F459579

General Info

Members Datasets Scaffolds Average Seq Length
527 264 1054 271

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0097827|Ga0466967_0097827_1501_2355
Length 284
Sequence MAGRGTGADFVEALARGLDVLAAFDRDRPRMSLTEIATATSLARPTARRLLLTLQELGFVRAEDGVFTLTPQVLRLGVAYVGSLGLWDVARPHMEDLVRQTGESSSMSQLDGSDIVYVARVAVPKIITLRVDIGTRFPALFTSQGKVLLAALPPDRVDEVLAEPSRSGLPQALPRSRAQVEEELRGVRARGWALADEELAPGVRSVAAPVRDGAGVVRAAMNVTVHAAETSVDTLVEKYLPLLLRTTGEVSADWALWQARPHLEIDAATGADRGPAQDAGSAAG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
173 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
261 2643221641 Nocardioides sp. Root122 Isolate Unclassified
262 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
263 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
264 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0.38
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 17.27
Rhizosphere 77.99
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0097827 3300045976 Bacteria 2679
2 JGI24737J22298_10006123 3300001990 Bacteria 4121
3 JGI24744J21845_10001848 3300002077 Bacteria 4253
4 JGI24751J29686_10003502 3300002459 Bacteria 3162
5 Ga0070658_10052506 3300005327 Bacteria 3306
6 Ga0070683_100004405 3300005329 Bacteria 11596
7 Ga0070683_100015382 3300005329 Bacteria 6719
8 Ga0070683_100148306 3300005329 Bacteria 2224
9 Ga0070683_100340465 3300005329 Bacteria 1428
10 Ga0068869_100003051 3300005334 Bacteria 10187
11 Ga0068869_100133783 3300005334 Bacteria 1908
12 Ga0070682_100003421 3300005337 Bacteria 8800
13 Ga0070682_100007731 3300005337 Bacteria 6056
14 Ga0070682_100012327 3300005337 Bacteria 4900
15 Ga0070682_100052519 3300005337 Bacteria 2551
16 Ga0068868_100124167 3300005338 Bacteria 2107
17 Ga0070660_100019835 3300005339 Bacteria 4933
18 Ga0070660_100193258 3300005339 Bacteria 1649
19 Ga0070689_100010182 3300005340 Bacteria 6697
20 Ga0070691_10019515 3300005341 Bacteria 3129
21 Ga0070691_10114157 3300005341 Bacteria 1354
22 Ga0070661_100025318 3300005344 Bacteria 4263
23 Ga0070692_10095479 3300005345 Bacteria 1622
24 Ga0070692_10172251 3300005345 Bacteria 1248
25 Ga0070692_10194137 3300005345 Bacteria 1185
26 Ga0070668_100396209 3300005347 Bacteria 1178
27 Ga0070675_100030718 3300005354 Bacteria 4338
28 Ga0070675_100118197 3300005354 Bacteria 2251
29 Ga0070671_100000500 3300005355 Bacteria 27402
30 Ga0070674_100033255 3300005356 Bacteria 3431
31 Ga0070673_100034058 3300005364 Bacteria 3850
32 Ga0070673_100055377 3300005364 Bacteria 3125
33 Ga0070688_100118932 3300005365 Bacteria 1767
34 Ga0070659_100033750 3300005366 Bacteria 3977
35 Ga0070659_100153436 3300005366 Bacteria 1880
36 Ga0070659_100167751 3300005366 Bacteria 1797
37 Ga0070667_100117012 3300005367 Bacteria 2315
38 Ga0070667_100210080 3300005367 Bacteria 1730
39 Ga0070709_10032058 3300005434 Bacteria 3166
40 Ga0070714_100322000 3300005435 Bacteria 1446
41 Ga0070714_100458525 3300005435 Bacteria 1211
42 Ga0070713_100122489 3300005436 Bacteria 2283
43 Ga0070701_10001503 3300005438 Bacteria 8636
44 Ga0070711_100041920 3300005439 Bacteria 3092
45 Ga0070700_100002449 3300005441 Bacteria 9444
46 Ga0070700_100109683 3300005441 Bacteria 1832
47 Ga0070663_100000959 3300005455 Bacteria 15673
48 Ga0070663_100010358 3300005455 Bacteria 5812
49 Ga0070663_100066178 3300005455 Bacteria 2618
50 Ga0070678_100003702 3300005456 Bacteria 8553
51 Ga0070678_100484697 3300005456 Bacteria 1089
52 Ga0070662_100231528 3300005457 Bacteria 1478
53 Ga0068867_100005539 3300005459 Bacteria 8941
54 Ga0070698_100495708 3300005471 Bacteria 1159
55 Ga0070679_100356949 3300005530 Bacteria 1409
56 Ga0070684_100005458 3300005535 Bacteria 9741
57 Ga0070684_100050238 3300005535 Bacteria 3621
58 Ga0070684_100077063 3300005535 Bacteria 2944
59 Ga0070684_100619659 3300005535 Bacteria 1007
60 Ga0070684_100680160 3300005535 Bacteria 959
61 Ga0068853_100002683 3300005539 Bacteria 13413
62 Ga0068853_100408684 3300005539 Bacteria 1271
63 Ga0070672_100025298 3300005543 Bacteria 4400
64 Ga0070686_100077742 3300005544 Bacteria 2189
65 Ga0070696_100149518 3300005546 Bacteria 1713
66 Ga0070693_100000559 3300005547 Bacteria 16472
67 Ga0070693_100090032 3300005547 Bacteria 1848
68 Ga0070665_100057310 3300005548 Bacteria 3906
69 Ga0070665_100317722 3300005548 Bacteria 1561
70 Ga0070665_100695240 3300005548 Bacteria 1030
71 Ga0068855_100021296 3300005563 Bacteria 7773
72 Ga0070664_100712768 3300005564 Unclassified 935
73 Ga0068857_100026735 3300005577 Bacteria 5087
74 Ga0068857_100271006 3300005577 Bacteria 1560
75 Ga0068854_100220062 3300005578 Bacteria 1502
76 Ga0068856_100016943 3300005614 Bacteria 7061
77 Ga0068856_100078646 3300005614 Bacteria 3270
78 Ga0068856_100084600 3300005614 Bacteria 3151
79 Ga0068856_100271123 3300005614 Bacteria 1713
80 Ga0070702_100027279 3300005615 Bacteria 3079
81 Ga0068852_100083660 3300005616 Bacteria 2838
82 Ga0068852_100338176 3300005616 Bacteria 1466
83 Ga0068859_100006559 3300005617 Bacteria 11812
84 Ga0068864_100005607 3300005618 Bacteria 10293
