F459545

General Info

Members Datasets Scaffolds Average Seq Length
527 299 512 410

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10126699|Ga0207659_101266991
Length 484
Sequence MRACPIPEIDWNVSARTGKTFIKRFTEERELTVILAVDLSGSGSFGSGRPPWVPSTLVTSGPTSDVSKETAGAPLVVRTVALELPAEASLLDLLPEDHPVTWLRNGDGLVGCGVAAVLRPSGPDRFAEADAWWRDVTARAIVRSDVHEPGSGLVSFGTFAFADDSVESALIVPEVILGRRGDTSWLTTVSSVGGLDQLDRRLELATTPPAPVGVTFTDGALDGQQWMAAVGEAVRRINAGDLEKVVLARDLVATAAEPIDVRWPLRRLADGYPTCWTFHVDGIFGATPELLVRRERGLVTSRVLAGTIRRTGDDARDLTLAARLARSSKDLEEHEYAVRSVAEALEPHCSSMNVPEAPFVLHLPNVMHLATDVAGVVHDAATVTSLELAAALHPSAAVGGTPTRDAIALIAELEGMDRGRYAGPVGWMDAQGDGEWGIALRSAVIDGATVRLYAGCGIVADSDPEAELAETQGKFVPVRDALST

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
4 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
7 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
8 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
9 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
10 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
11 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
12 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
13 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
14 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
154 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
155 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
156 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0.19
Isolates 2.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 8.16
Nodule 0
Rhizoplane 6.64
Rhizosphere 81.4
Stem 0
Stem Tuber 0
Unclassified 3.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014343 3300001979 Bacteria 2926
2 JGI24739J22299_10013514 3300001989 Bacteria 2980
3 JGI24737J22298_10000883 3300001990 Bacteria 10709
4 JGI24738J21930_10007663 3300002075 Bacteria 2480
5 JGI24744J21845_10006150 3300002077 Bacteria 2490
6 Ga0070658_10093621 3300005327 Bacteria 2478
7 Ga0070683_100014369 3300005329 Bacteria 6925
8 Ga0070683_100035140 3300005329 Bacteria 4581
9 Ga0070670_100008648 3300005331 Bacteria 8691
10 Ga0068869_100152091 3300005334 Bacteria 1795
11 Ga0070680_100050778 3300005336 Bacteria 3383
12 Ga0070682_100011681 3300005337 Bacteria 5020
13 Ga0070682_100053194 3300005337 Bacteria 2537
14 Ga0068868_100017979 3300005338 Bacteria 5276
15 Ga0068868_100049680 3300005338 Bacteria 3292
16 Ga0070660_100062623 3300005339 Bacteria 2890
17 Ga0070660_100129374 3300005339 Bacteria 2019
18 Ga0070689_100075178 3300005340 Bacteria 2644
19 Ga0070691_10009498 3300005341 Bacteria 4438
20 Ga0070661_100187709 3300005344 Bacteria 1575
21 Ga0070669_100058715 3300005353 Bacteria 2823
22 Ga0070675_100088812 3300005354 Bacteria 2587
23 Ga0070675_100195878 3300005354 Bacteria 1752
24 Ga0070671_100018779 3300005355 Bacteria 5619
25 Ga0070673_100018065 3300005364 Bacteria 5031
26 Ga0070659_100078345 3300005366 Bacteria 2636
27 Ga0070667_100042907 3300005367 Bacteria 3795
28 Ga0070667_100064728 3300005367 Bacteria 3103
29 Ga0070709_10067834 3300005434 Bacteria 2292
30 Ga0070714_100122941 3300005435 Bacteria 2311
31 Ga0070713_100011013 3300005436 Bacteria 6564
32 Ga0070710_10000505 3300005437 Bacteria 18330
33 Ga0070701_10015954 3300005438 Bacteria 3481
34 Ga0070701_10019669 3300005438 Bacteria 3192
35 Ga0070711_100125867 3300005439 Bacteria 1902
36 Ga0070700_100018285 3300005441 Bacteria 4027
37 Ga0070678_100026245 3300005456 Bacteria 3935
38 Ga0070662_100051334 3300005457 Bacteria 2977
39 Ga0070662_100189495 3300005457 Bacteria 1626
40 Ga0070681_10058330 3300005458 Bacteria 3840
41 Ga0070681_10194572 3300005458 Bacteria 1947
42 Ga0070706_100001261 3300005467 Bacteria 27056
43 Ga0070698_100000408 3300005471 Bacteria 45628
44 Ga0070698_100086394 3300005471 Bacteria 3123
45 Ga0070679_100129313 3300005530 Bacteria 2507
46 Ga0070679_100174373 3300005530 Bacteria 2123
47 Ga0070684_100004776 3300005535 Bacteria 10352
48 Ga0070684_100064125 3300005535 Bacteria 3222
49 Ga0070684_100098422 3300005535 Bacteria 2609
50 Ga0070684_100264469 3300005535 Bacteria 1574
51 Ga0068853_100016715 3300005539 Bacteria 6042
52 Ga0068853_100113954 3300005539 Bacteria 2404
53 Ga0070672_100003670 3300005543 Bacteria 9972
54 Ga0070672_100055011 3300005543 Bacteria 3117
55 Ga0070696_100000187 3300005546 Bacteria 36190
56 Ga0070693_100082559 3300005547 Bacteria 1919
57 Ga0070665_100000516 3300005548 Bacteria 55112
58 Ga0070665_100128440 3300005548 Bacteria 2537
59 Ga0068855_100208450 3300005563 Bacteria 2198
60 Ga0068854_100138037 3300005578 Bacteria 1868
61 Ga0068854_100236477 3300005578 Bacteria 1453
62 Ga0068856_100029744 3300005614 Bacteria 5336
63 Ga0068856_100063781 3300005614 Bacteria 3640
64 Ga0070702_100036173 3300005615 Bacteria 2733
65 Ga0068852_100024052 3300005616 Bacteria 4916
66 Ga0068852_100066673 3300005616 Bacteria 3144
67 Ga0068852_100126853 3300005616 Bacteria 2345
68 Ga0068859_100069551 3300005617 Bacteria 3555
69 Ga0068864_100040133 3300005618 Bacteria 4004
70 Ga0068864_100088392 3300005618 Bacteria 2729
71 Ga0068866_10012229 3300005718 Bacteria 3738
72 Ga0068861_100025987 3300005719 Bacteria 4252
73 Ga0068861_100140340 3300005719 Bacteria 1971
74 Ga0068851_10036346 3300005834 Bacteria 2466
75 Ga0068870_10000498 3300005840 Bacteria 14856
76 Ga0068870_10029456 3300005840 Bacteria 2766
77 Ga0068863_100013023 3300005841 Bacteria 8019
78 Ga0068860_100000935 3300005843 Bacteria 32328
79 Ga0068860_100015625 3300005843 Bacteria 7412
80 Ga0081540_1002210 3300005983 Bacteria 16066
81 Ga0081540_1064004 3300005983 Bacteria 1737
82 Ga0070717_10020355 3300006028 Bacteria 5217
83 Ga0070717_10021159 3300006028 Bacteria 5124
84 Ga0070717_10022511 3300006028 Bacteria 4981
85 Ga0075365_10001291 3300006038 Bacteria 11158
86 Ga0075365_10063284 3300006038 Bacteria 2476
87 Ga0075368_10005875 3300006042 Bacteria 4249
88 Ga0075368_10012620 3300006042 Bacteria 3093
89 Ga0075368_10034343 3300006042 Bacteria 1976
90 Ga0075363_100006847 3300006048 Bacteria 5209
91 Ga0075363_100098702 3300006048 Bacteria 1614
92 Ga0075364_10006892 3300006051 Bacteria 6708
93 Ga0075364_10012496 3300006051 Bacteria 5196
94 Ga0075364_10027427 3300006051 Bacteria 3638
95 Ga0075364_10069706 3300006051 Bacteria 2314
96 Ga0075364_10142430 3300006051 Bacteria 1613
97 Ga0075432_10003084 3300006058 Bacteria 5620
98 Ga0070712_100098020 3300006175 Bacteria 2162
99 Ga0075362_10025470 3300006177 Bacteria 2519
100 Ga0075367_10019671 3300006178 Bacteria 3748
101 Ga0075367_10062861 3300006178 Bacteria 2218
102 Ga0075367_10084204 3300006178 Bacteria 1928
103 Ga0075367_10107430 3300006178 Bacteria 1710
104 Ga0075370_10001186 3300006353 Bacteria 10976
105 Ga0075370_10073099 3300006353 Bacteria 1963
106 Ga0068871_100113365 3300006358 Bacteria 2283
107 Ga0075428_100389096 3300006844 Bacteria 1495
108 Ga0075431_100059950 3300006847 Bacteria 3927
109 Ga0075431_100132207 3300006847 Bacteria 2574
110 Ga0075433_10248168 3300006852 Bacteria 1579
111 Ga0075434_100052464 3300006871 Bacteria 4052
112 Ga0068865_100023489 3300006881 Bacteria 4037
113 Ga0075436_100002394 3300006914 Bacteria 12926
114 Ga0097620_100069547 3300006931 Bacteria 3555
115 Ga0075435_100001452 3300007076 Bacteria 15217
116 Ga0111539_10013377 3300009094 Bacteria 10257
117 Ga0105245_10001045 3300009098 Bacteria 25060
118 Ga0105245_10048078 3300009098 Bacteria 3816
119 Ga0105245_10128987 3300009098 Bacteria 2370
120 Ga0105245_10139885 3300009098 Bacteria 2279
121 Ga0105247_10077447 3300009101 Bacteria 2090
122 Ga0105247_10108827 3300009101 Bacteria 1781
123 Ga0114129_10005133 3300009147 Bacteria 18430
124 Ga0114129_10064363 3300009147 Bacteria 5117
125 Ga0105243_10023409 3300009148 Bacteria 4703
126 Ga0105243_10065522 3300009148 Bacteria 2918
127 Ga0105243_10083065 3300009148 Bacteria 2620
128 Ga0105241_10033003 3300009174 Bacteria 3884
129 Ga0105242_10210940 3300009176 Bacteria 1731
130 Ga0105248_10011321 3300009177 Bacteria 9832
131 Ga0105248_10034299 3300009177 Bacteria 5673
132 Ga0105248_10314517 3300009177 Bacteria 1764
133 Ga0105239_10001253 3300010375 Bacteria 34499
134 Ga0105239_10195661 3300010375 Bacteria 2264
135 Ga0105246_10002828 3300011119 Bacteria 10519
136 Ga0105246_10035193 3300011119 Bacteria 3345
137 Ga0105246_10060042 3300011119 Bacteria 2641
138 Ga0157371_10206858 3300013102 Bacteria 1408
139 Ga0157370_10057427 3300013104 Bacteria 3700
140 Ga0157369_10045086 3300013105 Bacteria 4797
141 Ga0157374_10051523 3300013296 Bacteria 3831
