F459606

General Info

Members Datasets Scaffolds Average Seq Length
527 399 1054 189

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874123672|2874130263
Length 222
Sequence SGDLSRASQEQWLKLYYFARTAFSAVWMAAAFTVGQHSWVIAAVLLVAYPAWDALANFVDASRSGGLGQNRTQTINVVVSVATTLAVVLALEMSMNWVLGVFGVWAILSGLFQLGTAVRRWKSYGAQWAMVLSGGQSALAGTFFIVQARMPMPPSITDVAGYAAVGAFYFLVSAVWLSVSQLRRKGAYARHLKPSPIRSEMLSAASVGSPIYRQNRTTHPCP

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
47 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
74 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
75 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
87 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
88 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
190 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
191 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
194 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
195 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
200 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
201 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
207 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
208 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
209 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
210 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
213 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
214 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
215 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
216 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
217 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
218 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
219 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
220 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
221 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
222 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
223 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
224 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
225 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
226 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
227 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
228 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
229 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
230 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
231 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
232 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
233 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
234 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
235 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
236 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
237 2738541297 Duganella sp. GV083 Isolate Unclassified
238 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
239 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
240 2738541357 Duganella sp. GV053 Isolate Unclassified
241 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
242 2738543003 Duganella sp. GV066 Isolate Unclassified
243 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
244 2738543026 Duganella sp. GV089 Isolate Unclassified
245 2738543029 Duganella sp. GV039 Isolate Unclassified
246 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
247 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
248 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
249 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
250 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
251 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
252 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
253 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
254 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
255 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
256 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
257 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
258 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
259 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
260 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
261 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
262 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
263 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
264 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
265 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
266 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
267 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
268 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
269 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
270 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
271 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
272 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
273 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
274 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
275 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
276 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
277 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
278 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
279 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
280 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
281 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
282 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
283 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
284 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
285 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