85 Ga0068864_100099020 3300005618 Bacteria 2583
86 Ga0068866_10069456 3300005718 Bacteria 1856
87 Ga0068861_100045617 3300005719 Bacteria 3302
88 Ga0068861_100084795 3300005719 Bacteria 2488
89 Ga0068870_10000046 3300005840 Bacteria 37945
90 Ga0068870_10006890 3300005840 Bacteria 5041
91 Ga0068863_100001184 3300005841 Bacteria 26079
92 Ga0068863_100004060 3300005841 Bacteria 14453
93 Ga0068863_100309570 3300005841 Bacteria 1533
94 Ga0068862_100564219 3300005844 Bacteria 1089
95 Ga0081455_10004519 3300005937 Bacteria 15540
96 Ga0081455_10009149 3300005937 Bacteria 10215
97 Ga0081455_10127091 3300005937 Bacteria 1999
98 Ga0081539_10003079 3300005985 Bacteria 21456
99 Ga0081539_10010950 3300005985 Bacteria 7273
100 Ga0075365_10010786 3300006038 Bacteria 5342
101 Ga0075365_10170940 3300006038 Bacteria 1517
102 Ga0075368_10027040 3300006042 Bacteria 2210
103 Ga0075363_100114926 3300006048 Bacteria 1498
104 Ga0075364_10154724 3300006051 Bacteria 1546
105 Ga0075432_10022999 3300006058 Bacteria 2134
106 Ga0075367_10177059 3300006178 Bacteria 1329
107 Ga0075367_10206316 3300006178 Bacteria 1228
108 Ga0097621_100108606 3300006237 Bacteria 2342
109 Ga0068871_100027250 3300006358 Bacteria 4467
110 Ga0075428_100217305 3300006844 Bacteria 2064
111 Ga0075431_100129402 3300006847 Bacteria 2605
112 Ga0075433_10004150 3300006852 Bacteria 11245
113 Ga0075434_100009359 3300006871 Bacteria 9132
114 Ga0068865_100159231 3300006881 Bacteria 1720
115 Ga0068865_100369249 3300006881 Bacteria 1167
116 Ga0075436_100001360 3300006914 Bacteria 16635
117 Ga0097620_100006559 3300006931 Bacteria 11812
118 Ga0075435_100000781 3300007076 Bacteria 19788
119 Ga0105244_10011342 3300009036 Bacteria 5355
120 Ga0111539_10019753 3300009094 Bacteria 8309
121 Ga0111539_10088275 3300009094 Bacteria 3643
122 Ga0111539_10831519 3300009094 Bacteria 1074
123 Ga0105245_10002794 3300009098 Bacteria 15708
124 Ga0105245_10016355 3300009098 Bacteria 6469
125 Ga0105245_10018530 3300009098 Bacteria 6088
126 Ga0105245_10285555 3300009098 Bacteria 1614
127 Ga0105245_10300332 3300009098 Bacteria 1575
128 Ga0105245_10326109 3300009098 Bacteria 1514
129 Ga0105245_10999363 3300009098 Bacteria 881
130 Ga0105247_10006988 3300009101 Bacteria 6946
131 Ga0114129_10456072 3300009147 Bacteria 1676
132 Ga0114129_11160907 3300009147 Bacteria 964
133 Ga0105243_10026729 3300009148 Bacteria 4419
134 Ga0105243_10031577 3300009148 Bacteria 4084
135 Ga0105243_10065650 3300009148 Bacteria 2916
136 Ga0105243_10121317 3300009148 Bacteria 2204
137 Ga0105243_10356903 3300009148 Bacteria 1344
138 Ga0105241_10001138 3300009174 Bacteria 20247
139 Ga0105242_10443140 3300009176 Bacteria 1222
140 Ga0105248_10190266 3300009177 Bacteria 2312
141 Ga0105248_10239005 3300009177 Bacteria 2045
142 Ga0105237_10077080 3300009545 Bacteria 3324
143 Ga0105237_10108950 3300009545 Bacteria 2761
144 Ga0105238_10088789 3300009551 Bacteria 3077
145 Ga0105238_10342768 3300009551 Bacteria 1483
146 Ga0105238_10374096 3300009551 Bacteria 1415
147 Ga0105249_10038197 3300009553 Bacteria 4356
148 Ga0105249_10078558 3300009553 Bacteria 3062
149 Ga0105239_10003258 3300010375 Bacteria 20035
150 Ga0105239_10004863 3300010375 Bacteria 15896
151 Ga0105239_10021506 3300010375 Bacteria 7112
152 Ga0105239_10533560 3300010375 Bacteria 1336
153 Ga0105246_10000960 3300011119 Bacteria 16495
154 Ga0105246_10001859 3300011119 Bacteria 12702
155 Ga0105246_10011037 3300011119 Bacteria 5599
156 Ga0105246_10290340 3300011119 Bacteria 1315
157 Ga0157371_10006528 3300013102 Bacteria 9599
158 Ga0157369_10037024 3300013105 Bacteria 5344
159 Ga0157374_10030847 3300013296 Bacteria 4869
160 Ga0157378_10230928 3300013297 Bacteria 1763
161 Ga0163162_11530511 3300013306 Bacteria 760
162 Ga0157372_10047643 3300013307 Bacteria 4763
163 Ga0157372_10128522 3300013307 Bacteria 2914
164 Ga0157372_10174539 3300013307 Bacteria 2487
165 Ga0157372_10429118 3300013307 Bacteria 1540
166 Ga0157372_10491015 3300013307 Bacteria 1432
167 Ga0157375_10045447 3300013308 Bacteria 4274
168 Ga0157375_10247219 3300013308 Bacteria 1944
169 Ga0157375_10374074 3300013308 Bacteria 1591
170 Ga0157375_10768617 3300013308 Bacteria 1114
171 Ga0163163_10062641 3300014325 Bacteria 3686
172 Ga0163163_10064568 3300014325 Bacteria 3632
173 Ga0163163_10222447 3300014325 Bacteria 1936
174 Ga0163163_10242226 3300014325 Bacteria 1853
175 Ga0163163_10402555 3300014325 Bacteria 1427
176 Ga0163163_10417084 3300014325 Bacteria 1401
177 Ga0163163_10772093 3300014325 Bacteria 1024
178 Ga0157380_10006487 3300014326 Bacteria 8246
179 Ga0157380_10044591 3300014326 Bacteria 3476
180 Ga0157380_10146778 3300014326 Bacteria 2034
181 Ga0182008_10016607 3300014497 Bacteria 3824
182 Ga0182008_10042895 3300014497 Bacteria 2253
183 Ga0182008_10091580 3300014497 Bacteria 1499
184 Ga0182008_10182336 3300014497 Bacteria 1063
185 Ga0182008_10208128 3300014497 Bacteria 997
186 Ga0157377_10026773 3300014745 Bacteria 3090
187 Ga0157377_10136614 3300014745 Bacteria 1503