142 Ga0163162_10029675 3300013306 Bacteria 5414
143 Ga0157372_10085297 3300013307 Bacteria 3581
144 Ga0157375_10013311 3300013308 Bacteria 7317
145 Ga0157375_10027407 3300013308 Bacteria 5325
146 Ga0157375_10067602 3300013308 Bacteria 3571
147 Ga0157375_10143980 3300013308 Bacteria 2513
148 Ga0157375_10191074 3300013308 Bacteria 2202
149 Ga0163163_10037132 3300014325 Bacteria 4738
150 Ga0157380_10006556 3300014326 Bacteria 8211
151 Ga0157377_10062626 3300014745 Bacteria 2128
152 Ga0157379_10081465 3300014968 Bacteria 2899
153 Ga0157376_10206080 3300014969 Bacteria 1812
154 Ga0163161_10038762 3300017792 Bacteria 3419
155 Ga0163161_10065327 3300017792 Bacteria 2655
156 Ga0206353_10753967 3300020082 Bacteria 3993
157 Ga0213875_10001577 3300021388 Bacteria 14567
158 Ga0207656_10009921 3300025321 Bacteria 3547
159 Ga0207688_10001785 3300025901 Bacteria 11428
160 Ga0207688_10004278 3300025901 Bacteria 7784
161 Ga0207688_10080902 3300025901 Bacteria 1855
162 Ga0207647_10003470 3300025904 Bacteria 11824
163 Ga0207647_10028804 3300025904 Bacteria 3603
164 Ga0207647_10044909 3300025904 Bacteria 2759
165 Ga0207699_10117629 3300025906 Bacteria 1714
166 Ga0207645_10012919 3300025907 Bacteria 5651
167 Ga0207643_10001291 3300025908 Bacteria 14603
168 Ga0207643_10006874 3300025908 Bacteria 6106
169 Ga0207643_10014438 3300025908 Bacteria 4290
170 Ga0207684_10016281 3300025910 Bacteria 6384
171 Ga0207707_10250039 3300025912 Bacteria 1540
172 Ga0207662_10027752 3300025918 Bacteria 3269
173 Ga0207657_10022169 3300025919 Bacteria 5957
174 Ga0207657_10036870 3300025919 Bacteria 4374
175 Ga0207657_10124261 3300025919 Bacteria 2120
176 Ga0207652_10008433 3300025921 Bacteria 8294
177 Ga0207652_10049969 3300025921 Bacteria 3582
178 Ga0207652_10052211 3300025921 Bacteria 3507
179 Ga0207652_10144418 3300025921 Bacteria 2129
180 Ga0207652_10237238 3300025921 Bacteria 1644
181 Ga0207694_10040494 3300025924 Bacteria 3587
182 Ga0207659_10126699 3300025926 Bacteria 1965
183 Ga0207687_10004073 3300025927 Bacteria 9797
184 Ga0207687_10145519 3300025927 Bacteria 1803
185 Ga0207664_10003864 3300025929 Bacteria 10068
186 Ga0207644_10043180 3300025931 Bacteria 3198
187 Ga0207706_10199947 3300025933 Bacteria 1753
188 Ga0207709_10036673 3300025935 Bacteria 2907
189 Ga0207669_10108246 3300025937 Bacteria 1856
190 Ga0207691_10000365 3300025940 Bacteria 45542
191 Ga0207691_10077153 3300025940 Bacteria 3002
192 Ga0207691_10165817 3300025940 Bacteria 1936
193 Ga0207689_10005718 3300025942 Bacteria 11053
194 Ga0207661_10000322 3300025944 Bacteria 30526
195 Ga0207661_10058082 3300025944 Bacteria 3113
196 Ga0207661_10082289 3300025944 Bacteria 2661
197 Ga0207661_10116984 3300025944 Bacteria 2264
198 Ga0207679_10008244 3300025945 Bacteria 6635
199 Ga0207658_10067846 3300025986 Bacteria 2689
200 Ga0207658_10199049 3300025986 Bacteria 1671
201 Ga0207703_10040698 3300026035 Bacteria 3720
202 Ga0207639_10047826 3300026041 Bacteria 3235
203 Ga0207639_10166003 3300026041 Bacteria 1865
204 Ga0207678_10000416 3300026067 Bacteria 38515
205 Ga0207708_10000208 3300026075 Bacteria 46487
206 Ga0207708_10013574 3300026075 Bacteria 6090
207 Ga0207708_10053697 3300026075 Bacteria 3071
208 Ga0207708_10117429 3300026075 Bacteria 2070
209 Ga0207702_10004296 3300026078 Bacteria 12706
210 Ga0207702_10128491 3300026078 Bacteria 2278
211 Ga0207641_10012736 3300026088 Bacteria 6895
212 Ga0207648_10055126 3300026089 Bacteria 3471
213 Ga0207676_10001620 3300026095 Bacteria 16590
214 Ga0207676_10054944 3300026095 Bacteria 3123
215 Ga0207674_10012444 3300026116 Bacteria 9508
216 Ga0207674_10139371 3300026116 Bacteria 2386
217 Ga0207675_100010541 3300026118 Bacteria 8659
218 Ga0207675_100036539 3300026118 Bacteria 4582
219 Ga0207675_100260127 3300026118 Bacteria 1682
220 Ga0207683_10002172 3300026121 Bacteria 17224
221 Ga0207683_10058565 3300026121 Bacteria 3383
222 Ga0207698_10014796 3300026142 Bacteria 5200
223 Ga0207698_10021543 3300026142 Bacteria 4461
224 Ga0207698_10048793 3300026142 Bacteria 3217
225 Ga0209813_10001675 3300027866 Bacteria 4989
226 Ga0209813_10008505 3300027866 Bacteria 2596
227 Ga0268266_10000509 3300028379 Bacteria 54900
228 Ga0268266_10063913 3300028379 Bacteria 3178
229 Ga0268264_10000374 3300028381 Bacteria 65781
230 Ga0268264_10019656 3300028381 Bacteria 5518
231 Ga0268264_10168624 3300028381 Bacteria 1978
232 Ga0307511_10000590 3300030521 Bacteria 38846
233 Ga0316177_1137362 3300030731 Bacteria 1463
234 Ga0316176_1211199 3300030732 Bacteria 1876
235 Ga0314311_1246063 3300030733 Bacteria 2057
236 Ga0307408_100071989 3300031548 Bacteria 2558
237 Ga0316576_10004023 3300031727 Bacteria 8750
238 Ga0316576_10011817 3300031727 Bacteria 5741
239 Ga0307413_10029598 3300031824 Bacteria 3066
240 Ga0307413_10036457 3300031824 Bacteria 2831
241 Ga0307410_10016443 3300031852 Bacteria 4413
242 Ga0307410_10017503 3300031852 Bacteria 4306
243 Ga0307406_10055646 3300031901 Bacteria 2530
244 Ga0307407_10014503 3300031903 Bacteria 3862
245 Ga0307407_10026504 3300031903 Bacteria 3071
246 Ga0307412_10039779 3300031911 Bacteria 3039
247 Ga0307412_10130128 3300031911 Bacteria 1827
248 Ga0307409_100004301 3300031995 Bacteria 7968
249 Ga0307409_100041608 3300031995 Bacteria 3433
250 Ga0307409_100089528 3300031995 Bacteria 2516
251 Ga0307409_100139228 3300031995 Bacteria 2088
252 Ga0307409_100169559 3300031995 Bacteria 1920
253 Ga0307409_100291451 3300031995 Bacteria 1514
254 Ga0307416_100029013 3300032002 Bacteria 4126
255 Ga0307416_100135865 3300032002 Bacteria 2224
256 Ga0307416_100202444 3300032002 Bacteria 1885
257 Ga0307414_10029640 3300032004 Bacteria 3564
258 Ga0307414_10051038 3300032004 Bacteria 2869
259 Ga0307411_10001892 3300032005 Bacteria 8924
260 Ga0307411_10063295 3300032005 Bacteria 2471
261 Ga0307411_10167552 3300032005 Bacteria 1653
262 Ga0307415_100000246 3300032126 Bacteria 23474
263 Ga0307415_100054745 3300032126 Bacteria 2725
264 Ga0307415_100115291 3300032126 Bacteria 2002
265 Ga0307415_100122492 3300032126 Bacteria 1953
266 Ga0373934_0003349 3300035086 Bacteria 5870
267 Ga0373944_0003752 3300035089 Bacteria 3927
268 Ga0373923_0004308 3300035111 Bacteria 4710
269 Ga0373936_0026411 3300035113 Bacteria 2273
270 Ga0373953_0000559 3300035117 Bacteria 10324
271 Ga0373953_0018303 3300035117 Bacteria 2590
272 Ga0373953_0050752 3300035117 Bacteria 1676
273 Ga0373956_0000259 3300035119 Bacteria 21148
274 Ga0373957_0004792 3300035120 Bacteria 4144
275 Ga0373943_0044732 3300035170 Bacteria 2155
276 Ga0373946_0058375 3300035171 Bacteria 1634
277 Ga0373955_0000042 3300035172 Bacteria 50503
278 Ga0316574_0003441 3300035398 Bacteria 8157
279 Ga0316574_0094083 3300035398 Bacteria 1914
280 Ga0373924_0002625 3300035410 Bacteria 6065
281 Ga0373924_0008331 3300035410 Bacteria 3763
282 Ga0373931_0070600 3300035691 Bacteria 1906
283 Ga0373935_0092157 3300035692 Bacteria 1985
284 Ga0373933_0000024 3300035724 Bacteria 93753
285 Ga0373933_0002131 3300035724 Bacteria 11374
286 Ga0373937_0000029 3300036401 Bacteria 123547
287 Ga0373937_0016258 3300036401 Bacteria 6603
288 Ga0373937_0018412 3300036401 Bacteria 6237
289 Ga0316584_0030443 3300036712 Bacteria 3987
290 Ga0373925_0046247 3300037068 Bacteria 3236
291 Ga0395900_0003901 3300037418 Bacteria 15934
292 Ga0395900_0025721 3300037418 Bacteria 6026
293 Ga0395900_0038298 3300037418 Bacteria 4942
294 Ga0395900_0048454 3300037418 Bacteria 4377
295 Ga0395898_0048906 3300037466 Bacteria 4145
296 Ga0395898_0114063 3300037466 Bacteria 2590
297 Ga0395905_0334654 3300037471 Bacteria 1405
298 Ga0436364_0512751 3300037853 Bacteria 53348
299 Ga0395901_0032608 3300038443 Bacteria 5373
300 Ga0395901_0061850 3300038443 Bacteria 3896
301 Ga0395901_0125625 3300038443 Bacteria 2696
302 Ga0436365_1259398 3300039437 Bacteria 7823
303 Ga0451833_0309082 3300041491 Bacteria 3515
304 Ga0451837_1325092 3300041494 Bacteria 4353
305 Ga0451839_0248974 3300041496 Bacteria 4840
306 Ga0439448_0008448 3300042005 Bacteria 3017
307 Ga0439449_0038536 3300042007 Bacteria 1777
308 Ga0439446_0025261 3300042156 Bacteria 1698
309 Ga0466965_0004742 3300044683 Bacteria 6059
310 Ga0466965_0005892 3300044683 Bacteria 5535
311 Ga0466965_0012182 3300044683 Bacteria 4041
312 Ga0466966_0002361 3300044684 Bacteria 12330
313 Ga0466966_0002490 3300044684 Bacteria 12063
314 Ga0466966_0153128 3300044684 Bacteria 1405
315 Ga0466961_0005360 3300044693 Bacteria 8070
316 Ga0466961_0009837 3300044693 Bacteria 6089