286 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
287 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
288 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
289 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
290 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
291 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
292 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
293 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
294 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
295 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
296 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
297 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
298 2904424332 Duganella sp. 1411 Isolate Rhizosphere
299 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
300 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
301 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
302 2922368715
303 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
304 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
305 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
306 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
307 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
308 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
309 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
310 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
311 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
312 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
313 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
314 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
315 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
316 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
317 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
318 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
319 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
320 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
321 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
322 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
323 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
324 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
325 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
326 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
327 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
328 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
329 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
330 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
331 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
332 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
333 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
334 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
335 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
336 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
337 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
338 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
339 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
340 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
341 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
342 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
343 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
344 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
345 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
346 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
347 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
348 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
349 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
350 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
351 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
352 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
353 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
354 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
355 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
356 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
357 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
358 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
359 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
360 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
361 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
362 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
363 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
364 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
365 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
366 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
367 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
368 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
369 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
370 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
371 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
372 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
373 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
374 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
375 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
376 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
377 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
378 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
379 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
380 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
381 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
382 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
383 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
384 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
385 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
386 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
387 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
388 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
389 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
390 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
391 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
392 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
393 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
394 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
395 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
396 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
397 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
398 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
399 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.21
Metatranscriptomes 0
Isolates 34.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.94
Nodule 24.29
Rhizoplane 3.98
Rhizosphere 37.57
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10071679 3300001989 Bacteria 1077
2 JGI24738J21930_10042331 3300002075 Bacteria 925
3 JGI25159J45721_1008033 3300002987 Bacteria 2946
4 JGI25151J46595_10000180 3300003187 Bacteria 79747
5 JGI25153J46596_10000142 3300003215 Bacteria 73162
6 JGI25153J46596_10006956 3300003215 Bacteria 5634
7 rootL2_10088555 3300003322 Bacteria 2652
8 rootL2_10107321 3300003322 Bacteria 1601
9 rootH1_10036249 3300003323 Bacteria 1389
10 JGI25160J50197_1001119 3300003354 Bacteria 13683
11 JGI25160J50197_1006072 3300003354 Bacteria 4931
12 Ga0055526_1051263 3300003771 Bacteria 940
13 Ga0055543_1002266 3300004625 Bacteria 6508
14 Ga0055543_1039784 3300004625 Bacteria 796
15 Ga0065165_1000348 3300005262 Bacteria 75762
16 Ga0065165_1001016 3300005262 Bacteria 34080
17 Ga0065165_1008800 3300005262 Bacteria 4650
18 Ga0065165_1040475 3300005262 Bacteria 1390
19 Ga0065165_1062163 3300005262 Bacteria 1019
20 Ga0070658_10026837 3300005327 Bacteria 4624
21 Ga0068869_100526831 3300005334 Bacteria 990
22 Ga0070660_100095076 3300005339 Bacteria 2355
23 Ga0070668_100102503 3300005347 Bacteria 2269
24 Ga0070668_100353304 3300005347 Bacteria 1244
25 Ga0070669_100126535 3300005353 Bacteria 1956
26 Ga0070703_10034883 3300005406 Bacteria 1538
27 Ga0070701_10450595 3300005438 Bacteria 826
28 Ga0070663_100068544 3300005455 Bacteria 2575
29 Ga0070663_100469444 3300005455 Bacteria 1040
30 Ga0070662_100163697 3300005457 Bacteria 1741
31 Ga0070698_100262309 3300005471 Bacteria 1660
32 Ga0070699_100080668 3300005518 Bacteria 2835
33 Ga0070695_100593123 3300005545 Bacteria 869
34 Ga0070696_100088943 3300005546 Bacteria 2196
35 Ga0070693_100743343 3300005547 Bacteria 722
36 Ga0070665_100928414 3300005548 Bacteria 883
37 Ga0070665_100941732 3300005548 Bacteria 876
38 Ga0068855_101065285 3300005563 Bacteria 847
39 Ga0070664_100366606 3300005564 Bacteria 1312
40 Ga0068854_100389704 3300005578 Bacteria 1150
41 Ga0068856_100658495 3300005614 Bacteria 1068
42 Ga0068861_100499392 3300005719 Bacteria 1099
43 Ga0068858_100317092 3300005842 Bacteria 1489
44 Ga0068860_100048358 3300005843 Bacteria 4053
45 Ga0068862_100369123 3300005844 Bacteria 1335
46 Ga0075365_10041812 3300006038 Bacteria 2995
47 Ga0075367_10187609 3300006178 Bacteria 1290
48 Ga0075369_10005593 3300006186 Bacteria 4706
49 Ga0075369_10070768 3300006186 Bacteria 1535
50 Ga0099795_10132671 3300007788 Bacteria 1006
51 Ga0105240_10567507 3300009093 Bacteria 1253
52 Ga0105243_10174797 3300009148 Bacteria 1863
53 Ga0105241_10615499 3300009174 Bacteria 983
54 Ga0105242_10164944 3300009176 Bacteria 1943
55 Ga0105248_10469633 3300009177 Bacteria 1418
56 Ga0105237_10064318 3300009545 Bacteria 3665
57 Ga0105237_10099698 3300009545 Bacteria 2896
58 Ga0105238_10147813 3300009551 Bacteria 2326
59 Ga0105238_10304659 3300009551 Bacteria 1577
60 Ga0105147_104316 3300009982 Bacteria 1193
61 Ga0105033_102961 3300009986 Bacteria 1417
62 Ga0105239_10014915 3300010375 Bacteria 8614
63 Ga0105239_10342766 3300010375 Bacteria 1687
64 Ga0105239_10813189 3300010375 Bacteria 1071
65 Ga0105239_11001658 3300010375 Bacteria 961
66 Ga0157369_10154487 3300013105 Bacteria 2425
67 Ga0157374_10170602 3300013296 Bacteria 2122
68 Ga0163162_10190657 3300013306 Bacteria 2177
69 Ga0163163_10185657 3300014325 Bacteria 2127
70 Ga0182008_10039085 3300014497 Bacteria 2372
71 Ga0157379_10389910 3300014968 Bacteria 1279
72 Ga0157376_10293025 3300014969 Bacteria 1537
73 Ga0183361_10007 3300016635 Bacteria 339575
74 Ga0209233_1003572 3300025261 Bacteria 5461
75 Ga0209233_1061186 3300025261 Bacteria 726
76 Ga0209130_1002055 3300025284 Bacteria 10906
77 Ga0209025_1000422 3300025294 Bacteria 84434
78 Ga0209564_1004271 3300025295 Bacteria 8858
79 Ga0209758_1000138 3300025297 Bacteria 175187
80 Ga0209758_1000321 3300025297 Bacteria 92591
81 Ga0209758_1005688 3300025297 Bacteria 9422
82 Ga0209256_1009095 3300025299 Bacteria 4428
83 Ga0209256_1031963 3300025299 Bacteria 1432
84 Ga0207426_1000133 3300025302 Bacteria 206783
85 Ga0207426_1000278 3300025302 Bacteria 105775
86 Ga0207426_1000822 3300025302 Bacteria 33249
87 Ga0207426_1067034 3300025302 Bacteria 1013
88 Ga0209257_1017915 3300025304 Bacteria 2758
89 Ga0207647_10011969 3300025904 Bacteria 6056
90 Ga0207647_10295620 3300025904 Bacteria 923
91 Ga0207705_10221154 3300025909 Unclassified 1438
92 Ga0207657_10284508 3300025919 Bacteria 1312
93 Ga0207690_10123961 3300025932 Bacteria 1881