188 Ga0157379_10027601 3300014968 Bacteria 5055
189 Ga0157379_10147801 3300014968 Bacteria 2119
190 Ga0157376_10065343 3300014969 Bacteria 3071
191 Ga0157376_10232429 3300014969 Bacteria 1713
192 Ga0163161_10009067 3300017792 Bacteria 6882
193 Ga0163161_10224483 3300017792 Bacteria 1456
194 Ga0206356_10765520 3300020070 Bacteria 4364
195 Ga0206354_10821825 3300020081 Bacteria 1926
196 Ga0213875_10000802 3300021388 Bacteria 23498
197 Ga0207710_10005475 3300025900 Bacteria 5462
198 Ga0207688_10000497 3300025901 Bacteria 18879
199 Ga0207688_10004516 3300025901 Bacteria 7575
200 Ga0207647_10013462 3300025904 Bacteria 5668
201 Ga0207647_10058391 3300025904 Bacteria 2363
202 Ga0207699_10030070 3300025906 Bacteria 3036
203 Ga0207645_10019803 3300025907 Bacteria 4407
204 Ga0207643_10000125 3300025908 Bacteria 53016
205 Ga0207643_10003939 3300025908 Bacteria 7988
206 Ga0207643_10282135 3300025908 Bacteria 1030
207 Ga0207654_10019938 3300025911 Bacteria 3546
208 Ga0207693_10091319 3300025915 Bacteria 2387
209 Ga0207663_10318973 3300025916 Bacteria 1167
210 Ga0207657_10007162 3300025919 Bacteria 11456
211 Ga0207657_10033475 3300025919 Bacteria 4632
212 Ga0207657_10132605 3300025919 Bacteria 2041
213 Ga0207649_10361633 3300025920 Bacteria 1077
214 Ga0207652_10005377 3300025921 Bacteria 10388
215 Ga0207652_10129941 3300025921 Bacteria 2246
216 Ga0207694_10077538 3300025924 Bacteria 2604
217 Ga0207694_10428466 3300025924 Bacteria 1103
218 Ga0207650_10009379 3300025925 Bacteria 6687
219 Ga0207659_10083048 3300025926 Bacteria 2374
220 Ga0207659_10141669 3300025926 Bacteria 1867
221 Ga0207687_10007445 3300025927 Bacteria 7207
222 Ga0207687_10024556 3300025927 Bacteria 4028
223 Ga0207687_10174721 3300025927 Bacteria 1660
224 Ga0207687_10312215 3300025927 Bacteria 1270
225 Ga0207687_10664700 3300025927 Bacteria 882
226 Ga0207700_10098061 3300025928 Bacteria 2330
227 Ga0207644_10004830 3300025931 Bacteria 8773
228 Ga0207690_10086564 3300025932 Bacteria 2202
229 Ga0207690_10421274 3300025932 Bacteria 1068
230 Ga0207706_10001073 3300025933 Bacteria 27771
231 Ga0207706_10058448 3300025933 Bacteria 3396
232 Ga0207670_10026390 3300025936 Bacteria 3659
233 Ga0207669_10068201 3300025937 Bacteria 2220
234 Ga0207669_10101052 3300025937 Bacteria 1907
235 Ga0207704_10034818 3300025938 Bacteria 2878
236 Ga0207704_10326354 3300025938 Bacteria 1186
237 Ga0207691_10012232 3300025940 Bacteria 8226
238 Ga0207691_10036424 3300025940 Bacteria 4558
239 Ga0207689_10000198 3300025942 Bacteria 53018
240 Ga0207661_10008340 3300025944 Bacteria 7398
241 Ga0207661_10018692 3300025944 Bacteria 5153
242 Ga0207661_10031925 3300025944 Bacteria 4074
243 Ga0207661_10253916 3300025944 Bacteria 1564
244 Ga0207661_10372861 3300025944 Bacteria 1291
245 Ga0207679_10003694 3300025945 Bacteria 9486
246 Ga0207679_10237985 3300025945 Bacteria 1541
247 Ga0207679_10527416 3300025945 Bacteria 1057
248 Ga0207651_10138664 3300025960 Bacteria 1875
249 Ga0207651_10263736 3300025960 Bacteria 1416
250 Ga0207712_10571484 3300025961 Bacteria 975
251 Ga0207668_10354682 3300025972 Bacteria 1227
252 Ga0207640_10134653 3300025981 Bacteria 1792
253 Ga0207658_10061441 3300025986 Bacteria 2808
254 Ga0207658_10306056 3300025986 Bacteria 1371
255 Ga0207658_10388310 3300025986 Bacteria 1224
256 Ga0207677_10002285 3300026023 Bacteria 10066
257 Ga0207677_10103893 3300026023 Bacteria 2099
258 Ga0207703_10020158 3300026035 Bacteria 5212
259 Ga0207703_10165911 3300026035 Bacteria 1938
260 Ga0207639_10080434 3300026041 Bacteria 2577
261 Ga0207678_10000446 3300026067 Bacteria 37601
262 Ga0207678_10001386 3300026067 Bacteria 22310
263 Ga0207678_10086486 3300026067 Bacteria 2679
264 Ga0207708_10003120 3300026075 Bacteria 12196
265 Ga0207708_10013615 3300026075 Bacteria 6078
266 Ga0207702_10000481 3300026078 Bacteria 44873
267 Ga0207702_10052967 3300026078 Bacteria 3435
268 Ga0207702_10109253 3300026078 Bacteria 2455
269 Ga0207641_10015824 3300026088 Bacteria 6178
270 Ga0207641_10508731 3300026088 Bacteria 1170
271 Ga0207648_10005677 3300026089 Bacteria 12520
272 Ga0207676_10000324 3300026095 Bacteria 41140
273 Ga0207676_10294868 3300026095 Bacteria 1478
274 Ga0207674_10040630 3300026116 Bacteria 4817
275 Ga0207674_10375828 3300026116 Bacteria 1373
276 Ga0207675_100029712 3300026118 Bacteria 5090
277 Ga0207675_100460159 3300026118 Bacteria 1262
278 Ga0207683_10000172 3300026121 Bacteria 55979
279 Ga0207683_10066105 3300026121 Bacteria 3188
280 Ga0207683_10177131 3300026121 Bacteria 1933
281 Ga0207698_10002027 3300026142 Bacteria 11943
282 Ga0207698_10422258 3300026142 Bacteria 1280
283 Ga0207698_10755396 3300026142 Bacteria 972
284 Ga0209813_10033158 3300027866 Bacteria 1534
285 Ga0207428_10007700 3300027907 Bacteria 9800
286 Ga0268266_10054204 3300028379 Bacteria 3446
287 Ga0268266_10541207 3300028379 Bacteria 1115
288 Ga0268265_10398642 3300028380 Bacteria 1271
289 Ga0307517_10161484 3300028786 Bacteria 1502
290 Ga0307408_100527850 3300031548 Bacteria 1038