317 Ga0466961_0016615 3300044693 Bacteria 4733
318 Ga0466961_0038957 3300044693 Bacteria 3048
319 Ga0466961_0117107 3300044693 Bacteria 1674
320 Ga0466963_0001501 3300044694 Bacteria 12624
321 Ga0466963_0017547 3300044694 Bacteria 4463
322 Ga0466964_0105313 3300044706 Bacteria 1250
323 Ga0466971_0037363 3300044719 Bacteria 2176
324 Ga0466970_0043074 3300044765 Bacteria 2401
325 Ga0466970_0050959 3300044765 Bacteria 2209
326 Ga0466957_0005140 3300044842 Bacteria 7314
327 Ga0466957_0039715 3300044842 Bacteria 2840
328 Ga0466960_0001139 3300044901 Bacteria 9536
329 Ga0466960_0002593 3300044901 Bacteria 6798
330 Ga0466959_0068399 3300045049 Bacteria 2573
331 Ga0466959_0075826 3300045049 Bacteria 2429
332 Ga0466958_0105068 3300045836 Bacteria 1759
333 Ga0466967_0004458 3300045976 Bacteria 9448
334 Ga0466967_0010889 3300045976 Bacteria 6851
335 Ga0466967_0028090 3300045976 Bacteria 4692
336 Ga0466967_0061984 3300045976 Bacteria 3319
337 Ga0466967_0109278 3300045976 Bacteria 2539
338 Ga0466967_0261850 3300045976 Bacteria 1655
339 Ga0466967_0311032 3300045976 Bacteria 1517
340 Ga0466967_0371607 3300045976 Bacteria 1387
341 Ga0495592_0000040 3300046454 Bacteria 123599
342 Ga0495592_0033946 3300046454 Bacteria 3847
343 Ga0495603_0062306 3300046455 Bacteria 2202
344 Ga0495629_0034825 3300046459 Bacteria 3559
345 Ga0495629_0084039 3300046459 Bacteria 2221
346 Ga0495641_0007867 3300046461 Bacteria 6589
347 Ga0495651_0000017 3300046462 Bacteria 124010
348 Ga0495651_0003331 3300046462 Bacteria 12340
349 Ga0495653_0023228 3300046463 Bacteria 5014
350 Ga0495653_0102539 3300046463 Bacteria 2070
351 Ga0495650_0012030 3300046471 Bacteria 4683
352 Ga0495662_0039873 3300046476 Bacteria 2268
353 Ga0495608_0000053 3300046511 Bacteria 93787
354 Ga0495608_0001385 3300046511 Bacteria 17232
355 Ga0495628_0003346 3300046516 Bacteria 14336
356 Ga0495652_0004370 3300046529 Bacteria 13521
357 Ga0495652_0071474 3300046529 Bacteria 2896
358 Ga0495665_0011540 3300046531 Bacteria 4783
359 Ga0495640_0065345 3300046533 Bacteria 2456
360 Ga0495587_0000079 3300046536 Bacteria 76330
361 Ga0495587_0051987 3300046536 Bacteria 2419
362 Ga0495587_0136602 3300046536 Bacteria 1400
363 Ga0495645_0060085 3300046543 Bacteria 2755
364 Ga0495667_0000063 3300046559 Bacteria 93832
365 Ga0495667_0011569 3300046559 Bacteria 5974
366 Ga0495667_0038552 3300046559 Bacteria 3181
367 Ga0495657_0000032 3300046675 Bacteria 123599
368 Ga0495657_0012453 3300046675 Bacteria 6321
369 Ga0495657_0027196 3300046675 Bacteria 4040
370 Ga0495599_0000047 3300046678 Bacteria 85391
371 Ga0495599_0007807 3300046678 Bacteria 6495
372 Ga0495599_0021137 3300046678 Bacteria 4058
373 Ga0495623_0006030 3300046679 Bacteria 7883
374 Ga0495623_0028564 3300046679 Bacteria 3588
375 Ga0495646_0026817 3300046680 Bacteria 3616
376 Ga0495669_0024146 3300046684 Bacteria 2649
377 Ga0495600_0134467 3300046809 Bacteria 1606
378 Ga0495581_0050360 3300047315 Bacteria 2405
379 Ga0495604_0000688 3300047317 Bacteria 28660
380 Ga0495604_0015385 3300047317 Bacteria 6105
381 Ga0495604_0079347 3300047317 Bacteria 2461
382 Ga0495674_0239552 3300047319 Bacteria 1495
383 Ga0495680_0000085 3300047322 Bacteria 83333
384 Ga0495680_0006211 3300047322 Bacteria 11134
385 Ga0495680_0056399 3300047322 Bacteria 3041
386 Ga0495675_0000946 3300047444 Bacteria 17615
387 Ga0495675_0061195 3300047444 Bacteria 2385
388 Ga0495684_0015842 3300047471 Bacteria 5803
389 Ga0495593_0038705 3300047673 Bacteria 2574
390 Ga0495602_0001525 3300048088 Bacteria 23037
391 Ga0496101_0004132 3300048904 Bacteria 9088
392 Ga0496101_0019589 3300048904 Bacteria 4622
393 Ga0496101_0094372 3300048904 Bacteria 2230
394 Ga0496101_0108538 3300048904 Bacteria 2087
395 Ga0496101_0266433 3300048904 Bacteria 1337
396 Ga0496102_0007714 3300048905 Bacteria 9194
397 Ga0496102_0060970 3300048905 Bacteria 3451
398 Ga0496103_0023740 3300048906 Bacteria 3698
399 Ga0496103_0097373 3300048906 Bacteria 1860
400 Ga0496105_0081900 3300048908 Bacteria 2666
401 Ga0496105_0139123 3300048908 Bacteria 1999
402 Ga0496106_0025755 3300048909 Bacteria 4377
403 Ga0496106_0078145 3300048909 Bacteria 2539
404 Ga0496107_0033516 3300048910 Bacteria 3675
405 Ga0496107_0194044 3300048910 Bacteria 1509
406 Ga0496108_0002092 3300048911 Bacteria 15967
407 Ga0496108_0113151 3300048911 Bacteria 2323
408 Ga0496108_0114965 3300048911 Bacteria 2304
409 Ga0496108_0203550 3300048911 Bacteria 1718
410 Ga0496109_0012848 3300048912 Bacteria 7238
411 Ga0496109_0067301 3300048912 Bacteria 3281
412 Ga0496109_0316269 3300048912 Bacteria 1473
413 Ga0496110_0001710 3300048913 Bacteria 16153
414 Ga0496110_0050461 3300048913 Bacteria 3653
415 Ga0496110_0134840 3300048913 Bacteria 2231
416 Ga0496111_0021572 3300048914 Bacteria 4500
417 Ga0496111_0026115 3300048914 Bacteria 4123
418 Ga0496111_0027854 3300048914 Bacteria 4001
419 Ga0496113_0074448 3300048916 Bacteria 2589
420 Ga0496114_0035008 3300048917 Bacteria 4146
421 Ga0496114_0045839 3300048917 Bacteria 3633
422 Ga0496114_0093559 3300048917 Bacteria 2556
423 Ga0496114_0094920 3300048917 Bacteria 2537
424 Ga0496115_0003477 3300048918 Bacteria 11329
425 Ga0496115_0024439 3300048918 Bacteria 4697
426 Ga0496124_0021648 3300048927 Bacteria 5922
427 Ga0496124_0035554 3300048927 Bacteria 4357
428 Ga0501031_0022032 3300049568 Bacteria 4152
429 Ga0501031_0045439 3300049568 Bacteria 2865
430 Ga0501031_0149218 3300049568 Bacteria 1527
431 Ga0501034_0087886 3300049571 Bacteria 3107
432 Ga0501036_0027020 3300049572 Bacteria 4850
433 Ga0501037_0136603 3300049573 Bacteria 1756
434 Ga0501038_0024352 3300049574 Bacteria 5402
435 Ga0501039_0007274 3300049575 Bacteria 8432
436 Ga0501039_0045507 3300049575 Bacteria 3391
437 Ga0501041_0004277 3300049577 Bacteria 8264
438 Ga0501042_0013394 3300049578 Bacteria 5579
439 Ga0501047_0000112 3300049581 Bacteria 98939
440 Ga0501067_0006602 3300049583 Bacteria 6433
441 Ga0501067_0009826 3300049583 Bacteria 5297
442 Ga0501067_0043572 3300049583 Bacteria 2492
443 Ga0501067_0051515 3300049583 Bacteria 2282
444 Ga0501068_0002525 3300049584 Bacteria 9709
445 Ga0501068_0039698 3300049584 Bacteria 2823
446 Ga0501069_0042190 3300049585 Bacteria 2523
447 Ga0501069_0044902 3300049585 Bacteria 2447
448 Ga0501069_0059762 3300049585 Bacteria 2127
449 Ga0501070_0001860 3300049586 Bacteria 18632
450 Ga0501070_0009674 3300049586 Bacteria 8151
451 Ga0501070_0016837 3300049586 Bacteria 6136
452 Ga0501070_0051248 3300049586 Bacteria 3426
453 Ga0501070_0062211 3300049586 Bacteria 3092
454 Ga0501070_0283948 3300049586 Bacteria 1350
455 Ga0501071_0006405 3300049587 Bacteria 7641
456 Ga0501071_0044699 3300049587 Bacteria 3177
457 Ga0501071_0257470 3300049587 Bacteria 1318
458 Ga0501072_0031001 3300049588 Bacteria 4183
459 Ga0501072_0152020 3300049588 Bacteria 1845
460 Ga0501073_0003012 3300049589 Bacteria 12622
461 Ga0501073_0042469 3300049589 Bacteria 3209
462 Ga0501073_0095558 3300049589 Bacteria 2064
463 Ga0501074_0038928 3300049590 Bacteria 3444
464 Ga0501074_0039683 3300049590 Bacteria 3409
465 Ga0501079_0059168 3300049741 Bacteria 2956
466 Ga0501079_0086073 3300049741 Bacteria 2433
467 Ga0501079_0147505 3300049741 Bacteria 1834
468 Ga0501080_0007094 3300049742 Bacteria 10117
469 Ga0501080_0041321 3300049742 Bacteria 4298
470 Ga0501083_0008007 3300049744 Bacteria 7485
471 Ga0501083_0030364 3300049744 Bacteria 3714
472 Ga0501083_0050420 3300049744 Bacteria 2801
473 Ga0501045_0142621 3300049824 Bacteria 1782
474 Ga0501045_0208047 3300049824 Bacteria 1457
475 nmdc:mga03683_1096_c1 3300050489 Bacteria 7916
476 nmdc:mga03n38_3361_c1 3300050490 Bacteria 5125
477 nmdc:mga03n38_54106_c1 3300050490 Bacteria 1803
478 nmdc:mga03n38_60099_c1 3300050490 Bacteria 1727
479 nmdc:mga00v17_112387_c1 3300050491 Bacteria 1729
480 nmdc:mga00v17_15668_c1 3300050491 Bacteria 4258
481 nmdc:mga0yw44_21088_c1 3300050492 Bacteria 3629
482 nmdc:mga0yw44_38494_c1 3300050492 Bacteria 2830
483 nmdc:mga0yw44_4285_c1 3300050492 Bacteria 6509
484 nmdc:mga0yw44_84788_c1 3300050492 Bacteria 1992
485 nmdc:mga06z11_147909_c1 3300050494 Bacteria 1333
486 nmdc:mga06z11_20507_c1 3300050494 Bacteria 3056
487 nmdc:mga06z11_28307_c1 3300050494 Bacteria 2688
488 nmdc:mga06z11_49126_c1 3300050494 Bacteria 2150
489 nmdc:mga04h51_3704_c1 3300050495 Bacteria 3739
490 nmdc:mga07m45_102913_c1 3300050496 Bacteria 1641
491 nmdc:mga07m45_6243_c1 3300050496 Bacteria 6018