94 Ga0207711_10490502 3300025941 Bacteria 1145
95 Ga0207679_10554783 3300025945 Bacteria 1031
96 Ga0207639_10805434 3300026041 Bacteria 875
97 Ga0207678_10228577 3300026067 Bacteria 1593
98 Ga0207678_11004340 3300026067 Bacteria 738
99 Ga0209389_1000201 3300027296 Bacteria 42938
100 Ga0209489_100035 3300027361 Bacteria 168255
101 Ga0209700_100005 3300027363 Bacteria 573969
102 Ga0268266_10415026 3300028379 Bacteria 1275
103 Ga0268266_10742458 3300028379 Bacteria 947
104 Ga0307509_10283635 3300031507 Bacteria 1416
105 Ga0307412_10000002 3300031911 Bacteria 743446
106 Ga0307412_10294953 3300031911 Bacteria 1279
107 Ga0307414_10901215 3300032004 Bacteria 811
108 Ga0307510_10394007 3300033180 Bacteria 828
109 Ga0395898_0669642 3300037466 Bacteria 980
110 Ga0395905_0000157 3300037471 Bacteria 112004
111 Ga0395905_0001027 3300037471 Bacteria 35582
112 Ga0395905_0456530 3300037471 Bacteria 1176
113 Ga0395901_0657042 3300038443 Bacteria 1051
114 Ga0451793_1401622 3300041452 Bacteria 690
115 Ga0451800_0613205 3300041459 Bacteria 1019
116 Ga0451835_1213202 3300041492 Bacteria 1083
117 Ga0451839_0570097 3300041496 Bacteria 1413
118 Ga0451845_0211355 3300041501 Bacteria 1319
119 Ga0466972_0169529 3300044658 Bacteria 1025
120 Ga0466968_0323623 3300044735 Bacteria 745
121 Ga0466960_0180357 3300044901 Bacteria 1144
122 Ga0495617_000007 3300046452 Bacteria 369986
123 Ga0495590_0007134 3300046457 Bacteria 4324
124 Ga0495590_0059244 3300046457 Bacteria 1339
125 Ga0495629_0164472 3300046459 Bacteria 1541
126 Ga0495638_0073642 3300046460 Bacteria 2084
127 Ga0495653_0000042 3300046463 Bacteria 117284
128 Ga0495653_0587161 3300046463 Bacteria 686
129 Ga0495650_0000696 3300046471 Bacteria 43354
130 Ga0495650_0006886 3300046471 Bacteria 6979
131 Ga0495650_0050826 3300046471 Bacteria 1711
132 Ga0495580_0295511 3300046472 Bacteria 1103
133 Ga0495582_0130946 3300046473 Bacteria 1417
134 Ga0495605_0017887 3300046474 Bacteria 3807
135 Ga0495605_0020582 3300046474 Bacteria 3505
136 Ga0495605_0134830 3300046474 Bacteria 1111
137 Ga0495605_0274593 3300046474 Bacteria 717
138 Ga0495639_0067288 3300046475 Bacteria 1650
139 Ga0495664_0079832 3300046477 Bacteria 1961
140 Ga0495664_0233249 3300046477 Bacteria 1113
141 Ga0495584_0330854 3300046491 Bacteria 774
142 Ga0495585_0001154 3300046492 Bacteria 21551
143 Ga0495596_0050435 3300046500 Bacteria 1631
144 Ga0495607_0000386 3300046501 Bacteria 45031
145 Ga0495583_0010278 3300046506 Bacteria 5478
146 Ga0495583_0042271 3300046506 Bacteria 2129
147 Ga0495583_0131011 3300046506 Bacteria 1049
148 Ga0495606_0000576 3300046507 Bacteria 58266
149 Ga0495606_0002371 3300046507 Bacteria 22116
150 Ga0495606_0017070 3300046507 Bacteria 5505
151 Ga0495606_0037668 3300046507 Bacteria 3282
152 Ga0495606_0122102 3300046507 Bacteria 1558
153 Ga0495606_0340484 3300046507 Bacteria 799
154 Ga0495610_0000004 3300046512 Bacteria 1006135
155 Ga0495610_0000364 3300046512 Bacteria 47361
156 Ga0495610_0019720 3300046512 Bacteria 3762
157 Ga0495618_0330985 3300046514 Bacteria 942
158 Ga0495620_0086467 3300046515 Bacteria 1262
159 Ga0495628_0238432 3300046516 Bacteria 1361
160 Ga0495630_0133269 3300046517 Bacteria 1887
161 Ga0495643_0023945 3300046522 Bacteria 3466
162 Ga0495643_0084437 3300046522 Bacteria 1648
163 Ga0495643_0199531 3300046522 Bacteria 961
164 Ga0495648_0015781 3300046524 Bacteria 5464
165 Ga0495648_0016293 3300046524 Bacteria 5364
166 Ga0495648_0023456 3300046524 Bacteria 4224
167 Ga0495648_0271236 3300046524 Bacteria 809
168 Ga0495666_0019426 3300046526 Bacteria 3372
169 Ga0495642_0027050 3300046528 Bacteria 2281
170 Ga0495652_0227282 3300046529 Bacteria 1398
171 Ga0495654_0009448 3300046530 Bacteria 5344
172 Ga0495665_0052749 3300046531 Bacteria 2152
173 Ga0495640_0063068 3300046533 Bacteria 2512
174 Ga0495587_0352744 3300046536 Unclassified 820
175 Ga0495622_0030484 3300046557 Bacteria 2520
176 Ga0495622_0049748 3300046557 Bacteria 1946
177 Ga0495633_0007540 3300046558 Bacteria 6247
178 Ga0495668_0001787 3300046616 Bacteria 19644
179 Ga0495668_0120161 3300046616 Bacteria 1437
180 Ga0495668_0128910 3300046616 Bacteria 1385
181 Ga0495611_0053313 3300046648 Bacteria 1825
182 Ga0495611_0059372 3300046648 Bacteria 1736
183 Ga0495625_0026624 3300046660 Bacteria 4367
184 Ga0495625_0032489 3300046660 Bacteria 3868
185 Ga0495625_0106428 3300046660 Bacteria 1921
186 Ga0495625_0335849 3300046660 Bacteria 959
187 Ga0495661_0104982 3300046665 Bacteria 1583
188 Ga0495588_0247658 3300046674 Bacteria 940
189 Ga0495657_0064011 3300046675 Bacteria 2424
190 Ga0495669_0230532 3300046684 Bacteria 888
191 Ga0495624_0005430 3300046690 Bacteria 9182
192 Ga0495671_0000070 3300046692 Bacteria 97889
193 Ga0495671_0041751 3300046692 Bacteria 2308
194 Ga0495671_0088368 3300046692 Bacteria 1517
195 Ga0495649_0087368 3300046694 Bacteria 1664
196 Ga0495649_0256267 3300046694 Bacteria 897
197 Ga0495649_0377258 3300046694 Bacteria 714
198 Ga0495589_0084152 3300046794 Bacteria 1546
199 Ga0495600_0084144 3300046809 Bacteria 2076
200 Ga0495660_0018498 3300046810 Bacteria 4007
201 Ga0495604_0149553 3300047317 Bacteria 1660
202 Ga0495674_0007958 3300047319 Bacteria 10119
203 Ga0495674_0125849 3300047319 Bacteria 2163
204 Ga0495672_0098901 3300047320 Bacteria 1586
205 Ga0495676_0043265 3300047321 Bacteria 3689
206 Ga0495683_0003040 3300047323 Bacteria 9861
207 Ga0495683_0035864 3300047323 Bacteria 2520
208 Ga0495683_0090829 3300047323 Bacteria 1479
209 Ga0495683_0179792 3300047323 Bacteria 967
210 Ga0495687_024389 3300047443 Bacteria 2875
211 Ga0495687_114396 3300047443 Bacteria 985
