0157379_10003805
807 Ga0157379_10015914
808 Ga0157376_10059176
809 Ga0157376_10116062
810 Ga0157376_10227444
811 Ga0163161_10018465
812 Ga0163161_10027245
813 Ga0163161_10243563
814 Ga0206354_10886907
815 Ga0213872_10007354
816 Ga0207697_10036595
817 Ga0207656_10017019
818 Ga0207656_10031275
819 Ga0207682_10000817
820 Ga0207692_10012709
821 Ga0207688_10145437
822 Ga0207680_10131561
823 Ga0207685_10073630
824 Ga0207645_10003482
825 Ga0207645_10010696
826 Ga0207645_10024425
827 Ga0207643_10008611
828 Ga0207643_10166710
829 Ga0207705_10021804
830 Ga0207705_10123476
831 Ga0207684_10134518
832 Ga0207654_10035017
833 Ga0207707_10009857
834 Ga0207695_10016581
835 Ga0207695_10066116
836 Ga0207663_10086996
837 Ga0207660_10063106
838 Ga0207662_10043458
839 Ga0207657_10002392
840 Ga0207657_10003769
841 Ga0207657_10015488
842 Ga0207657_10091516
843 Ga0207657_10277614
844 Ga0207649_10010975
845 Ga0207649_10011419
846 Ga0207649_10034824
847 Ga0207652_10099395
848 Ga0207652_10111584
849 Ga0207646_10051195
850 Ga0207681_10001450
851 Ga0207681_10006599
852 Ga0207681_10036742
853 Ga0207681_10086704
854 Ga0207681_10095138
855 Ga0207694_10014158
856 Ga0207650_10023909
857 Ga0207650_10177021
858 Ga0207650_10262530
859 Ga0207650_10399913
860 Ga0207659_10002562
861 Ga0207659_10041203
862 Ga0207659_10107797
863 Ga0207687_10344933
864 Ga0207700_10010733
865 Ga0207664_10000571
866 Ga0207664_10040430
867 Ga0207664_10097621
868 Ga0207644_10018570
869 Ga0207644_10022032
870 Ga0207644_10027270
871 Ga0207644_10124501
872 Ga0207690_10015068
873 Ga0207690_10048301
874 Ga0207690_10103947
875 Ga0207706_10000847
876 Ga0207706_10009529
877 Ga0207686_10028272
878 Ga0207669_10001390
879 Ga0207669_10021013
880 Ga0207704_10052413
881 Ga0207704_10054018
882 Ga0207665_10081788
883 Ga0207691_10000384
884 Ga0207691_10002018
885 Ga0207691_10002155
886 Ga0207691_10129171
887 Ga0207691_10187814
888 Ga0207691_10198986
889 Ga0207691_10329086
890 Ga0207711_10001714
891 Ga0207711_10092694
892 Ga0207711_10114741
893 Ga0207689_10000147
894 Ga0207689_10015321
895 Ga0207689_10025691
896 Ga0207689_10046172
897 Ga0207689_10166746
898 Ga0207661_10012848
899 Ga0207661_10012971
900 Ga0207679_10016468
901 Ga0207679_10029760
902 Ga0207679_10052494
903 Ga0207679_10053241
904 Ga0207679_10317293
905 Ga0207667_10004877
906 Ga0207667_10194894
907 Ga0207667_10209598
908 Ga0207667_10210850
909 Ga0207651_10005772
910 Ga0207651_10376461
911 Ga0207712_10165938
912 Ga0207712_10178696
913 Ga0207712_10488415
914 Ga0207668_10006070
915 Ga0207668_10019722
916 Ga0207668_10034738
917 Ga0207668_10037262
918 Ga0207668_10064566
919 Ga0207668_10069866
920 Ga0207668_10086076
921 Ga0207640_10030716
922 Ga0207640_10104426
923 Ga0207640_10130872
924 Ga0207658_10001437
925 Ga0207658_10005873
926 Ga0207658_10010364
927 Ga0207658_10106433
928 Ga0207677_10000387
929 Ga0207677_10008889
930 Ga0207677_10082442
931 Ga0207677_10214618
932 Ga0207677_10407271
933 Ga0207703_10005893
934 Ga0207703_10017003
935 Ga0207703_10027845
936 Ga0207703_10078368
937 Ga0207639_10116921
938 Ga0207678_10002049
939 Ga0207678_10004036
940 Ga0207678_10009018
941 Ga0207702_10005967
942 Ga0207702_10006709
943 Ga0207702_10110472
944 Ga0207702_10217330
945 Ga0207641_10001895
946 Ga0207641_10020302
947 Ga0207641_10035599
948 Ga0207641_10054235
949 Ga0207641_10073112
950 Ga0207641_10097444
951 Ga0207641_10284827
952 Ga0207641_10312648
953 Ga0207648_10000689
954 Ga0207648_10001063
955 Ga0207648_10003724
956 Ga0207648_10097821
957 Ga0207676_10002124
958 Ga0207676_10002162
959 Ga0207676_10007815
960 Ga0207676_10014275
961 Ga0207676_10081298
962 Ga0207676_10081493
963 Ga0207676_10091044
964 Ga0207674_10003913