492 nmdc:mga05p37_28018_c1 3300050507 Bacteria 6864
493 nmdc:mga06r32_692_c3 3300050510 Bacteria 10179
494 nmdc:mga0n895_1510_c1 3300050512 Bacteria 17461
495 nmdc:mga0n895_28306_c1 3300050512 Bacteria 5330
496 nmdc:mga0n895_463001_c1 3300050512 Bacteria 1280
497 nmdc:mga0rr50_8140_c1 3300050513 Bacteria 6507
498 nmdc:mga08x19_1123_c1 3300050514 Bacteria 16676
499 nmdc:mga0a205_139077_c1 3300050515 Bacteria 2329
500 nmdc:mga0a205_143076_c1 3300050515 Bacteria 2292
501 Ga0495601_0046823 3300053077 Bacteria 2722
502 Ga0495595_0001409 3300053084 Bacteria 9342
503 Ga0495619_0085234 3300053085 Bacteria 2133
504 Ga0495619_0086939 3300053085 Bacteria 2114
505 Ga0500644_0000148 3300053088 Bacteria 43939
506 Ga0500593_000774 3300053117 Bacteria 11961
507 Ga0500559_0007294 3300053136 Bacteria 4909
508 Ga0500568_0000706 3300053139 Bacteria 23977
509 Ga0500573_0055242 3300053140 Bacteria 2278
510 Ga0501084_0005525 3300054114 Bacteria 10378
511 Ga0501082_0008583 3300060353 Bacteria 8814
512 Ga0501082_0015723 3300060353 Bacteria 6510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1064004 Ga0081540_10640042 318
2 3300031548 Ga0307408_100071989 Ga0307408_1000719892 338
3 3300031852 Ga0307410_10016443 Ga0307410_100164434 338
4 3300031995 Ga0307409_100004301 Ga0307409_1000043016 338
5 3300032004 Ga0307414_10051038 Ga0307414_100510382 338
6 3300014326 Ga0157380_10006556 Ga0157380_100065565 346
7 3300002075 JGI24738J21930_10007663 JGI24738J21930_100076632 350
8 3300002077 JGI24744J21845_10006150 JGI24744J21845_100061502 350
9 3300005329 Ga0070683_100014369 Ga0070683_1000143693 350
10 3300005354 Ga0070675_100088812 Ga0070675_1000888122 350
11 3300005438 Ga0070701_10015954 Ga0070701_100159542 350
12 3300005535 Ga0070684_100098422 Ga0070684_1000984221 350
13 3300005543 Ga0070672_100003670 Ga0070672_1000036702 350
14 3300005616 Ga0068852_100024052 Ga0068852_1000240525 350
15 3300005618 Ga0068864_100040133 Ga0068864_1000401332 350
16 3300005718 Ga0068866_10012229 Ga0068866_100122292 350
17 3300005719 Ga0068861_100140340 Ga0068861_1001403401 350
18 3300005840 Ga0068870_10029456 Ga0068870_100294562 350
19 3300006881 Ga0068865_100023489 Ga0068865_1000234892 350
20 3300009098 Ga0105245_10048078 Ga0105245_100480783 350
21 3300009148 Ga0105243_10023409 Ga0105243_100234095 350
22 3300009177 Ga0105248_10011321 Ga0105248_100113212 350
23 3300011119 Ga0105246_10035193 Ga0105246_100351933 350
24 3300013307 Ga0157372_10085297 Ga0157372_100852972 350
25 3300014325 Ga0163163_10037132 Ga0163163_100371323 350
26 3300025901 Ga0207688_10004278 Ga0207688_100042784 350
27 3300025908 Ga0207643_10014438 Ga0207643_100144384 350
28 3300025927 Ga0207687_10145519 Ga0207687_101455192 350
29 3300025935 Ga0207709_10036673 Ga0207709_100366732 350
30 3300025940 Ga0207691_10000365 Ga0207691_100003652 350
31 3300025944 Ga0207661_10082289 Ga0207661_100822892 350
32 3300026075 Ga0207708_10000208 Ga0207708_1000020846 350
33 3300026095 Ga0207676_10054944 Ga0207676_100549442 350
34 3300026118 Ga0207675_100010541 Ga0207675_1000105417 350
35 3300026142 Ga0207698_10014796 Ga0207698_100147964 350
36 3300048910 Ga0496107_0033516 Ga0496107_0033516_1792_3114 350
37 3300048911 Ga0496108_0114965 Ga0496108_0114965_460_1782 350
38 3300048913 Ga0496110_0050461 Ga0496110_0050461_1400_2722 350
39 3300048917 Ga0496114_0094920 Ga0496114_0094920_784_2106 350
40 3300005834 Ga0068851_10036346 Ga0068851_100363463 351
41 3300042007 Ga0439449_0038536 Ga0439449_0038536_627_1766 353
42 3300005437 Ga0070710_10000505 Ga0070710_1000050515 358
43 3300026075 Ga0207708_10053697 Ga0207708_100536973 358
44 3300030731 Ga0316177_1137362 Ga0316177_11373621 358
45 3300030732 Ga0316176_1211199 Ga0316176_12111992 358
46 3300030733 Ga0314311_1246063 Ga0314311_12460632 358
47 3300038443 Ga0395901_0125625 Ga0395901_0125625_467_1807 358
48 3300044683 Ga0466965_0004742 Ga0466965_0004742_1679_2797 358
49 3300044683 Ga0466965_0005892 Ga0466965_0005892_3482_4600 358
50 3300044683 Ga0466965_0012182 Ga0466965_0012182_837_1955 358
51 3300025921 Ga0207652_10237238 Ga0207652_102372381 359
52 3300049742 Ga0501080_0041321 Ga0501080_0041321_1181_2428 359
53 3300005441 Ga0070700_100018285 Ga0070700_1000182851 360
54 3300044693 Ga0466961_0038957 Ga0466961_0038957_1551_2864 362
55 3300045976 Ga0466967_0371607 Ga0466967_0371607_117_1355 363
56 3300032005 Ga0307411_10001892 Ga0307411_100018923 364
57 3300006847 Ga0075431_100059950 Ga0075431_1000599502 366
58 3300048927 Ga0496124_0035554 Ga0496124_0035554_3211_4332 366
59 3300050510 nmdc:mga06r32_692_c3 nmdc:mga06r32_692_c3_8575_9819 366
60 3300035117 Ga0373953_0050752 Ga0373953_0050752_278_1534 368
61 3300036401 Ga0373937_0018412 Ga0373937_0018412_4216_5472 368
62 3300044693 Ga0466961_0016615 Ga0466961_0016615_141_1394 368
63 3300046462 Ga0495651_0003331 Ga0495651_0003331_7717_8973 368
64 3300046463 Ga0495653_0023228 Ga0495653_0023228_3695_4951 368
65 3300046511 Ga0495608_0001385 Ga0495608_0001385_235_1491 368
66 3300046529 Ga0495652_0071474 Ga0495652_0071474_323_1579 368
67 3300046536 Ga0495587_0136602 Ga0495587_0136602_97_1353 368
68 3300046543 Ga0495645_0060085 Ga0495645_0060085_1289_2545 368
69 3300046559 Ga0495667_0011569 Ga0495667_0011569_3607_4863 368
70 3300046675 Ga0495657_0012453 Ga0495657_0012453_4930_6186 368
71 3300046678 Ga0495599_0007807 Ga0495599_0007807_3778_5034 368
72 3300046680 Ga0495646_0026817 Ga0495646_0026817_2168_3424 368
73 3300046809 Ga0495600_0134467 Ga0495600_0134467_24_1280 368
74 3300047317 Ga0495604_0015385 Ga0495604_0015385_3223_4479 368
75 3300047319 Ga0495674_0239552 Ga0495674_0239552_111_1367 368
76 3300047322 Ga0495680_0006211 Ga0495680_0006211_6451_7707 368
77 3300047444 Ga0495675_0061195 Ga0495675_0061195_224_1480 368
78 3300047471 Ga0495684_0015842 Ga0495684_0015842_4402_5658 368
79 3300048904 Ga0496101_0019589 Ga0496101_0019589_2316_3554 368
80 3300048912 Ga0496109_0012848 Ga0496109_0012848_5388_6626 368
81 3300048918 Ga0496115_0003477 Ga0496115_0003477_8143_9381 368
82 3300053085 Ga0495619_0085234 Ga0495619_0085234_144_1400 368
83 3300046471 Ga0495650_0012030 Ga0495650_0012030_3262_4464 371
84 3300044765 Ga0466970_0043074 Ga0466970_0043074_596_1801 372
85 iso_pu_bacteria 2816332139 2816505706 372
86 3300005340 Ga0070689_100075178 Ga0070689_1000751783 373
87 3300005353 Ga0070669_100058715 Ga0070669_1000587152 373
88 3300005366 Ga0070659_100078345 Ga0070659_1000783453 373
89 3300005457 Ga0070662_100051334 Ga0070662_1000513342 373
90 3300005530 Ga0070679_100174373 Ga0070679_1001743732 373
91 3300005535 Ga0070684_100064125 Ga0070684_1000641253 373
92 3300005547 Ga0070693_100082559 Ga0070693_1000825592 373
93 3300005563 Ga0068855_100208450 Ga0068855_1002084502 373
94 3300025901 Ga0207688_10001785 Ga0207688_1000178510 373
95 3300025908 Ga0207643_10006874 Ga0207643_100068743 373
96 3300025918 Ga0207662_10027752 Ga0207662_100277523 373
97 3300025919 Ga0207657_10036870 Ga0207657_100368703 373
98 3300025940 Ga0207691_10165817 Ga0207691_101658171 373
99 3300026075 Ga0207708_10013574 Ga0207708_100135744 373
100 3300026089 Ga0207648_10055126 Ga0207648_100551262 373
101 3300026118 Ga0207675_100036539 Ga0207675_1000365393 373
102 3300028381 Ga0268264_10168624 Ga0268264_101686242 373
103 3300005539 Ga0068853_100016715 Ga0068853_1000167154 374
104 3300005616 Ga0068852_100126853 Ga0068852_1001268532 374
105 3300009101 Ga0105247_10077447 Ga0105247_100774472 374
106 3300009177 Ga0105248_10314517 Ga0105248_103145171 374
107 3300010375 Ga0105239_10195661 Ga0105239_101956613 374
108 3300014745 Ga0157377_10062626 Ga0157377_100626262 374
109 3300021388 Ga0213875_10001577 Ga0213875_100015774 374
110 3300025924 Ga0207694_10040494 Ga0207694_100404944 374
111 3300026041 Ga0207639_10166003 Ga0207639_101660032 374
112 3300026142 Ga0207698_10048793 Ga0207698_100487933 374
113 3300030521 Ga0307511_10000590 Ga0307511_1000059036 374
114 3300037068 Ga0373925_0046247 Ga0373925_0046247_12_1199 374
115 3300037853 Ga0436364_0512751 Ga0436364_0512751_50907_52148 374
116 3300039437 Ga0436365_1259398 Ga0436365_1259398_512_1720 374
117 3300044684 Ga0466966_0002361 Ga0466966_0002361_3972_5213 374
118 3300044693 Ga0466961_0005360 Ga0466961_0005360_4644_5885 374
119 3300044901 Ga0466960_0002593 Ga0466960_0002593_4836_6098 374
120 3300045049 Ga0466959_0068399 Ga0466959_0068399_20_1213 374
121 3300048904 Ga0496101_0266433 Ga0496101_0266433_62_1270 374
122 3300048912 Ga0496109_0316269 Ga0496109_0316269_250_1458 374