212 Ga0495687_143160 3300047443 Bacteria 828
213 Ga0495679_000273 3300047446 Bacteria 43168
214 Ga0495679_002837 3300047446 Bacteria 8587
215 Ga0495679_024523 3300047446 Bacteria 2030
216 Ga0495673_0000017 3300047469 Bacteria 574970
217 Ga0495673_0000027 3300047469 Bacteria 475440
218 Ga0495673_0027075 3300047469 Bacteria 2732
219 Ga0495673_0059570 3300047469 Bacteria 1641
220 Ga0495673_0081506 3300047469 Bacteria 1340
221 Ga0495684_0392767 3300047471 Bacteria 976
222 Ga0495686_0000110 3300047472 Bacteria 169827
223 Ga0495686_0021897 3300047472 Bacteria 4235
224 Ga0495686_0087838 3300047472 Bacteria 1891
225 Ga0495686_0163663 3300047472 Bacteria 1298
226 Ga0495686_0167207 3300047472 Bacteria 1281
227 Ga0495593_0024135 3300047673 Bacteria 3373
228 Ga0495593_0368711 3300047673 Bacteria 718
229 Ga0495602_0169151 3300048088 Bacteria 1698
230 Ga0495614_0089497 3300048089 Bacteria 1338
231 Ga0495626_0032415 3300048091 Bacteria 2509
232 Ga0495626_0036476 3300048091 Bacteria 2342
233 Ga0496100_0074346 3300048903 Bacteria 2276
234 Ga0496103_0003574 3300048906 Bacteria 9492
235 Ga0496103_0131394 3300048906 Bacteria 1599
236 Ga0496104_0009760 3300048907 Bacteria 8560
237 Ga0496104_0023470 3300048907 Bacteria 5670
238 Ga0496104_0211660 3300048907 Bacteria 1850
239 Ga0496105_0000463 3300048908 Bacteria 26695
240 Ga0496105_0072026 3300048908 Bacteria 2856
241 Ga0496106_0057083 3300048909 Bacteria 2952
242 Ga0496110_0507358 3300048913 Bacteria 1098
243 Ga0496111_0446170 3300048914 Bacteria 955
244 Ga0496112_0339587 3300048915 Bacteria 1445
245 Ga0496112_0367386 3300048915 Bacteria 1380
246 Ga0496112_0739587 3300048915 Bacteria 910
247 Ga0496113_0075706 3300048916 Bacteria 2569
248 Ga0496113_0122699 3300048916 Bacteria 2033
249 Ga0496114_0308570 3300048917 Bacteria 1397
250 Ga0496115_0117186 3300048918 Bacteria 2191
251 Ga0496116_0041573 3300048919 Bacteria 3153
252 Ga0496116_0242316 3300048919 Bacteria 905
253 Ga0496117_0058886 3300048920 Bacteria 2657
254 Ga0496117_0114012 3300048920 Bacteria 1677
255 Ga0496118_0010237 3300048921 Bacteria 9307
256 Ga0496118_0012856 3300048921 Bacteria 7982
257 Ga0496118_0055846 3300048921 Bacteria 2974
258 Ga0496118_0058366 3300048921 Bacteria 2884
259 Ga0496118_0123838 3300048921 Bacteria 1678
260 Ga0496118_0140434 3300048921 Bacteria 1532
261 Ga0496119_0025369 3300048922 Bacteria 4142
262 Ga0496119_0161631 3300048922 Bacteria 1190
263 Ga0496120_0029833 3300048923 Bacteria 3325
264 Ga0496120_0100851 3300048923 Bacteria 1526
265 Ga0496120_0152404 3300048923 Bacteria 1160
266 Ga0496121_0006804 3300048924 Bacteria 14005
267 Ga0496121_0007297 3300048924 Bacteria 13370
268 Ga0496121_0007495 3300048924 Bacteria 13174
269 Ga0496121_0051008 3300048924 Bacteria 3489
270 Ga0496121_0068696 3300048924 Bacteria 2864
271 Ga0496121_0152974 3300048924 Bacteria 1695
272 Ga0496121_0256244 3300048924 Bacteria 1210
273 Ga0496122_0034697 3300048925 Bacteria 4123
274 Ga0496122_0216844 3300048925 Bacteria 1102
275 Ga0496123_0001861 3300048926 Bacteria 27666
276 Ga0496124_0000006 3300048927 Bacteria 904259
277 Ga0496124_0244563 3300048927 Bacteria 1332
278 Ga0496124_0315548 3300048927 Bacteria 1122
279 Ga0496124_0388614 3300048927 Bacteria 973
280 Ga0496125_0035579 3300048928 Bacteria 4364
281 Ga0496125_0085057 3300048928 Bacteria 2398
282 Ga0496126_0022927 3300048929 Bacteria 6061
283 Ga0496126_0028757 3300048929 Bacteria 5291
284 Ga0496126_0122752 3300048929 Bacteria 2251
285 Ga0496126_0129931 3300048929 Bacteria 2177
286 Ga0496126_0164732 3300048929 Bacteria 1892
287 Ga0496126_0585314 3300048929 Unclassified 881
288 Ga0496126_1056913 3300048929 Bacteria 606
289 Ga0495678_094430 3300049459 Bacteria 1047
290 Ga0495682_0007692 3300049460 Bacteria 4275
291 Ga0495682_0068001 3300049460 Bacteria 1283
292 Ga0495682_0194675 3300049460 Bacteria 719
293 nmdc:mga0yw44_4370_c1 3300050492 Bacteria 6469
294 nmdc:mga06z11_132660_c1 3300050494 Bacteria 1400
295 Ga0500610_0055048 3300053079 Bacteria 2075
296 Ga0500635_0104490 3300053080 Bacteria 1046
297 Ga0500635_0189014 3300053080 Bacteria 798
298 Ga0500578_0174602 3300053086 Bacteria 1327
299 Ga0500578_0245310 3300053086 Bacteria 1081
300 Ga0500583_0004194 3300053092 Bacteria 4658
301 Ga0500651_0127641 3300053093 Bacteria 1540
302 Ga0500566_0000246 3300053094 Bacteria 28960
303 Ga0500650_0218191 3300053098 Bacteria 864
304 Ga0500555_029818 3300053103 Bacteria 1550
305 Ga0500556_0014479 3300053104 Bacteria 2409
306 Ga0500557_000004 3300053105 Bacteria 202318
307 Ga0500557_001489 3300053105 Bacteria 3848
308 Ga0500562_008288 3300053108 Bacteria 2625
309 Ga0500569_033882 3300053109 Bacteria 1454
310 Ga0500569_149967 3300053109 Bacteria 786
311 Ga0500592_027289 3300053116 Bacteria 921
312 Ga0500594_0010652 3300053118 Bacteria 2138
313 Ga0500595_001365 3300053119 Bacteria 13120
314 Ga0500595_011613 3300053119 Bacteria 3437
315 Ga0500595_021870 3300053119 Bacteria 2276
316 Ga0500595_031743 3300053119 Bacteria 1769
317 Ga0500597_023604 3300053120 Bacteria 2460
318 Ga0500607_090882 3300053121 Bacteria 1536
319 Ga0500628_001575 3300053129 Bacteria 3879
320 Ga0500642_0000080 3300053130 Bacteria 52024
321 Ga0500559_0019888 3300053136 Bacteria 2837
322 Ga0500559_0386976 3300053136 Bacteria 651
323 Ga0500568_0021807 3300053139 Bacteria 2752
324 Ga0500577_0055968 3300053142 Bacteria 1500
325 Ga0500585_098510 3300053144 Bacteria 1054
326 Ga0500586_020352 3300053145 Bacteria 2078
327 Ga0500588_0045730 3300053146 Bacteria 1342
328 Ga0500588_0100754 3300053146 Bacteria 995
329 Ga0500616_0017302 3300053153 Bacteria 4093