291 Ga0316575_10000679 3300031665 Bacteria 10118
292 Ga0316579_10018528 3300031691 Bacteria 3065
293 Ga0316576_10069819 3300031727 Bacteria 2590
294 Ga0316576_10105488 3300031727 Bacteria 2109
295 Ga0316578_10000081 3300031728 Bacteria 21609
296 Ga0316578_10077513 3300031728 Bacteria 1973
297 Ga0307405_10072349 3300031731 Bacteria 2222
298 Ga0316577_10012665 3300031733 Bacteria 4599
299 Ga0307413_10091201 3300031824 Bacteria 1985
300 Ga0307410_10021543 3300031852 Bacteria 3967
301 Ga0307410_10131837 3300031852 Bacteria 1837
302 Ga0307410_10244730 3300031852 Bacteria 1392
303 Ga0307410_10665780 3300031852 Bacteria 874
304 Ga0307406_10116480 3300031901 Bacteria 1849
305 Ga0307406_10154264 3300031901 Bacteria 1642
306 Ga0307406_10171698 3300031901 Bacteria 1570
307 Ga0307407_10009036 3300031903 Bacteria 4617
308 Ga0307407_10196953 3300031903 Bacteria 1347
309 Ga0307412_10240151 3300031911 Bacteria 1401
310 Ga0307409_100021474 3300031995 Bacteria 4427
311 Ga0307409_100044491 3300031995 Bacteria 3344
312 Ga0307409_100106534 3300031995 Bacteria 2340
313 Ga0307409_100168032 3300031995 Bacteria 1927
314 Ga0307409_100339164 3300031995 Bacteria 1413
315 Ga0307409_100346806 3300031995 Bacteria 1399
316 Ga0307409_100902885 3300031995 Bacteria 897
317 Ga0307416_100002229 3300032002 Bacteria 11029
318 Ga0307416_100023569 3300032002 Bacteria 4469
319 Ga0307416_100181412 3300032002 Bacteria 1974
320 Ga0307416_100225049 3300032002 Bacteria 1803
321 Ga0307416_100536983 3300032002 Bacteria 1240
322 Ga0307414_10132763 3300032004 Bacteria 1936
323 Ga0307414_10423698 3300032004 Bacteria 1161
324 Ga0307411_10368690 3300032005 Bacteria 1177
325 Ga0307415_100000404 3300032126 Bacteria 18403
326 Ga0307415_100046119 3300032126 Bacteria 2926
327 Ga0307415_100054223 3300032126 Bacteria 2735
328 Ga0307415_100077654 3300032126 Bacteria 2358
329 Ga0307415_100500369 3300032126 Bacteria 1062
330 Ga0307415_100726423 3300032126 Bacteria 899
331 Ga0316585_10013308 3300032137 Bacteria 2447
332 Ga0316580_10003246 3300032139 Bacteria 4597
333 Ga0316574_0003038 3300035398 Bacteria 8555
334 Ga0316574_0012225 3300035398 Bacteria 4906
335 Ga0316582_0000615 3300036647 Bacteria 13869
336 Ga0316582_0002495 3300036647 Bacteria 8668
337 Ga0316582_0394178 3300036647 Bacteria 954
338 Ga0316584_0001718 3300036712 Bacteria 13426
339 Ga0316584_0032546 3300036712 Bacteria 3859
340 Ga0395898_0140583 3300037466 Bacteria 2311
341 Ga0436364_0141456 3300037853 Bacteria 107449
342 Ga0395901_0002530 3300038443 Bacteria 18531
343 Ga0395901_0438893 3300038443 Bacteria 1337
344 Ga0451789_0128986 3300041443 Bacteria 1716
345 Ga0451789_0398056 3300041443 Bacteria 2884
346 Ga0451791_0141654 3300041451 Bacteria 6475
347 Ga0451791_0374616 3300041451 Bacteria 2010
348 Ga0451793_0934301 3300041452 Bacteria 39444
349 Ga0451793_1160377 3300041452 Bacteria 1189
350 Ga0451797_0038411 3300041453 Bacteria 1856
351 Ga0451797_0654696 3300041453 Bacteria 1053
352 Ga0451802_1693759 3300041460 Bacteria 2905
353 Ga0451807_0462477 3300041486 Bacteria 801
354 Ga0451833_0532434 3300041491 Bacteria 1560
355 Ga0451839_0968946 3300041496 Bacteria 1671
356 Ga0451839_1640158 3300041496 Bacteria 2432
357 Ga0451841_0563244 3300041498 Bacteria 1513
358 Ga0451843_0583516 3300041509 Bacteria 2994
359 Ga0451853_0112927 3300041512 Bacteria 4994
360 Ga0439448_0001333 3300042005 Bacteria 6316
361 Ga0439464_0004084 3300042439 Bacteria 3713
362 Ga0466969_0194574 3300044656 Bacteria 926
363 Ga0466965_0076622 3300044683 Bacteria 1688
364 Ga0466965_0148877 3300044683 Bacteria 1223
365 Ga0466963_0048657 3300044694 Bacteria 2802
366 Ga0466963_0107227 3300044694 Bacteria 1916
367 Ga0466963_0431843 3300044694 Bacteria 929
368 Ga0466964_0032253 3300044706 Bacteria 2081
369 Ga0466970_0058791 3300044765 Bacteria 2058
370 Ga0466957_0020076 3300044842 Bacteria 3933
371 Ga0466957_0248865 3300044842 Bacteria 1181
372 Ga0451576_0153933 3300045051 Bacteria 2398
373 Ga0466967_0005341 3300045976 Bacteria 8878
374 Ga0466967_0015666 3300045976 Bacteria 5952
375 Ga0466967_0041266 3300045976 Bacteria 3977
376 Ga0466967_0065642 3300045976 Bacteria 3231
377 Ga0466967_0154405 3300045976 Bacteria 2149
378 Ga0466967_0295408 3300045976 Bacteria 1557
379 Ga0466967_0837751 3300045976 Bacteria 914
380 Ga0495629_0184530 3300046459 Bacteria 1445
381 Ga0495629_0234043 3300046459 Bacteria 1266
382 Ga0495629_0402019 3300046459 Bacteria 931
383 Ga0495651_0007647 3300046462 Bacteria 8261
384 Ga0495653_0184248 3300046463 Bacteria 1430
385 Ga0495662_0029140 3300046476 Bacteria 2666
386 Ga0495664_0100818 3300046477 Bacteria 1740
387 Ga0495664_0364401 3300046477 Bacteria 870
388 Ga0495594_0295261 3300046499 Bacteria 923
389 Ga0495628_0275600 3300046516 Bacteria 1250
390 Ga0495587_0059077 3300046536 Bacteria 2252
391 Ga0495667_0151504 3300046559 Bacteria 1493
392 Ga0495656_0134399 3300046615 Bacteria 1180
393 Ga0495656_0158962 3300046615 Bacteria 1097
394 Ga0495625_0243797 3300046660 Bacteria 1169
395 Ga0495658_0068598 3300046683 Bacteria 2054