123 3300053136 Ga0500559_0007294 Ga0500559_0007294_457_1737 374
124 3300053139 Ga0500568_0000706 Ga0500568_0000706_21642_22976 374
125 iso_pu_bacteria 2751185734 2753069826 374
126 iso_pu_bacteria 2870721527 2870727663 374
127 iso_pu_bacteria 8047710418 8047719869 374
128 3300025921 Ga0207652_10049969 Ga0207652_100499694 375
129 3300035398 Ga0316574_0003441 Ga0316574_0003441_1280_2431 375
130 3300036712 Ga0316584_0030443 Ga0316584_0030443_2521_3672 375
131 3300037471 Ga0395905_0334654 Ga0395905_0334654_49_1296 375
132 3300045976 Ga0466967_0028090 Ga0466967_0028090_2806_4053 375
133 3300048911 Ga0496108_0113151 Ga0496108_0113151_375_1622 375
134 3300045049 Ga0466959_0075826 Ga0466959_0075826_543_1811 376
135 3300005435 Ga0070714_100122941 Ga0070714_1001229412 377
136 3300006028 Ga0070717_10021159 Ga0070717_100211591 377
137 3300025929 Ga0207664_10003864 Ga0207664_100038642 377
138 3300044694 Ga0466963_0017547 Ga0466963_0017547_1142_2383 377
139 3300044706 Ga0466964_0105313 Ga0466964_0105313_44_1225 377
140 3300044842 Ga0466957_0005140 Ga0466957_0005140_3660_4901 377
141 3300045976 Ga0466967_0061984 Ga0466967_0061984_878_2119 377
142 3300048904 Ga0496101_0094372 Ga0496101_0094372_52_1362 377
143 iso_pu_bacteria 2622736605 2623497721 377
144 3300025944 Ga0207661_10116984 Ga0207661_101169842 378
145 3300031824 Ga0307413_10029598 Ga0307413_100295983 378
146 3300031852 Ga0307410_10017503 Ga0307410_100175034 378
147 3300031903 Ga0307407_10014503 Ga0307407_100145032 378
148 3300031911 Ga0307412_10039779 Ga0307412_100397794 378
149 3300031911 Ga0307412_10130128 Ga0307412_101301282 378
150 3300031995 Ga0307409_100041608 Ga0307409_1000416081 378
151 3300031995 Ga0307409_100089528 Ga0307409_1000895282 378
152 3300031995 Ga0307409_100139228 Ga0307409_1001392282 378
153 3300031995 Ga0307409_100169559 Ga0307409_1001695592 378
154 3300031995 Ga0307409_100291451 Ga0307409_1002914512 378
155 3300032002 Ga0307416_100135865 Ga0307416_1001358653 378
156 3300032002 Ga0307416_100202444 Ga0307416_1002024442 378
157 3300032004 Ga0307414_10029640 Ga0307414_100296403 378
158 3300032005 Ga0307411_10063295 Ga0307411_100632952 378
159 3300032126 Ga0307415_100054745 Ga0307415_1000547452 378
160 3300037418 Ga0395900_0003901 Ga0395900_0003901_9359_10624 378
161 3300045976 Ga0466967_0010889 Ga0466967_0010889_4574_5851 378
162 3300049581 Ga0501047_0000112 Ga0501047_0000112_25260_26507 378
163 3300049741 Ga0501079_0147505 Ga0501079_0147505_82_1362 378
164 3300050492 nmdc:mga0yw44_38494_c1 nmdc:mga0yw44_38494_c1_383_1609 378
165 3300050512 nmdc:mga0n895_463001_c1 nmdc:mga0n895_463001_c1_41_1219 378
166 3300005329 Ga0070683_100035140 Ga0070683_1000351403 379
167 3300005337 Ga0070682_100011681 Ga0070682_1000116812 379
168 3300005339 Ga0070660_100129374 Ga0070660_1001293742 379
169 3300005367 Ga0070667_100042907 Ga0070667_1000429072 379
170 3300005458 Ga0070681_10194572 Ga0070681_101945722 379
171 3300005530 Ga0070679_100129313 Ga0070679_1001293133 379
172 3300005535 Ga0070684_100004776 Ga0070684_1000047768 379
173 3300005535 Ga0070684_100264469 Ga0070684_1002644692 379
174 3300005548 Ga0070665_100000516 Ga0070665_10000051627 379
175 3300005614 Ga0068856_100063781 Ga0068856_1000637814 379
176 3300005843 Ga0068860_100015625 Ga0068860_1000156254 379
177 3300009098 Ga0105245_10001045 Ga0105245_100010455 379
178 3300009098 Ga0105245_10128987 Ga0105245_101289872 379
179 3300009176 Ga0105242_10210940 Ga0105242_102109402 379
180 3300009177 Ga0105248_10034299 Ga0105248_100342996 379
181 3300010375 Ga0105239_10001253 Ga0105239_100012537 379
182 3300011119 Ga0105246_10002828 Ga0105246_100028285 379
183 3300013105 Ga0157369_10045086 Ga0157369_100450861 379
184 3300013306 Ga0163162_10029675 Ga0163162_100296752 379
185 3300013308 Ga0157375_10027407 Ga0157375_100274073 379
186 3300020082 Ga0206353_10753967 Ga0206353_107539673 379
187 3300025904 Ga0207647_10028804 Ga0207647_100288043 379
188 3300025904 Ga0207647_10044909 Ga0207647_100449092 379
189 3300025919 Ga0207657_10124261 Ga0207657_101242612 379
190 3300025921 Ga0207652_10052211 Ga0207652_100522113 379
191 3300025921 Ga0207652_10144418 Ga0207652_101444182 379
192 3300025944 Ga0207661_10058082 Ga0207661_100580821 379
193 3300025986 Ga0207658_10067846 Ga0207658_100678462 379
194 3300026078 Ga0207702_10128491 Ga0207702_101284912 379
195 3300026116 Ga0207674_10012444 Ga0207674_100124446 379
196 3300028379 Ga0268266_10000509 Ga0268266_1000050953 379
197 3300028381 Ga0268264_10019656 Ga0268264_100196564 379
198 3300037418 Ga0395900_0048454 Ga0395900_0048454_1884_3164 379
199 3300044684 Ga0466966_0153128 Ga0466966_0153128_44_1315 379
200 3300044694 Ga0466963_0001501 Ga0466963_0001501_9306_10514 379
201 3300044719 Ga0466971_0037363 Ga0466971_0037363_341_1603 379
202 3300044765 Ga0466970_0050959 Ga0466970_0050959_225_1505 379
203 3300044842 Ga0466957_0039715 Ga0466957_0039715_1555_2817 379
204 3300045836 Ga0466958_0105068 Ga0466958_0105068_249_1511 379
205 3300045976 Ga0466967_0004458 Ga0466967_0004458_497_1705 379
206 3300045976 Ga0466967_0109278 Ga0466967_0109278_1000_2277 379
207 3300046684 Ga0495669_0024146 Ga0495669_0024146_1324_2622 379
208 3300048905 Ga0496102_0060970 Ga0496102_0060970_1128_2357 379
209 3300048906 Ga0496103_0097373 Ga0496103_0097373_604_1833 379
210 3300048914 Ga0496111_0021572 Ga0496111_0021572_1929_3158 379
211 3300049573 Ga0501037_0136603 Ga0501037_0136603_437_1699 379
212 3300049583 Ga0501067_0009826 Ga0501067_0009826_2553_3815 379
213 3300049584 Ga0501068_0002525 Ga0501068_0002525_1400_2662 379
214 3300049585 Ga0501069_0059762 Ga0501069_0059762_557_1819 379
215 3300049586 Ga0501070_0001860 Ga0501070_0001860_8979_10181 379
216 3300049586 Ga0501070_0009674 Ga0501070_0009674_5031_6293 379
217 3300049586 Ga0501070_0051248 Ga0501070_0051248_617_1879 379
218 3300049586 Ga0501070_0283948 Ga0501070_0283948_10_1254 379
219 3300049587 Ga0501071_0044699 Ga0501071_0044699_488_1750 379
220 3300049588 Ga0501072_0152020 Ga0501072_0152020_201_1463 379
221 3300049589 Ga0501073_0003012 Ga0501073_0003012_54_1316 379
222 3300049589 Ga0501073_0095558 Ga0501073_0095558_729_1931 379
223 3300049590 Ga0501074_0039683 Ga0501074_0039683_2174_3376 379
224 3300049741 Ga0501079_0059168 Ga0501079_0059168_45_1307 379
225 3300049742 Ga0501080_0007094 Ga0501080_0007094_7383_8645 379
226 3300049744 Ga0501083_0008007 Ga0501083_0008007_1525_2787 379
227 3300049744 Ga0501083_0050420 Ga0501083_0050420_46_1308 379
228 3300049824 Ga0501045_0142621 Ga0501045_0142621_205_1482 379
229 3300054114 Ga0501084_0005525 Ga0501084_0005525_7522_8784 379
230 3300060353 Ga0501082_0015723 Ga0501082_0015723_4373_5635 379
231 3300005471 Ga0070698_100000408 Ga0070698_10000040832 380
232 3300031903 Ga0307407_10026504 Ga0307407_100265043 380
233 3300049583 Ga0501067_0043572 Ga0501067_0043572_63_1373 380
234 3300049585 Ga0501069_0042190 Ga0501069_0042190_107_1417 380
235 3300005614 Ga0068856_100029744 Ga0068856_1000297442 381
236 3300031727 Ga0316576_10011817 Ga0316576_100118174 381
237 3300048917 Ga0496114_0035008 Ga0496114_0035008_958_2253 381
238 3300005338 Ga0068868_100049680 Ga0068868_1000496802 382
239 3300005467 Ga0070706_100001261 Ga0070706_10000126114 382
240 3300005471 Ga0070698_100086394 Ga0070698_1000863943 382
241 3300005983 Ga0081540_1002210 Ga0081540_100221011 382
242 3300006028 Ga0070717_10020355 Ga0070717_100203553 382
243 3300006871 Ga0075434_100052464 Ga0075434_1000524643 382
244 3300009147 Ga0114129_10005133 Ga0114129_100051333 382
245 3300025910 Ga0207684_10016281 Ga0207684_100162813 382
246 3300031727 Ga0316576_10004023 Ga0316576_100040233 382
247 3300035086 Ga0373934_0003349 Ga0373934_0003349_3947_5212 382
248 3300035089 Ga0373944_0003752 Ga0373944_0003752_876_2141 382
249 3300035111 Ga0373923_0004308 Ga0373923_0004308_2054_3319 382
250 3300035113 Ga0373936_0026411 Ga0373936_0026411_154_1419 382
251 3300035117 Ga0373953_0000559 Ga0373953_0000559_4795_6060 382
252 3300035117 Ga0373953_0018303 Ga0373953_0018303_670_1935 382
253 3300035119 Ga0373956_0000259 Ga0373956_0000259_19367_20632 382
254 3300035120 Ga0373957_0004792 Ga0373957_0004792_1745_3010 382
255 3300035170 Ga0373943_0044732 Ga0373943_0044732_872_2137 382
256 3300035171 Ga0373946_0058375 Ga0373946_0058375_13_1278 382
257 3300035172 Ga0373955_0000042 Ga0373955_0000042_18108_19373 382
258 3300035398 Ga0316574_0094083 Ga0316574_0094083_287_1561 382