330 Ga0500620_014037 3300053155 Bacteria 2225
331 Ga0500622_0164945 3300053156 Bacteria 1035
332 Ga0500627_0161437 3300053158 Bacteria 1011
333 Ga0500627_0250501 3300053158 Unclassified 784
334 Ga0500633_0222995 3300053160 Bacteria 704
335 Ga0500638_068959 3300053162 Bacteria 1692
336 Ga0500636_0000066 3300053177 Bacteria 51367
337 Ga0500625_002329 3300053729 Bacteria 7078
338 Ga0500645_001853 3300053730 Bacteria 10129
339 Ga0500645_137576 3300053730 Bacteria 676
340 Ga0500609_009971 3300053731 Bacteria 1278
341 Ga0500656_030870 3300053732 Bacteria 712
342 Ga0500601_000289 3300053737 Bacteria 9554
343 Ga0500661_055715 3300055283 Bacteria 710
344 2874130263 2874123672 Bacteria 7238285
345 2501078044 2501025502 Bacteria 9641094
346 2503203129 2503198000 Bacteria 6884444
347 2508542460 2508501009 Bacteria 7784016
348 2511091995 2510917013 Bacteria 9951648
349 2511399858 2511231028 Bacteria 8046582
350 2513644443 2513237094 Bacteria 8789602
351 2513645637 2513237095 Bacteria 8976980
352 2513706344 2513237102 Bacteria 7703324
353 2513872970 2513237139 Bacteria 8737671
354 2514013736 2513237161 Bacteria 8871253
355 2514049446 2513237166 Bacteria 10373764
356 2515627113 2515154112 Bacteria 8294334
357 2516019998 2515154189 Bacteria 9629850
358 2517102854 2517093001 Bacteria 9002274
359 2524471092 2524023210 Bacteria 9029266
360 2528852431 2528768022 Bacteria 10457665
361 2563060777 2562617112 Bacteria 10918404
362 2617347317 2617270735 Bacteria 9163226
363 2713480324 2711768613 Bacteria 11048459
364 2738820325 2738541296 Bacteria 7285013
365 2738825407 2738541297 Bacteria 6549566
366 2738832805 2738541298 Bacteria 7286732
367 2738874332 2738541306 Bacteria 7284992
368 2739149204 2738541357 Bacteria 6549408
369 2739185962 2738543002 Bacteria 7284546
370 2739191123 2738543003 Bacteria 6549560
371 2739220930 2738543008 Bacteria 7282815
372 2739317600 2738543026 Bacteria 6549408
373 2739335841 2738543029 Bacteria 6549249
374 2805915132 2802429603 Bacteria 8777136
375 2818238680 2816332527 Bacteria 8933356
376 2824604066 2824600985 Bacteria 8488197
377 2824610335 2824609381 Bacteria 8672835
378 2824617933 2824617872 Bacteria 8814715
379 2824626601 2824626560 Bacteria 8813858
380 2824638618 2824635225 Bacteria 8785348
381 2824646086 2824644064 Bacteria 8743947
382 2824658024 2824653114 Bacteria 8493680
383 2824668301 2824661429 Bacteria 9877870
384 2824672429 2824671348 Bacteria 8369588
385 2824685868 2824679649 Bacteria 8248951
386 2824689016 2824687955 Bacteria 8360029
387 2824702480 2824696289 Bacteria 8335049
388 2824716272 2824714736 Bacteria 8717648
389 2824726571 2824723954 Bacteria 8758240
390 2824735309 2824732956 Bacteria 7810675
391 2824746590 2824746037 Bacteria 7911610
392 2824759539 2824753945 Bacteria 9787441
393 2824771710 2824763712 Bacteria 9792355
394 2824775437 2824773399 Bacteria 8360218
395 2838123531 2838122688 Bacteria 8803140
396 2841949631 2841949485 Bacteria 8680857
397 2841958872 2841957949 Bacteria 8652217
398 2841971861 2841966195 Bacteria 8673214
399 2841983645 2841983080 Bacteria 8395090
400 2842782361 2842780639 Bacteria 4337790
401 2844535604 2844533157 Bacteria 7517899
402 2847936426 2847930680 Bacteria 9342022
403 2847946772 2847939898 Bacteria 8606328
404 2849079121 2849076700 Bacteria 7039503
405 2857514103 2857509624 Bacteria 7472071
406 2857576927 2857576091 Bacteria 5465855
407 2874176649 2874168670 Bacteria 8062617
408 2874598242 2874590934 Bacteria 8299676
409 2874615120 2874612657 Bacteria 8252029
410 2874632065 2874628541 Bacteria 8630250
411 2874652703 2874645413 Bacteria 8214782
412 2876764736 2876761206 Bacteria 10111113
413 2876778280 2876771140 Bacteria 8287509
414 2876825851 2876818435 Bacteria 8274608
415 2879082074 2879074833 Bacteria 8279565
416 2879090206 2879083081 Bacteria 8587928
417 2879105699 2879099564 Bacteria 10442239
418 2879135221 2879127579 Bacteria 8294491
419 2879145420 2879142872 Bacteria 8267021
420 2881368643 2881364244 Bacteria 7710352
421 2883088596 2883087390 Bacteria 9532701
422 2885373523 2885366525 Bacteria 8326213
423 2885387762 2885383462 Bacteria 9473874
424 2888384272 2888378607 Bacteria 9652610
425 2888424736 2888419890 Bacteria 7857137
426 2904428850 2904424332 Bacteria 7633521
427 2904714883 2904711408 Bacteria 9771557
428 2908780384 2908775508 Bacteria 8092255
429 2921648436 2921643360 Bacteria 11448031
430 2922374619
431 2922400591 2922393267 Bacteria 8285685
432 2929618293 2929615660 Bacteria 9193770
433 2929632481 2929624759 Bacteria 9339455
434 2932790576 2932784394 Bacteria 9704911
435 2932798147 2932794094 Bacteria 7915132
436 2932806996 2932801729 Bacteria 7987968
437 2932810997 2932809354 Bacteria 9135765
438 2932823673 2932818245 Bacteria 9955613
439 2932830207 2932828146 Bacteria 9745859
440 2933580220 2933577622 Bacteria 9116884
441 2935609065 2935608549 Bacteria 8203142
442 2935622567 2935616580 Bacteria 9032984
443 2935642633 2935638405 Bacteria 10015038
444 2935653225 2935648319 Bacteria 8801166
445 2935660456 2935656913 Bacteria 8965014
446 2935668063 2935665750 Bacteria 9571747
447 2935676096 2935675223 Bacteria 9928132
448 2935686080 2935684952 Bacteria 9590419
449 2935701294 2935694250 Bacteria 9291695
450 2935705923 2935703347 Bacteria 10242284
451 2935714632 2935713505 Bacteria 9608509
452 2935725251 2935722832 Bacteria 9608746
453 2935732389 2935732158 Bacteria 9706831
454 2935741768 2935741537 Bacteria 9707219
455 2935752045 2935750917 Bacteria 9590372
456 2935766393 2935760218 Bacteria 9817913
457 2935771844 2935769743 Bacteria 7878163
458 2935778719 2935777560 Bacteria 8077691