396 Ga0495658_0276493 3300046683 Bacteria 1059
397 Ga0495581_0218313 3300047315 Bacteria 1115
398 Ga0495604_0280085 3300047317 Bacteria 1127
399 Ga0496100_0066097 3300048903 Bacteria 2398
400 Ga0496100_0445794 3300048903 Bacteria 992
401 Ga0496101_0042364 3300048904 Bacteria 3249
402 Ga0496101_0072866 3300048904 Bacteria 2522
403 Ga0496101_0090885 3300048904 Bacteria 2271
404 Ga0496101_0225058 3300048904 Bacteria 1457
405 Ga0496102_0008906 3300048905 Bacteria 8613
406 Ga0496102_0038378 3300048905 Bacteria 4322
407 Ga0496102_0153076 3300048905 Bacteria 2168
408 Ga0496102_0164619 3300048905 Bacteria 2087
409 Ga0496102_0191237 3300048905 Bacteria 1928
410 Ga0496102_0330438 3300048905 Bacteria 1436
411 Ga0496103_0021785 3300048906 Bacteria 3857
412 Ga0496103_0206120 3300048906 Bacteria 1264
413 Ga0496104_0002088 3300048907 Bacteria 17340
414 Ga0496104_0009170 3300048907 Bacteria 8800
415 Ga0496104_0068027 3300048907 Bacteria 3384
416 Ga0496104_0081044 3300048907 Bacteria 3094
417 Ga0496104_0128568 3300048907 Bacteria 2433
418 Ga0496104_0136550 3300048907 Bacteria 2356
419 Ga0496104_0343400 3300048907 Bacteria 1406
420 Ga0496105_0001206 3300048908 Bacteria 18015
421 Ga0496105_0022189 3300048908 Bacteria 5141
422 Ga0496105_0059339 3300048908 Bacteria 3157
423 Ga0496105_0295373 3300048908 Bacteria 1304
424 Ga0496106_0001804 3300048909 Bacteria 16003
425 Ga0496106_0056437 3300048909 Bacteria 2968
426 Ga0496107_0015056 3300048910 Bacteria 5418
427 Ga0496107_0027342 3300048910 Bacteria 4050
428 Ga0496107_0118964 3300048910 Bacteria 1945
429 Ga0496108_0002714 3300048911 Bacteria 14144
430 Ga0496108_0008208 3300048911 Bacteria 8474
431 Ga0496108_0039932 3300048911 Bacteria 3911
432 Ga0496108_0145834 3300048911 Bacteria 2041
433 Ga0496108_0172543 3300048911 Bacteria 1871
434 Ga0496108_0186485 3300048911 Bacteria 1797
435 Ga0496108_0203571 3300048911 Bacteria 1718
436 Ga0496108_0268492 3300048911 Bacteria 1485
437 Ga0496109_0005206 3300048912 Bacteria 10864
438 Ga0496109_0011319 3300048912 Bacteria 7662
439 Ga0496109_0014971 3300048912 Bacteria 6751
440 Ga0496109_0039000 3300048912 Bacteria 4298
441 Ga0496109_0042145 3300048912 Bacteria 4134
442 Ga0496109_0060458 3300048912 Bacteria 3462
443 Ga0496109_0071137 3300048912 Bacteria 3193
444 Ga0496109_0174183 3300048912 Bacteria 2019
445 Ga0496109_0177054 3300048912 Bacteria 2002
446 Ga0496109_0248990 3300048912 Bacteria 1673
447 Ga0496109_0260885 3300048912 Bacteria 1632
448 Ga0496109_0288952 3300048912 Bacteria 1546
449 Ga0496109_0390227 3300048912 Bacteria 1315
450 Ga0496109_0572650 3300048912 Bacteria 1065
451 Ga0496110_0000572 3300048913 Bacteria 25251
452 Ga0496110_0002864 3300048913 Bacteria 13026
453 Ga0496110_0017340 3300048913 Bacteria 6024
454 Ga0496110_0070957 3300048913 Bacteria 3087
455 Ga0496110_0248113 3300048913 Bacteria 1620
456 Ga0496110_0522644 3300048913 Bacteria 1080
457 Ga0496111_0002783 3300048914 Bacteria 10648
458 Ga0496111_0019094 3300048914 Bacteria 4756
459 Ga0496112_0027626 3300048915 Bacteria 5471
460 Ga0496112_0080155 3300048915 Bacteria 3228
461 Ga0496112_0089822 3300048915 Bacteria 3040
462 Ga0496112_0201994 3300048915 Bacteria 1947
463 Ga0496113_0009713 3300048916 Bacteria 6321
464 Ga0496113_0028285 3300048916 Bacteria 4030
465 Ga0496113_0175964 3300048916 Bacteria 1696
466 Ga0496113_0176631 3300048916 Bacteria 1692
467 Ga0496113_0319609 3300048916 Bacteria 1244
468 Ga0496114_0009544 3300048917 Bacteria 7700
469 Ga0496114_0017960 3300048917 Bacteria 5716
470 Ga0496114_0028074 3300048917 Bacteria 4615
471 Ga0496114_0029467 3300048917 Bacteria 4512
472 Ga0496114_0051449 3300048917 Bacteria 3429
473 Ga0496114_0177145 3300048917 Bacteria 1861
474 Ga0496114_0180498 3300048917 Bacteria 1843
475 Ga0496114_0293805 3300048917 Bacteria 1434
476 Ga0496114_0398582 3300048917 Bacteria 1218
477 Ga0496115_0011008 3300048918 Bacteria 6774
478 Ga0496115_0032386 3300048918 Bacteria 4124
479 Ga0496115_0047580 3300048918 Bacteria 3430
480 Ga0501034_0018894 3300049571 Bacteria 7060
481 Ga0501034_0140363 3300049571 Bacteria 2396
482 Ga0501036_0026524 3300049572 Bacteria 4891
483 Ga0501036_0524541 3300049572 Bacteria 985
484 Ga0501037_0017463 3300049573 Bacteria 5281
485 Ga0501038_0006196 3300049574 Bacteria 11063
486 Ga0501039_0013063 3300049575 Bacteria 6349
487 Ga0501040_0405933 3300049576 Bacteria 979
488 Ga0501043_0011728 3300049579 Bacteria 6862
489 Ga0501047_0010445 3300049581 Bacteria 8787
490 Ga0501047_0104857 3300049581 Bacteria 2707
491 Ga0501048_0011498 3300049582 Bacteria 6601
492 Ga0501048_0455080 3300049582 Bacteria 917
493 Ga0501067_0003844 3300049583 Bacteria 8293
494 Ga0501067_0082162 3300049583 Bacteria 1786
495 Ga0501069_0028183 3300049585 Bacteria 3079
496 Ga0501069_0033391 3300049585 Bacteria 2835
497 Ga0501070_0032251 3300049586 Bacteria 4384
498 Ga0501071_0041523 3300049587 Bacteria 3294
499 Ga0501073_0005785 3300049589 Bacteria 9241
500 Ga0501073_0134108 3300049589 Bacteria 1716