259 3300035410 Ga0373924_0002625 Ga0373924_0002625_3480_4745 382
260 3300035410 Ga0373924_0008331 Ga0373924_0008331_1702_2967 382
261 3300035692 Ga0373935_0092157 Ga0373935_0092157_498_1763 382
262 3300035724 Ga0373933_0000024 Ga0373933_0000024_18101_19366 382
263 3300035724 Ga0373933_0002131 Ga0373933_0002131_5529_6794 382
264 3300036401 Ga0373937_0000029 Ga0373937_0000029_18135_19400 382
265 3300036401 Ga0373937_0016258 Ga0373937_0016258_2111_3376 382
266 3300042156 Ga0439446_0025261 Ga0439446_0025261_353_1609 382
267 3300046454 Ga0495592_0000040 Ga0495592_0000040_104200_105465 382
268 3300046454 Ga0495592_0033946 Ga0495592_0033946_1148_2413 382
269 3300046455 Ga0495603_0062306 Ga0495603_0062306_491_1756 382
270 3300046459 Ga0495629_0034825 Ga0495629_0034825_1068_2333 382
271 3300046459 Ga0495629_0084039 Ga0495629_0084039_687_1952 382
272 3300046461 Ga0495641_0007867 Ga0495641_0007867_5267_6532 382
273 3300046462 Ga0495651_0000017 Ga0495651_0000017_104611_105876 382
274 3300046463 Ga0495653_0102539 Ga0495653_0102539_660_1925 382
275 3300046476 Ga0495662_0039873 Ga0495662_0039873_241_1506 382
276 3300046511 Ga0495608_0000053 Ga0495608_0000053_74388_75653 382
277 3300046516 Ga0495628_0003346 Ga0495628_0003346_630_1895 382
278 3300046529 Ga0495652_0004370 Ga0495652_0004370_645_1910 382
279 3300046531 Ga0495665_0011540 Ga0495665_0011540_3436_4701 382
280 3300046533 Ga0495640_0065345 Ga0495640_0065345_1035_2300 382
281 3300046536 Ga0495587_0000079 Ga0495587_0000079_74387_75652 382
282 3300046536 Ga0495587_0051987 Ga0495587_0051987_395_1660 382
283 3300046559 Ga0495667_0000063 Ga0495667_0000063_18135_19400 382
284 3300046559 Ga0495667_0038552 Ga0495667_0038552_1708_2973 382
285 3300046675 Ga0495657_0000032 Ga0495657_0000032_104211_105476 382
286 3300046675 Ga0495657_0027196 Ga0495657_0027196_1694_2959 382
287 3300046678 Ga0495599_0000047 Ga0495599_0000047_79631_80896 382
288 3300046678 Ga0495599_0021137 Ga0495599_0021137_178_1443 382
289 3300046679 Ga0495623_0006030 Ga0495623_0006030_5954_7219 382
290 3300046679 Ga0495623_0028564 Ga0495623_0028564_911_2176 382
291 3300047315 Ga0495581_0050360 Ga0495581_0050360_541_1806 382
292 3300047317 Ga0495604_0000688 Ga0495604_0000688_9261_10526 382
293 3300047317 Ga0495604_0079347 Ga0495604_0079347_57_1322 382
294 3300047322 Ga0495680_0000085 Ga0495680_0000085_81391_82656 382
295 3300047322 Ga0495680_0056399 Ga0495680_0056399_1757_3022 382
296 3300047444 Ga0495675_0000946 Ga0495675_0000946_4459_5724 382
297 3300047673 Ga0495593_0038705 Ga0495593_0038705_291_1556 382
298 3300048088 Ga0495602_0001525 Ga0495602_0001525_3638_4903 382
299 3300050507 nmdc:mga05p37_28018_c1 nmdc:mga05p37_28018_c1_2788_4053 382
300 3300050512 nmdc:mga0n895_28306_c1 nmdc:mga0n895_28306_c1_1928_3193 382
301 3300050515 nmdc:mga0a205_143076_c1 nmdc:mga0a205_143076_c1_951_2216 382
302 3300053077 Ga0495601_0046823 Ga0495601_0046823_78_1343 382
303 3300053084 Ga0495595_0001409 Ga0495595_0001409_5669_6934 382
304 3300053085 Ga0495619_0086939 Ga0495619_0086939_424_1689 382
305 iso_pu_bacteria 2643221561 2643827303 382
306 iso_pu_bacteria 2643221696 2644533870 382
307 3300048908 Ga0496105_0081900 Ga0496105_0081900_112_1371 383
308 3300048912 Ga0496109_0067301 Ga0496109_0067301_156_1415 383
309 3300048914 Ga0496111_0026115 Ga0496111_0026115_1013_2272 383
310 3300048917 Ga0496114_0045839 Ga0496114_0045839_1116_2291 383
311 3300049587 Ga0501071_0257470 Ga0501071_0257470_14_1255 383
312 3300009147 Ga0114129_10064363 Ga0114129_100643633 384
313 3300013308 Ga0157375_10067602 Ga0157375_100676024 384
314 3300037418 Ga0395900_0025721 Ga0395900_0025721_4593_5933 384
315 3300038443 Ga0395901_0032608 Ga0395901_0032608_2813_4153 384
316 3300042005 Ga0439448_0008448 Ga0439448_0008448_1642_2949 384
317 3300053117 Ga0500593_000774 Ga0500593_000774_7363_8589 384
318 iso_pu_bacteria 2643221657 2644322716 384
319 3300005327 Ga0070658_10093621 Ga0070658_100936211 385
320 3300005331 Ga0070670_100008648 Ga0070670_1000086488 385
321 3300005334 Ga0068869_100152091 Ga0068869_1001520911 385
322 3300005336 Ga0070680_100050778 Ga0070680_1000507782 385
323 3300005338 Ga0068868_100017979 Ga0068868_1000179796 385
324 3300005339 Ga0070660_100062623 Ga0070660_1000626231 385
325 3300005341 Ga0070691_10009498 Ga0070691_100094985 385
326 3300005344 Ga0070661_100187709 Ga0070661_1001877091 385
327 3300005354 Ga0070675_100195878 Ga0070675_1001958781 385
328 3300005355 Ga0070671_100018779 Ga0070671_1000187795 385
329 3300005364 Ga0070673_100018065 Ga0070673_1000180656 385
330 3300005434 Ga0070709_10067834 Ga0070709_100678342 385
331 3300005436 Ga0070713_100011013 Ga0070713_1000110135 385
332 3300005438 Ga0070701_10019669 Ga0070701_100196692 385
333 3300005439 Ga0070711_100125867 Ga0070711_1001258671 385
334 3300005456 Ga0070678_100026245 Ga0070678_1000262451 385
335 3300005457 Ga0070662_100189495 Ga0070662_1001894952 385
336 3300005458 Ga0070681_10058330 Ga0070681_100583302 385
337 3300005539 Ga0068853_100113954 Ga0068853_1001139543 385
338 3300005543 Ga0070672_100055011 Ga0070672_1000550112 385
339 3300005548 Ga0070665_100128440 Ga0070665_1001284403 385
340 3300005578 Ga0068854_100236477 Ga0068854_1002364772 385
341 3300005615 Ga0070702_100036173 Ga0070702_1000361734 385
342 3300005616 Ga0068852_100066673 Ga0068852_1000666734 385
343 3300005617 Ga0068859_100069551 Ga0068859_1000695514 385
344 3300005618 Ga0068864_100088392 Ga0068864_1000883923 385
345 3300005840 Ga0068870_10000498 Ga0068870_1000049811 385
346 3300005841 Ga0068863_100013023 Ga0068863_1000130238 385
347 3300006028 Ga0070717_10022511 Ga0070717_100225114 385
348 3300006038 Ga0075365_10001291 Ga0075365_100012914 385
349 3300006038 Ga0075365_10063284 Ga0075365_100632842 385
350 3300006042 Ga0075368_10034343 Ga0075368_100343432 385
351 3300006048 Ga0075363_100098702 Ga0075363_1000987022 385
352 3300006051 Ga0075364_10006892 Ga0075364_100068922 385
353 3300006051 Ga0075364_10012496 Ga0075364_100124964 385
354 3300006058 Ga0075432_10003084 Ga0075432_100030842 385
355 3300006175 Ga0070712_100098020 Ga0070712_1000980201 385
356 3300006177 Ga0075362_10025470 Ga0075362_100254702 385
357 3300006178 Ga0075367_10107430 Ga0075367_101074302 385
358 3300006353 Ga0075370_10001186 Ga0075370_100011862 385
359 3300006353 Ga0075370_10073099 Ga0075370_100730991 385
360 3300006358 Ga0068871_100113365 Ga0068871_1001133653 385
361 3300006844 Ga0075428_100389096 Ga0075428_1003890961 385
362 3300006847 Ga0075431_100132207 Ga0075431_1001322074 385
363 3300006852 Ga0075433_10248168 Ga0075433_102481682 385
364 3300006914 Ga0075436_100002394 Ga0075436_1000023945 385
365 3300006931 Ga0097620_100069547 Ga0097620_1000695474 385
366 3300007076 Ga0075435_100001452 Ga0075435_1000014529 385
367 3300009094 Ga0111539_10013377 Ga0111539_100133778 385
368 3300009098 Ga0105245_10139885 Ga0105245_101398852 385
369 3300009101 Ga0105247_10108827 Ga0105247_101088271 385
370 3300009148 Ga0105243_10083065 Ga0105243_100830652 385
371 3300009174 Ga0105241_10033003 Ga0105241_100330032 385
372 3300011119 Ga0105246_10060042 Ga0105246_100600423 385
373 3300013102 Ga0157371_10206858 Ga0157371_102068581 385
374 3300013104 Ga0157370_10057427 Ga0157370_100574272 385
375 3300013296 Ga0157374_10051523 Ga0157374_100515231 385
376 3300013308 Ga0157375_10013311 Ga0157375_100133115 385
377 3300014968 Ga0157379_10081465 Ga0157379_100814652 385
378 3300014969 Ga0157376_10206080 Ga0157376_102060802 385
379 3300017792 Ga0163161_10065327 Ga0163161_100653272 385
380 3300025321 Ga0207656_10009921 Ga0207656_100099215 385
381 3300025901 Ga0207688_10080902 Ga0207688_100809021 385
382 3300025906 Ga0207699_10117629 Ga0207699_101176292 385
383 3300025907 Ga0207645_10012919 Ga0207645_100129196 385
384 3300025908 Ga0207643_10001291 Ga0207643_100012916 385
385 3300025912 Ga0207707_10250039 Ga0207707_102500392 385
386 3300025919 Ga0207657_10022169 Ga0207657_100221696 385
387 3300025921 Ga0207652_10008433 Ga0207652_100084336 385
388 3300025927 Ga0207687_10004073 Ga0207687_100040739 385
389 3300025931 Ga0207644_10043180 Ga0207644_100431805 385
390 3300025933 Ga0207706_10199947 Ga0207706_101999472 385
391 3300025937 Ga0207669_10108246 Ga0207669_101082461 385
392 3300025940 Ga0207691_10077153 Ga0207691_100771535 385
393 3300025942 Ga0207689_10005718 Ga0207689_100057182 385
394 3300025944 Ga0207661_10000322 Ga0207661_100003229 385
395 3300025945 Ga0207679_10008244 Ga0207679_100082444 385