459 2935788895 2935785616 Bacteria 7962367
460 2935795305 2935793552 Bacteria 8012592
461 2935802921 2935801545 Bacteria 9301974
462 2935814239 2935810662 Bacteria 9401221
463 2935822225 2935819856 Bacteria 8261050
464 2935831376 2935827899 Bacteria 10038562
465 2935838236 2935837841 Bacteria 9454360
466 2935847807 2935847175 Bacteria 8228321
467 2935860816 2935855204 Bacteria 9035059
468 2935869847 2935864058 Bacteria 9784707
469 2935878734 2935873716 Bacteria 9632195
470 2935886875 2935883170 Bacteria 7964738
471 2935908921 2935908558 Bacteria 8568796
472 2935919639 2935916978 Bacteria 9113783
473 2935926505 2935926038 Bacteria 8601059
474 2935934955 2935934488 Bacteria 8602579
475 2935943405 2935942939 Bacteria 8599779
476 2935951843 2935951376 Bacteria 8602333
477 2935960617 2935959822 Bacteria 7869783
478 2935967968 2935967501 Bacteria 8603075
479 2935978596 2935975950 Bacteria 8347125
480 2935987551 2935984226 Bacteria 8302647
481 2935994870 2935992306 Bacteria 9802711
482 2936003513 2936002035 Bacteria 9362176
483 2936016095 2936011229 Bacteria 8801034
484 2936024728 2936019824 Bacteria 8804134
485 2936031824 2936028420 Bacteria 8965941
486 2936039795 2936037263 Bacteria 9446081
487 2936049685 2936046547 Bacteria 8903709
488 2936060789 2936055302 Bacteria 8785755
489 2940557152 2940556831 Bacteria 9590747
490 2941533019 2941531003 Bacteria 7653939
491 2941539096 2941538514 Bacteria 9402094
492 2945938894 2945934425 Bacteria 7444609
493 2990708894 2990703756 Bacteria 7715990
494 3005484524 3005483717 Bacteria 7877331
495 3005510521 3005506211 Bacteria 6943378
496 3005715102 3005710791 Bacteria 7622528
497 642421041 641736151 Bacteria 7477263
498 642597572 642555112 Bacteria 8676562
499 8016522102 8016511872 Bacteria 9921665
500 8016529417 8016522445 Bacteria 8156687
501 8016534628 8016530956 Bacteria 8155261
502 8016547849 8016539877 Bacteria 8155419
503 8016554286 8016548790 Bacteria 8155074
504 8016562662 8016557553 Bacteria 8154380
505 8016572971 8016566248 Bacteria 8158151
506 8016577125 8016575299 Bacteria 8154085
507 8016593065 8016583857 Bacteria 10421953
508 8016600444 8016595262 Bacteria 8149947
509 8016610297 8016603502 Bacteria 8731218
510 8016614634 8016613128 Bacteria 8794220
511 8016626363 8016622563 Bacteria 7999408
512 8016640123 8016630954 Bacteria 9217207
513 8017063566 8017057580 Bacteria 10023680
514 8019534391 8019530166 Bacteria 8155624
515 8019582885 8019576017 Bacteria 10049540
516 8019590680 8019586578 Bacteria 10212056
517 8019600669 8019597564 Bacteria 10041141
518 8019617877 8019608314 Bacteria 10042931
519 8019628381 8019619141 Bacteria 9218857
520 8019634247 8019629233 Bacteria 8687553
521 8019658610 8019648815 Bacteria 10014479
522 8019662122 8019659431 Bacteria 8577854
523 8019684461 8019678201 Bacteria 8863603
524 8019690267 8019687851 Bacteria 8712826
525 8055306988 8055301274 Bacteria 8587385
526 8055746119 8055742211 Bacteria 9226248
527 8056684951 8056681323 Bacteria 8472857
528 JGI24739J22299_10071679
529 JGI24738J21930_10042331
530 JGI25159J45721_1008033
531 JGI25151J46595_10000180
532 JGI25153J46596_10000142
533 JGI25153J46596_10006956
534 rootL2_10088555
535 rootL2_10107321
536 rootH1_10036249
537 JGI25160J50197_1001119
538 JGI25160J50197_1006072
539 Ga0055526_1051263
540 Ga0055543_1002266
541 Ga0055543_1039784
542 Ga0065165_1000348
543 Ga0065165_1001016
544 Ga0065165_1008800
545 Ga0065165_1040475
546 Ga0065165_1062163
547 Ga0070658_10026837
548 Ga0068869_100526831
549 Ga0070660_100095076
550 Ga0070668_100102503
551 Ga0070668_100353304
552 Ga0070669_100126535
553 Ga0070703_10034883
554 Ga0070701_10450595
555 Ga0070663_100068544
556 Ga0070663_100469444
557 Ga0070662_100163697
558 Ga0070698_100262309
559 Ga0070699_100080668
560 Ga0070695_100593123
561 Ga0070696_100088943
562 Ga0070693_100743343
563 Ga0070665_100928414
564 Ga0070665_100941732
565 Ga0068855_101065285
566 Ga0070664_100366606
567 Ga0068854_100389704
568 Ga0068856_100658495
569 Ga0068861_100499392
570 Ga0068858_100317092
571 Ga0068860_100048358
572 Ga0068862_100369123
573 Ga0075365_10041812
574 Ga0075367_10187609
575 Ga0075369_10005593
576 Ga0075369_10070768
577 Ga0099795_10132671
578 Ga0105240_10567507
579 Ga0105243_10174797
580 Ga0105241_10615499
581 Ga0105242_10164944
582 Ga0105248_10469633
583 Ga0105237_10064318
584 Ga0105237_10099698
585 Ga0105238_10147813
586 Ga0105238_10304659
587 Ga0105147_104316
588 Ga0105033_102961
589 Ga0105239_10014915
590 Ga0105239_10342766
591 Ga0105239_10813189
592 Ga0105239_11001658
593 Ga0157369_10154487
594 Ga0157374_10170602
595 Ga0163162_10190657
596 Ga0163163_10185657
597 Ga0182008_10039085
598 Ga0157379_10389910
599 Ga0157376_10293025
600 Ga0183361_10007
601 Ga0209233_1003572
602 Ga0209233_1061186
603 Ga0209130_1002055
604 Ga0209025_1000422
605 Ga0209564_1004271
606 Ga0209758_1000138
607 Ga0209758_1000321
608 Ga0209758_1005688
609 Ga0209256_1009095
610 Ga0209256_1031963
611 Ga0207426_1000133
612 Ga0207426_1000278
613 Ga0207426_1000822
614 Ga0207426_1067034
615 Ga0209257_1017915
616 Ga0207647_10011969
617 Ga0207647_10295620
618 Ga0207705_10221154
619 Ga0207657_10284508
620 Ga0207690_10123961
621 Ga0207711_10490502
622 Ga0207679_10554783
623 Ga0207639_10805434
624 Ga0207678_10228577
625 Ga0207678_11004340
626 Ga0209389_1000201
627 Ga0209489_100035
628 Ga0209700_100005
629 Ga0268266_10415026
630 Ga0268266_10742458
631 Ga0307509_10283635
632 Ga0307412_10000002
633 Ga0307412_10294953
634 Ga0307414_10901215
635 Ga0307510_10394007
636 Ga0395898_0669642
637 Ga0395905_0000157
638 Ga0395905_0001027