501 Ga0501074_0001898 3300049590 Bacteria 14352
502 Ga0501074_0006226 3300049590 Bacteria 8612
503 Ga0501080_0006178 3300049742 Bacteria 10749
504 Ga0501080_0203030 3300049742 Bacteria 1819
505 Ga0501081_0190650 3300049743 Bacteria 1484
506 Ga0501083_0145211 3300049744 Bacteria 1553
507 Ga0501044_0049838 3300049823 Bacteria 4322
508 Ga0501044_0313465 3300049823 Bacteria 1495
509 nmdc:mga03n38_152501_c1 3300050490 Bacteria 1164
510 nmdc:mga03n38_2746_c1 3300050490 Bacteria 5516
511 nmdc:mga0yw44_10204_c1 3300050492 Bacteria 4788
512 nmdc:mga04h51_10821_c1 3300050495 Bacteria 2517
513 nmdc:mga08y16_3829_c1 3300050511 Bacteria 15653
514 nmdc:mga0n895_4325_c1 3300050512 Bacteria 11644
515 nmdc:mga0a205_6794_c1 3300050515 Bacteria 10353
516 Ga0495595_0117839 3300053084 Bacteria 1292
517 Ga0495619_0128038 3300053085 Bacteria 1744
518 Ga0495619_0264322 3300053085 Bacteria 1192
519 Ga0500646_0000148 3300053090 Bacteria 20583
520 Ga0500588_0000940 3300053146 Bacteria 5166
521 Ga0466962_0122586 3300061719 Bacteria 1254
522 2623501006 2622736605 Bacteria 4992138
523 2623501026 2622736605 Bacteria 4992138
524 2644229512 2643221641 Bacteria 4490190
525 2816421868 2816332119 Bacteria 8120218
526 8016256971 8016254467 Bacteria 3797036
527 8047711944 8047710418 Bacteria 11023148
528 Ga0466967_0097827
529 JGI24737J22298_10006123
530 JGI24744J21845_10001848
531 JGI24751J29686_10003502
532 Ga0070658_10052506
533 Ga0070683_100004405
534 Ga0070683_100015382
535 Ga0070683_100148306
536 Ga0070683_100340465
537 Ga0068869_100003051
538 Ga0068869_100133783
539 Ga0070682_100003421
540 Ga0070682_100007731
541 Ga0070682_100012327
542 Ga0070682_100052519
543 Ga0068868_100124167
544 Ga0070660_100019835
545 Ga0070660_100193258
546 Ga0070689_100010182
547 Ga0070691_10019515
548 Ga0070691_10114157
549 Ga0070661_100025318
550 Ga0070692_10095479
551 Ga0070692_10172251
552 Ga0070692_10194137
553 Ga0070668_100396209
554 Ga0070675_100030718
555 Ga0070675_100118197
556 Ga0070671_100000500
557 Ga0070674_100033255
558 Ga0070673_100034058
559 Ga0070673_100055377
560 Ga0070688_100118932
561 Ga0070659_100033750
562 Ga0070659_100153436
563 Ga0070659_100167751
564 Ga0070667_100117012
565 Ga0070667_100210080
566 Ga0070709_10032058
567 Ga0070714_100322000
568 Ga0070714_100458525
569 Ga0070713_100122489
570 Ga0070701_10001503
571 Ga0070711_100041920
572 Ga0070700_100002449
573 Ga0070700_100109683
574 Ga0070663_100000959
575 Ga0070663_100010358
576 Ga0070663_100066178
577 Ga0070678_100003702
578 Ga0070678_100484697
579 Ga0070662_100231528
580 Ga0068867_100005539
581 Ga0070698_100495708
582 Ga0070679_100356949
583 Ga0070684_100005458
584 Ga0070684_100050238
585 Ga0070684_100077063
586 Ga0070684_100619659
587 Ga0070684_100680160
588 Ga0068853_100002683
589 Ga0068853_100408684
590 Ga0070672_100025298
591 Ga0070686_100077742
592 Ga0070696_100149518
593 Ga0070693_100000559
594 Ga0070693_100090032
595 Ga0070665_100057310
596 Ga0070665_100317722
597 Ga0070665_100695240
598 Ga0068855_100021296
599 Ga0070664_100712768
600 Ga0068857_100026735
601 Ga0068857_100271006
602 Ga0068854_100220062
603 Ga0068856_100016943
604 Ga0068856_100078646
605 Ga0068856_100084600
606 Ga0068856_100271123
607 Ga0070702_100027279
608 Ga0068852_100083660
609 Ga0068852_100338176
610 Ga0068859_100006559
611 Ga0068864_100005607
612 Ga0068864_100099020
613 Ga0068866_10069456
614 Ga0068861_100045617
615 Ga0068861_100084795
616 Ga0068870_10000046
617 Ga0068870_10006890
618 Ga0068863_100001184
619 Ga0068863_100004060
620 Ga0068863_100309570
621 Ga0068862_100564219
622 Ga0081455_10004519
623 Ga0081455_10009149
624 Ga0081455_10127091
625 Ga0081539_10003079
626 Ga0081539_10010950
627 Ga0075365_10010786
628 Ga0075365_10170940
629 Ga0075368_10027040
630 Ga0075363_100114926
631 Ga0075364_10154724
632 Ga0075432_10022999
633 Ga0075367_10177059
634 Ga0075367_10206316
635 Ga0097621_100108606
636 Ga0068871_100027250
637 Ga0075428_100217305
638 Ga0075431_100129402
639 Ga0075433_10004150
640 Ga0075434_100009359
641 Ga0068865_100159231
642 Ga0068865_100369249
643 Ga0075436_100001360
644 Ga0097620_100006559
645 Ga0075435_100000781
646 Ga0105244_10011342
647 Ga0111539_10019753
648 Ga0111539_10088275
649 Ga0111539_10831519
650 Ga0105245_10002794
651 Ga0105245_10016355
652 Ga0105245_10018530
653 Ga0105245_10285555
654 Ga0105245_10300332
655 Ga0105245_10326109
656 Ga0105245_10999363
657 Ga0105247_10006988
658 Ga0114129_10456072
659 Ga0114129_11160907
660 Ga0105243_10026729
661 Ga0105243_10031577
662 Ga0105243_10065650
663 Ga0105243_10121317
664 Ga0105243_10356903
665 Ga0105241_10001138
666 Ga0105242_10443140
667 Ga0105248_10190266
668 Ga0105248_10239005
669 Ga0105237_10077080
670 Ga0105237_10108950
671 Ga0105238_10088789
672 Ga0105238_10342768
673 Ga0105238_10374096
674 Ga0105249_10038197
675 Ga0105249_10078558
676 Ga0105239_10003258
677 Ga0105239_10004863
678 Ga0105239_10021506
679 Ga0105239_10533560
680 Ga0105246_10000960
681 Ga0105246_10001859
682 Ga0105246_10011037
683 Ga0105246_10290340
684 Ga0157371_10006528