965 Ga0207674_10009830
966 Ga0207675_100001839
967 Ga0207675_100576868
968 Ga0207683_10000306
969 Ga0207683_10000346
970 Ga0207683_10137489
971 Ga0207683_10307265
972 Ga0207698_10011134
973 Ga0207698_10025708
974 Ga0207698_10035243
975 Ga0207698_10047728
976 Ga0207698_10088870
977 Ga0209974_10032154
978 Ga0268266_10012888
979 Ga0268266_10014464
980 Ga0268266_10030657
981 Ga0268266_10089110
982 Ga0268265_10004349
983 Ga0268265_10030690
984 Ga0268264_10003678
985 Ga0268264_10007952
986 Ga0268264_10011710
987 Ga0268264_10036848
988 Ga0307408_100379822
989 Ga0307405_10012596
990 Ga0307413_10002936
991 Ga0307410_10005196
992 Ga0307407_10012112
993 Ga0307412_10012204
994 Ga0307409_100008907
995 Ga0307414_10035327
996 Ga0307411_10020677
997 Ga0307415_100006342
998 Ga0373923_0057141
999 Ga0373945_0054704
1000 Ga0373954_0008265
1001 Ga0373957_0039591
1002 Ga0373946_0021924
1003 Ga0373946_0023101
1004 Ga0373955_0021975
1005 Ga0373935_0022085
1006 Ga0373927_0008354
1007 Ga0373927_0017070
1008 Ga0373927_0019653
1009 Ga0373933_0008700
1010 Ga0373947_0028261
1011 Ga0373937_0066632
1012 Ga0373925_0000590
1013 Ga0373925_0268643
1014 Ga0395900_0144360
1015 Ga0436361_0307946
1016 Ga0436361_0754638
1017 Ga0436361_0856436
1018 Ga0436361_1183287
1019 Ga0466958_0054942
1020 Ga0495629_0068714
1021 Ga0495580_0004800
1022 Ga0495580_0052974
1023 Ga0495582_0003342
1024 Ga0495594_0146957
1025 Ga0495587_0104625
1026 Ga0495647_0004222
1027 Ga0495680_0041826
1028 Ga0495684_0002449
1029 Ga0496100_0133913
1030 Ga0496102_0023360
1031 Ga0496103_0087858
1032 Ga0496104_0001874
1033 Ga0496106_0010350
1034 Ga0496107_0016181
1035 Ga0496108_0036218
1036 Ga0496109_0191539
1037 Ga0496110_0152753
1038 Ga0496112_0006765
1039 Ga0496112_0006881
1040 Ga0496112_0117740
1041 Ga0496113_0005959
1042 Ga0496113_0290951
1043 Ga0496114_0121891
1044 Ga0496115_0021603
1045 nmdc:mga05p37_134643_c1
1046 nmdc:mga0n895_169752_c1
1047 nmdc:mga0n895_27844_c1
1048 nmdc:mga0n895_581678_c1
1049 nmdc:mga0rr50_148311_c1
1050 nmdc:mga0rr50_151836_c1
1051 nmdc:mga0a205_39514_c1
1052 Ga0495601_0141748
1053 Ga0495619_0003805
1054 Ga0495619_0258981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

167

247

0.93

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

259

357

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jz3-assembly1.cif.gz_A structure of the cytoplasmic segment of histidine kinase qsec 0.7553 170 308
3a0z-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 4: isopropanol, orthorombic) 0.7338 173 308
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.7327 173 308
3a0w-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.724 173 308
3a0w-assembly2.cif.gz_B catalytic domain of histidine kinase thka (tm1359) for mad phasing (nucleotide free form 2, orthorombic) 0.7233 173 310
ID Description Score Start End Superfamily
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8863 172 306 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8678 172 306 3.30.565.10
af_P0AA93_414_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8428 174 311 3.30.565.10
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7898 153 311 3.30.565.10
af_P0AA93_414_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7895 174 311 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A6J4L5E0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.897 197 311 GO:0000155
AF-A0A6J4L5E0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8896 197 311 GO:0000155
AF-A0A497CWF6-F1-model_v4 GHKL domain-containing protein 0.8365 189 306
AF-A0A7X8ZN63-F1-model_v4 Histidine kinase 0.8165 156 306 GO:0000155
GO:0016020
AF-A0A4Q5V3I5-F1-model_v4 deleted 0.8151 79 312

Map