396 3300026035 Ga0207703_10040698 Ga0207703_100406985 385
397 3300026067 Ga0207678_10000416 Ga0207678_100004168 385
398 3300026078 Ga0207702_10004296 Ga0207702_100042965 385
399 3300026088 Ga0207641_10012736 Ga0207641_100127366 385
400 3300026095 Ga0207676_10001620 Ga0207676_100016205 385
401 3300026121 Ga0207683_10002172 Ga0207683_100021725 385
402 3300026121 Ga0207683_10058565 Ga0207683_100585653 385
403 3300026142 Ga0207698_10021543 Ga0207698_100215431 385
404 3300027866 Ga0209813_10008505 Ga0209813_100085052 385
405 3300028379 Ga0268266_10063913 Ga0268266_100639134 385
406 3300035691 Ga0373931_0070600 Ga0373931_0070600_597_1793 385
407 3300037466 Ga0395898_0114063 Ga0395898_0114063_1099_2295 385
408 3300048905 Ga0496102_0007714 Ga0496102_0007714_5302_6498 385
409 3300048909 Ga0496106_0025755 Ga0496106_0025755_3053_4249 385
410 3300048910 Ga0496107_0194044 Ga0496107_0194044_189_1385 385
411 3300048911 Ga0496108_0002092 Ga0496108_0002092_1632_2828 385
412 3300048913 Ga0496110_0001710 Ga0496110_0001710_3054_4250 385
413 3300048914 Ga0496111_0027854 Ga0496111_0027854_2725_3921 385
414 3300048918 Ga0496115_0024439 Ga0496115_0024439_553_1749 385
415 3300048927 Ga0496124_0021648 Ga0496124_0021648_3987_5213 385
416 3300049584 Ga0501068_0039698 Ga0501068_0039698_1318_2598 385
417 3300049586 Ga0501070_0016837 Ga0501070_0016837_1645_2862 385
418 3300049589 Ga0501073_0042469 Ga0501073_0042469_293_1564 385
419 3300050489 nmdc:mga03683_1096_c1 nmdc:mga03683_1096_c1_2941_4164 385
420 3300050490 nmdc:mga03n38_54106_c1 nmdc:mga03n38_54106_c1_399_1622 385
421 3300050490 nmdc:mga03n38_60099_c1 nmdc:mga03n38_60099_c1_394_1665 385
422 3300050491 nmdc:mga00v17_112387_c1 nmdc:mga00v17_112387_c1_325_1548 385
423 3300050491 nmdc:mga00v17_15668_c1 nmdc:mga00v17_15668_c1_2110_3381 385
424 3300050494 nmdc:mga06z11_28307_c1 nmdc:mga06z11_28307_c1_350_1573 385
425 3300050494 nmdc:mga06z11_49126_c1 nmdc:mga06z11_49126_c1_18_1289 385
426 3300050496 nmdc:mga07m45_6243_c1 nmdc:mga07m45_6243_c1_478_1701 385
427 3300050512 nmdc:mga0n895_1510_c1 nmdc:mga0n895_1510_c1_12724_13920 385
428 3300050513 nmdc:mga0rr50_8140_c1 nmdc:mga0rr50_8140_c1_175_1371 385
429 3300050514 nmdc:mga08x19_1123_c1 nmdc:mga08x19_1123_c1_13380_14576 385
430 3300050515 nmdc:mga0a205_139077_c1 nmdc:mga0a205_139077_c1_1087_2283 385
431 3300053088 Ga0500644_0000148 Ga0500644_0000148_24182_25459 385
432 3300005546 Ga0070696_100000187 Ga0070696_10000018727 386
433 3300006042 Ga0075368_10012620 Ga0075368_100126203 386
434 3300006051 Ga0075364_10069706 Ga0075364_100697061 386
435 3300006051 Ga0075364_10142430 Ga0075364_101424302 386
436 3300017792 Ga0163161_10038762 Ga0163161_100387621 386
437 3300025926 Ga0207659_10126699 Ga0207659_101266991 386
438 3300031824 Ga0307413_10036457 Ga0307413_100364573 386
439 3300031901 Ga0307406_10055646 Ga0307406_100556462 386
440 3300032005 Ga0307411_10167552 Ga0307411_101675522 386
441 3300032126 Ga0307415_100115291 Ga0307415_1001152912 386
442 3300032126 Ga0307415_100122492 Ga0307415_1001224921 386
443 3300037418 Ga0395900_0038298 Ga0395900_0038298_3415_4677 386
444 3300037466 Ga0395898_0048906 Ga0395898_0048906_2141_3403 386
445 3300044684 Ga0466966_0002490 Ga0466966_0002490_5784_7046 386
446 3300044693 Ga0466961_0009837 Ga0466961_0009837_2326_3588 386
447 3300044901 Ga0466960_0001139 Ga0466960_0001139_2781_4061 386
448 3300048909 Ga0496106_0078145 Ga0496106_0078145_212_1516 386
449 3300048913 Ga0496110_0134840 Ga0496110_0134840_603_1886 386
450 3300048917 Ga0496114_0093559 Ga0496114_0093559_1010_2272 386
451 3300049568 Ga0501031_0022032 Ga0501031_0022032_2261_3529 386
452 3300049568 Ga0501031_0045439 Ga0501031_0045439_1550_2830 386
453 3300049568 Ga0501031_0149218 Ga0501031_0149218_97_1305 386
454 3300049572 Ga0501036_0027020 Ga0501036_0027020_1086_2354 386
455 3300049574 Ga0501038_0024352 Ga0501038_0024352_3515_4783 386
456 3300049575 Ga0501039_0007274 Ga0501039_0007274_7139_8407 386
457 3300049575 Ga0501039_0045507 Ga0501039_0045507_828_2108 386
458 3300049577 Ga0501041_0004277 Ga0501041_0004277_5730_6998 386
459 3300049578 Ga0501042_0013394 Ga0501042_0013394_579_1847 386
460 3300049583 Ga0501067_0051515 Ga0501067_0051515_858_2093 386
461 3300049585 Ga0501069_0044902 Ga0501069_0044902_148_1452 386
462 3300049586 Ga0501070_0062211 Ga0501070_0062211_757_2046 386
463 3300049587 Ga0501071_0006405 Ga0501071_0006405_5808_7076 386
464 3300049588 Ga0501072_0031001 Ga0501072_0031001_578_1846 386
465 3300049590 Ga0501074_0038928 Ga0501074_0038928_812_2080 386
466 3300049741 Ga0501079_0086073 Ga0501079_0086073_715_1983 386
467 3300049744 Ga0501083_0030364 Ga0501083_0030364_1045_2313 386
468 3300049824 Ga0501045_0208047 Ga0501045_0208047_120_1400 386
469 3300050492 nmdc:mga0yw44_21088_c1 nmdc:mga0yw44_21088_c1_1801_3084 386
470 3300050492 nmdc:mga0yw44_84788_c1 nmdc:mga0yw44_84788_c1_338_1621 386
471 3300060353 Ga0501082_0008583 Ga0501082_0008583_6990_8258 386
472 iso_pu_bacteria 2855386786 2855388115 386
473 iso_pu_bacteria 2857481737 2857485688 386
474 3300005337 Ga0070682_100053194 Ga0070682_1000531942 387
475 3300005719 Ga0068861_100025987 Ga0068861_1000259871 387
476 3300005843 Ga0068860_100000935 Ga0068860_10000093519 387
477 3300006042 Ga0075368_10005875 Ga0075368_100058752 387
478 3300006048 Ga0075363_100006847 Ga0075363_1000068473 387
479 3300006051 Ga0075364_10027427 Ga0075364_100274273 387
480 3300006178 Ga0075367_10019671 Ga0075367_100196713 387
481 3300006178 Ga0075367_10062861 Ga0075367_100628612 387
482 3300006178 Ga0075367_10084204 Ga0075367_100842042 387
483 3300009148 Ga0105243_10065522 Ga0105243_100655222 387
484 3300013308 Ga0157375_10143980 Ga0157375_101439802 387
485 3300026075 Ga0207708_10117429 Ga0207708_101174291 387
486 3300027866 Ga0209813_10001675 Ga0209813_100016753 387
487 3300028381 Ga0268264_10000374 Ga0268264_1000037440 387
488 3300038443 Ga0395901_0061850 Ga0395901_0061850_1691_2983 387
489 3300045976 Ga0466967_0261850 Ga0466967_0261850_299_1567 387
490 3300048904 Ga0496101_0004132 Ga0496101_0004132_3063_4355 387
491 3300048904 Ga0496101_0108538 Ga0496101_0108538_820_2064 387
492 3300048906 Ga0496103_0023740 Ga0496103_0023740_2069_3361 387
493 3300048908 Ga0496105_0139123 Ga0496105_0139123_482_1756 387
494 3300048911 Ga0496108_0203550 Ga0496108_0203550_317_1546 387
495 3300048916 Ga0496113_0074448 Ga0496113_0074448_1058_2350 387
496 3300049583 Ga0501067_0006602 Ga0501067_0006602_1221_2513 387
497 3300050490 nmdc:mga03n38_3361_c1 nmdc:mga03n38_3361_c1_1861_3159 387
498 3300050494 nmdc:mga06z11_147909_c1 nmdc:mga06z11_147909_c1_19_1263 387
499 3300050494 nmdc:mga06z11_20507_c1 nmdc:mga06z11_20507_c1_1620_2918 387
500 3300050495 nmdc:mga04h51_3704_c1 nmdc:mga04h51_3704_c1_678_1976 387
501 3300050496 nmdc:mga07m45_102913_c1 nmdc:mga07m45_102913_c1_174_1418 387
502 iso_pu_bacteria 2643221681 2644455806 387
503 3300005367 Ga0070667_100064728 Ga0070667_1000647282 388
504 3300044693 Ga0466961_0117107 Ga0466961_0117107_202_1497 388
505 3300045976 Ga0466967_0311032 Ga0466967_0311032_57_1361 388
506 3300050492 nmdc:mga0yw44_4285_c1 nmdc:mga0yw44_4285_c1_1068_2282 388
507 3300053140 Ga0500573_0055242 Ga0500573_0055242_286_1545 388
508 3300013308 Ga0157375_10191074 Ga0157375_101910742 389
509 3300032002 Ga0307416_100029013 Ga0307416_1000290132 390
510 3300032126 Ga0307415_100000246 Ga0307415_1000002467 390
511 3300041491 Ga0451833_0309082 Ga0451833_0309082_885_2186 390
512 3300041494 Ga0451837_1325092 Ga0451837_1325092_1407_2708 390
513 3300041496 Ga0451839_0248974 Ga0451839_0248974_3419_4720 390
514 iso_pu_bacteria 2984576629 2984577694 390
515 iso_pu_bacteria 2990256926 2990260607 390
516 3300049571 Ga0501034_0087886 Ga0501034_0087886_425_1792 392
517 iso_pu_bacteria 2839986021 2839989613 392
518 iso_pu_bacteria 2932431166 2932432107 392
519 3300001979 JGI24740J21852_10014343 JGI24740J21852_100143433 397
520 3300001989 JGI24739J22299_10013514 JGI24739J22299_100135143 397
521 3300001990 JGI24737J22298_10000883 JGI24737J22298_100008838 397
522 3300005578 Ga0068854_100138037 Ga0068854_1001380372 397
523 3300025904 Ga0207647_10003470 Ga0207647_100034706 397
524 3300025986 Ga0207658_10199049 Ga0207658_101990492 397
525 3300026041 Ga0207639_10047826 Ga0207639_100478263 397
526 3300026116 Ga0207674_10139371 Ga0207674_101393713 397
527 3300026118 Ga0207675_100260127 Ga0207675_1002601272 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00425