685 Ga0157369_10037024
686 Ga0157374_10030847
687 Ga0157378_10230928
688 Ga0163162_11530511
689 Ga0157372_10047643
690 Ga0157372_10128522
691 Ga0157372_10174539
692 Ga0157372_10429118
693 Ga0157372_10491015
694 Ga0157375_10045447
695 Ga0157375_10247219
696 Ga0157375_10374074
697 Ga0157375_10768617
698 Ga0163163_10062641
699 Ga0163163_10064568
700 Ga0163163_10222447
701 Ga0163163_10242226
702 Ga0163163_10402555
703 Ga0163163_10417084
704 Ga0163163_10772093
705 Ga0157380_10006487
706 Ga0157380_10044591
707 Ga0157380_10146778
708 Ga0182008_10016607
709 Ga0182008_10042895
710 Ga0182008_10091580
711 Ga0182008_10182336
712 Ga0182008_10208128
713 Ga0157377_10026773
714 Ga0157377_10136614
715 Ga0157379_10027601
716 Ga0157379_10147801
717 Ga0157376_10065343
718 Ga0157376_10232429
719 Ga0163161_10009067
720 Ga0163161_10224483
721 Ga0206356_10765520
722 Ga0206354_10821825
723 Ga0213875_10000802
724 Ga0207710_10005475
725 Ga0207688_10000497
726 Ga0207688_10004516
727 Ga0207647_10013462
728 Ga0207647_10058391
729 Ga0207699_10030070
730 Ga0207645_10019803
731 Ga0207643_10000125
732 Ga0207643_10003939
733 Ga0207643_10282135
734 Ga0207654_10019938
735 Ga0207693_10091319
736 Ga0207663_10318973
737 Ga0207657_10007162
738 Ga0207657_10033475
739 Ga0207657_10132605
740 Ga0207649_10361633
741 Ga0207652_10005377
742 Ga0207652_10129941
743 Ga0207694_10077538
744 Ga0207694_10428466
745 Ga0207650_10009379
746 Ga0207659_10083048
747 Ga0207659_10141669
748 Ga0207687_10007445
749 Ga0207687_10024556
750 Ga0207687_10174721
751 Ga0207687_10312215
752 Ga0207687_10664700
753 Ga0207700_10098061
754 Ga0207644_10004830
755 Ga0207690_10086564
756 Ga0207690_10421274
757 Ga0207706_10001073
758 Ga0207706_10058448
759 Ga0207670_10026390
760 Ga0207669_10068201
761 Ga0207669_10101052
762 Ga0207704_10034818
763 Ga0207704_10326354
764 Ga0207691_10012232
765 Ga0207691_10036424
766 Ga0207689_10000198
767 Ga0207661_10008340
768 Ga0207661_10018692
769 Ga0207661_10031925
770 Ga0207661_10253916
771 Ga0207661_10372861
772 Ga0207679_10003694
773 Ga0207679_10237985
774 Ga0207679_10527416
775 Ga0207651_10138664
776 Ga0207651_10263736
777 Ga0207712_10571484
778 Ga0207668_10354682
779 Ga0207640_10134653
780 Ga0207658_10061441
781 Ga0207658_10306056
782 Ga0207658_10388310
783 Ga0207677_10002285
784 Ga0207677_10103893
785 Ga0207703_10020158
786 Ga0207703_10165911
787 Ga0207639_10080434
788 Ga0207678_10000446
789 Ga0207678_10001386
790 Ga0207678_10086486
791 Ga0207708_10003120
792 Ga0207708_10013615
793 Ga0207702_10000481
794 Ga0207702_10052967
795 Ga0207702_10109253
796 Ga0207641_10015824
797 Ga0207641_10508731
798 Ga0207648_10005677
799 Ga0207676_10000324
800 Ga0207676_10294868
801 Ga0207674_10040630
802 Ga0207674_10375828
803 Ga0207675_100029712
804 Ga0207675_100460159
805 Ga0207683_10000172
806 Ga0207683_10066105
807 Ga0207683_10177131
808 Ga0207698_10002027
809 Ga0207698_10422258
810 Ga0207698_10755396
811 Ga0209813_10033158
812 Ga0207428_10007700
813 Ga0268266_10054204
814 Ga0268266_10541207
815 Ga0268265_10398642
816 Ga0307517_10161484
817 Ga0307408_100527850
818 Ga0316575_10000679
819 Ga0316579_10018528
820 Ga0316576_10069819
821 Ga0316576_10105488
822 Ga0316578_10000081
823 Ga0316578_10077513
824 Ga0307405_10072349
825 Ga0316577_10012665
826 Ga0307413_10091201
827 Ga0307410_10021543
828 Ga0307410_10131837
829 Ga0307410_10244730
830 Ga0307410_10665780
831 Ga0307406_10116480
832 Ga0307406_10154264
833 Ga0307406_10171698
834 Ga0307407_10009036
835 Ga0307407_10196953
836 Ga0307412_10240151
837 Ga0307409_100021474
838 Ga0307409_100044491
839 Ga0307409_100106534
840 Ga0307409_100168032
841 Ga0307409_100339164
842 Ga0307409_100346806
843 Ga0307409_100902885
844 Ga0307416_100002229
845 Ga0307416_100023569
846 Ga0307416_100181412
847 Ga0307416_100225049
848 Ga0307416_100536983
849 Ga0307414_10132763
850 Ga0307414_10423698
851 Ga0307411_10368690
852 Ga0307415_100000404
853 Ga0307415_100046119
854 Ga0307415_100054223
855 Ga0307415_100077654
856 Ga0307415_100500369
857 Ga0307415_100726423
858 Ga0316585_10013308
859 Ga0316580_10003246
860 Ga0316574_0003038
861 Ga0316574_0012225
862 Ga0316582_0000615
863 Ga0316582_0002495
864 Ga0316582_0394178
865 Ga0316584_0001718
866 Ga0316584_0032546
867 Ga0395898_0140583
868 Ga0436364_0141456
869 Ga0395901_0002530
870 Ga0395901_0438893
871 Ga0451789_0128986
872 Ga0451789_0398056
873 Ga0451791_0141654
874 Ga0451791_0374616
875 Ga0451793_0934301
876 Ga0451793_1160377
877 Ga0451797_0038411
878 Ga0451797_0654696
879 Ga0451802_1693759
880 Ga0451807_0462477
881 Ga0451833_0532434
882 Ga0451839_0968946
883 Ga0451839_1640158
884 Ga0451841_0563244
885 Ga0451843_0583516
886 Ga0451853_0112927
887 Ga0439448_0001333
888 Ga0439464_0004084
889 Ga0466969_0194574
890 Ga0466965_0076622
891 Ga0466965_0148877
892 Ga0466963_0048657
893 Ga0466963_0107227
894 Ga0466963_0431843
895 Ga0466964_0032253
896 Ga0466970_0058791
897 Ga0466957_0020076
898 Ga0466957_0248865
899 Ga0451576_0153933
900 Ga0466967_0005341
901 Ga0466967_0015666
902 Ga0466967_0041266
903 Ga0466967_0065642
904 Ga0466967_0154405
905 Ga0466967_0295408
906 Ga0466967_0837751
907 Ga0495629_0184530
908 Ga0495629_0234043
909 Ga0495629_0402019
910 Ga0495651_0007647
911 Ga0495653_0184248
912 Ga0495662_0029140
913 Ga0495664_0100818
914 Ga0495664_0364401
915 Ga0495594_0295261
916 Ga0495628_0275600
917 Ga0495587_0059077
918 Ga0495667_0151504
919 Ga0495656_0134399
920 Ga0495656_0158962
921 Ga0495625_0243797
922 Ga0495658_0068598
923 Ga0495658_0276493
924 Ga0495581_0218313
925 Ga0495604_0280085
926 Ga0496100_0066097
927 Ga0496100_0445794
928 Ga0496101_0042364
929 Ga0496101_0072866
930 Ga0496101_0090885
931 Ga0496101_0225058
932 Ga0496102_0008906
933 Ga0496102_0038378
934 Ga0496102_0153076
935 Ga0496102_0164619
936 Ga0496102_0191237
937 Ga0496102_0330438
938 Ga0496103_0021785
939 Ga0496103_0206120
940 Ga0496104_0002088
941 Ga0496104_0009170
942 Ga0496104_0068027
943 Ga0496104_0081044
944 Ga0496104_0128568
945 Ga0496104_0136550
946 Ga0496104_0343400
947 Ga0496105_0001206
948 Ga0496105_0022189
949 Ga0496105_0059339
950 Ga0496105_0295373
951 Ga0496106_0001804
952 Ga0496106_0056437
953 Ga0496107_0015056
954 Ga0496107_0027342
955 Ga0496107_0118964
956 Ga0496108_0002714
957 Ga0496108_0008208
958 Ga0496108_0039932
959 Ga0496108_0145834
960 Ga0496108_0172543
961 Ga0496108_0186485
962 Ga0496108_0203571
963 Ga0496108_0268492
964 Ga0496109_0005206
965 Ga0496109_0011319
966 Ga0496109_0014971
967 Ga0496109_0039000
968 Ga0496109_0042145
969 Ga0496109_0060458
970 Ga0496109_0071137
971 Ga0496109_0174183
972 Ga0496109_0177054
973 Ga0496109_0248990
974 Ga0496109_0260885
975 Ga0496109_0288952
976 Ga0496109_0390227
977 Ga0496109_0572650
978 Ga0496110_0000572
979 Ga0496110_0002864
980 Ga0496110_0017340
981 Ga0496110_0070957
982 Ga0496110_0248113
983 Ga0496110_0522644
984 Ga0496111_0002783
985 Ga0496111_0019094
986 Ga0496112_0027626
987 Ga0496112_0080155
988 Ga0496112_0089822
989 Ga0496112_0201994
990 Ga0496113_0009713
991 Ga0496113_0028285
992 Ga0496113_0175964
993 Ga0496113_0176631
994 Ga0496113_0319609
995 Ga0496114_0009544
996 Ga0496114_0017960
997 Ga0496114_0028074
998 Ga0496114_0029467
999 Ga0496114_0051449
1000 Ga0496114_0177145
1001 Ga0496114_0180498
1002 Ga0496114_0293805
1003 Ga0496114_0398582
1004 Ga0496115_0011008
1005 Ga0496115_0032386
1006 Ga0496115_0047580
1007 Ga0501034_0018894
1008 Ga0501034_0140363
1009 Ga0501036_0026524
1010 Ga0501036_0524541
1011 Ga0501037_0017463
1012 Ga0501038_0006196
1013 Ga0501039_0013063
1014 Ga0501040_0405933
1015 Ga0501043_0011728
1016 Ga0501047_0010445
1017 Ga0501047_0104857
1018 Ga0501048_0011498
1019 Ga0501048_0455080
1020 Ga0501067_0003844
1021 Ga0501067_0082162
1022 Ga0501069_0028183
1023 Ga0501069_0033391
1024 Ga0501070_0032251
1025 Ga0501071_0041523
1026 Ga0501073_0005785
1027 Ga0501073_0134108
1028 Ga0501074_0001898
1029 Ga0501074_0006226
1030 Ga0501080_0006178
1031 Ga0501080_0203030
1032 Ga0501081_0190650
1033 Ga0501083_0145211
1034 Ga0501044_0049838
1035 Ga0501044_0313465
1036 nmdc:mga03n38_152501_c1
1037 nmdc:mga03n38_2746_c1
1038 nmdc:mga0yw44_10204_c1
1039 nmdc:mga04h51_10821_c1
1040 nmdc:mga08y16_3829_c1
1041 nmdc:mga0n895_4325_c1
1042 nmdc:mga0a205_6794_c1
1043 Ga0495595_0117839
1044 Ga0495619_0128038
1045 Ga0495619_0264322
1046 Ga0500646_0000148
1047 Ga0500588_0000940
1048 Ga0466962_0122586
1049 2623501006
1050 2623501026
1051 2644229512
1052 2816421868
1053 8016256971
1054 8047711944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

13

64

0.97

PF01614

IclR

Bacterial transcriptional regulator

78

252

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ysp-assembly1.cif.gz_A crystal structure of the c-terminal domain of e. coli transcriptional regulator kdgr. 0.9185 85 255
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9057 12 70
1ysp-assembly1.cif.gz_A crystal structure of the c-terminal domain of e. coli transcriptional regulator kdgr. 0.9024 85 255
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8938 14 70
5hpi-assembly4.cif.gz_D crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter 0.8877 86 251
ID Description Score Start End Superfamily
2ia2D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9673 12 70 1.10.10.10
2ia2C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9661 12 70 1.10.10.10
3r4kD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9596 13 71 1.10.10.10
2g7uD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9485 12 70 1.10.10.10
2ia2B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9437 12 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4U9WHM4-F1-model_v4 Pectin degradation repressor protein kdgR 0.9065 96 255 GO:0003677
GO:0003700
GO:0045892
AF-H2K4J8-F1-model_v4 deleted 0.9 86 251
AF-X1EUD4-F1-model_v4 IclR-ED domain-containing protein 0.8876 90 255 GO:0003677
GO:0003700
GO:0045892
AF-A0A6C7Z857-F1-model_v4 deleted 0.881 87 226
AF-A0A353ZUB9-F1-model_v4 IclR family transcriptional regulator 0.8784 119 257 GO:0003677
GO:0003700
GO:0045892

Map