Chorismate_bind

chorismate binding enzyme

222

474

0.98

PF01882

DUF58

Protein of unknown function DUF58

5

64

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3os6-assembly1.cif.gz_B crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8817 5 395
3os6-assembly2.cif.gz_C crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8794 5 395
3os6-assembly2.cif.gz_D crystal structure of putative 2,3-dihydroxybenzoate-specific isochorismate synthase, dhbc from bacillus anthracis. 0.8783 5 395
5jy8-assembly2.cif.gz_B an iron-bound structure of the isochorismate synthase entc 0.8738 9 394
5jy4-assembly2.cif.gz_B a high magnesium structure of the isochorismate synthase, entc 0.8698 13 394
ID Description Score Start End Superfamily
af_P9WFW9_3_372_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8942 12 395 3.60.120.10
3os6D00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8735 5 395 3.60.120.10
5jy8A00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8656 14 395 3.60.120.10
af_P9WFW9_3_372_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8637 12 395 3.60.120.10
3os6D00 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.8528 5 395 3.60.120.10
ID Description Score Start End GO Terms
AF-A0A7H4N506-F1-model_v4 Isochorismate synthase (EC 5.4.4.2) 0.9849 197 328 GO:0008909
GO:0009058
AF-A0A6N6XHZ1-F1-model_v4 deleted 0.9762 213 343
AF-A0A6J6I096-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.9738 196 395 GO:0008909
GO:0009697
AF-A0A645HDC1-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.9731 197 395 GO:0008909
GO:0009058
AF-A0A1G7MP23-F1-model_v4 isochorismate synthase (EC 5.4.4.2) (Isochorismate mutase) 0.973 18 395 GO:0008909
GO:0009058

Feature Viewer

pLDDT pTM Quality
94.45 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map