639 Ga0395905_0456530
640 Ga0395901_0657042
641 Ga0451793_1401622
642 Ga0451800_0613205
643 Ga0451835_1213202
644 Ga0451839_0570097
645 Ga0451845_0211355
646 Ga0466972_0169529
647 Ga0466968_0323623
648 Ga0466960_0180357
649 Ga0495617_000007
650 Ga0495590_0007134
651 Ga0495590_0059244
652 Ga0495629_0164472
653 Ga0495638_0073642
654 Ga0495653_0000042
655 Ga0495653_0587161
656 Ga0495650_0000696
657 Ga0495650_0006886
658 Ga0495650_0050826
659 Ga0495580_0295511
660 Ga0495582_0130946
661 Ga0495605_0017887
662 Ga0495605_0020582
663 Ga0495605_0134830
664 Ga0495605_0274593
665 Ga0495639_0067288
666 Ga0495664_0079832
667 Ga0495664_0233249
668 Ga0495584_0330854
669 Ga0495585_0001154
670 Ga0495596_0050435
671 Ga0495607_0000386
672 Ga0495583_0010278
673 Ga0495583_0042271
674 Ga0495583_0131011
675 Ga0495606_0000576
676 Ga0495606_0002371
677 Ga0495606_0017070
678 Ga0495606_0037668
679 Ga0495606_0122102
680 Ga0495606_0340484
681 Ga0495610_0000004
682 Ga0495610_0000364
683 Ga0495610_0019720
684 Ga0495618_0330985
685 Ga0495620_0086467
686 Ga0495628_0238432
687 Ga0495630_0133269
688 Ga0495643_0023945
689 Ga0495643_0084437
690 Ga0495643_0199531
691 Ga0495648_0015781
692 Ga0495648_0016293
693 Ga0495648_0023456
694 Ga0495648_0271236
695 Ga0495666_0019426
696 Ga0495642_0027050
697 Ga0495652_0227282
698 Ga0495654_0009448
699 Ga0495665_0052749
700 Ga0495640_0063068
701 Ga0495587_0352744
702 Ga0495622_0030484
703 Ga0495622_0049748
704 Ga0495633_0007540
705 Ga0495668_0001787
706 Ga0495668_0120161
707 Ga0495668_0128910
708 Ga0495611_0053313
709 Ga0495611_0059372
710 Ga0495625_0026624
711 Ga0495625_0032489
712 Ga0495625_0106428
713 Ga0495625_0335849
714 Ga0495661_0104982
715 Ga0495588_0247658
716 Ga0495657_0064011
717 Ga0495669_0230532
718 Ga0495624_0005430
719 Ga0495671_0000070
720 Ga0495671_0041751
721 Ga0495671_0088368
722 Ga0495649_0087368
723 Ga0495649_0256267
724 Ga0495649_0377258
725 Ga0495589_0084152
726 Ga0495600_0084144
727 Ga0495660_0018498
728 Ga0495604_0149553
729 Ga0495674_0007958
730 Ga0495674_0125849
731 Ga0495672_0098901
732 Ga0495676_0043265
733 Ga0495683_0003040
734 Ga0495683_0035864
735 Ga0495683_0090829
736 Ga0495683_0179792
737 Ga0495687_024389
738 Ga0495687_114396
739 Ga0495687_143160
740 Ga0495679_000273
741 Ga0495679_002837
742 Ga0495679_024523
743 Ga0495673_0000017
744 Ga0495673_0000027
745 Ga0495673_0027075
746 Ga0495673_0059570
747 Ga0495673_0081506
748 Ga0495684_0392767
749 Ga0495686_0000110
750 Ga0495686_0021897
751 Ga0495686_0087838
752 Ga0495686_0163663
753 Ga0495686_0167207
754 Ga0495593_0024135
755 Ga0495593_0368711
756 Ga0495602_0169151
757 Ga0495614_0089497
758 Ga0495626_0032415
759 Ga0495626_0036476
760 Ga0496100_0074346
761 Ga0496103_0003574
762 Ga0496103_0131394
763 Ga0496104_0009760
764 Ga0496104_0023470
765 Ga0496104_0211660
766 Ga0496105_0000463
767 Ga0496105_0072026
768 Ga0496106_0057083
769 Ga0496110_0507358
770 Ga0496111_0446170
771 Ga0496112_0339587
772 Ga0496112_0367386
773 Ga0496112_0739587
774 Ga0496113_0075706
775 Ga0496113_0122699
776 Ga0496114_0308570
777 Ga0496115_0117186
778 Ga0496116_0041573
779 Ga0496116_0242316
780 Ga0496117_0058886
781 Ga0496117_0114012
782 Ga0496118_0010237
783 Ga0496118_0012856
784 Ga0496118_0055846
785 Ga0496118_0058366
786 Ga0496118_0123838
787 Ga0496118_0140434
788 Ga0496119_0025369
789 Ga0496119_0161631
790 Ga0496120_0029833
791 Ga0496120_0100851
792 Ga0496120_0152404
793 Ga0496121_0006804
794 Ga0496121_0007297
795 Ga0496121_0007495
796 Ga0496121_0051008
797 Ga0496121_0068696
798 Ga0496121_0152974
799 Ga0496121_0256244
800 Ga0496122_0034697
801 Ga0496122_0216844
802 Ga0496123_0001861
803 Ga0496124_0000006
804 Ga0496124_0244563
805 Ga0496124_0315548
806 Ga0496124_0388614
807 Ga0496125_0035579
808 Ga0496125_0085057
809 Ga0496126_0022927
810 Ga0496126_0028757
811 Ga0496126_0122752
812 Ga0496126_0129931
813 Ga0496126_0164732
814 Ga0496126_0585314
815 Ga0496126_1056913
816 Ga0495678_094430
817 Ga0495682_0007692
818 Ga0495682_0068001
819 Ga0495682_0194675
820 nmdc:mga0yw44_4370_c1
821 nmdc:mga06z11_132660_c1
822 Ga0500610_0055048
823 Ga0500635_0104490
824 Ga0500635_0189014
825 Ga0500578_0174602
826 Ga0500578_0245310
827 Ga0500583_0004194
828 Ga0500651_0127641
829 Ga0500566_0000246
830 Ga0500650_0218191
831 Ga0500555_029818
832 Ga0500556_0014479
833 Ga0500557_000004
834 Ga0500557_001489
835 Ga0500562_008288
836 Ga0500569_033882
837 Ga0500569_149967
838 Ga0500592_027289
839 Ga0500594_0010652
840 Ga0500595_001365
841 Ga0500595_011613
842 Ga0500595_021870
843 Ga0500595_031743
844 Ga0500597_023604
845 Ga0500607_090882
846 Ga0500628_001575
847 Ga0500642_0000080
848 Ga0500559_0019888
849 Ga0500559_0386976
850 Ga0500568_0021807
851 Ga0500577_0055968
852 Ga0500585_098510
853 Ga0500586_020352
854 Ga0500588_0045730
855 Ga0500588_0100754
856 Ga0500616_0017302
857 Ga0500620_014037
858 Ga0500622_0164945
859 Ga0500627_0161437
860 Ga0500627_0250501
861 Ga0500633_0222995
862 Ga0500638_068959
863 Ga0500636_0000066
864 Ga0500625_002329
865 Ga0500645_001853
866 Ga0500645_137576
867 Ga0500609_009971
868 Ga0500656_030870
869 Ga0500601_000289
870 Ga0500661_055715
871 2874130263
872 2501078044
873 2503203129
874 2508542460
875 2511091995
876 2511399858
877 2513644443
878 2513645637
879 2513706344
880 2513872970
881 2514013736
882 2514049446
883 2515627113
884 2516019998
885 2517102854
886 2524471092
887 2528852431
888 2563060777
889 2617347317
890 2713480324
891 2738820325
892 2738825407
893 2738832805
894 2738874332
895 2739149204
896 2739185962
897 2739191123
898 2739220930
899 2739317600
900 2739335841
901 2805915132
902 2818238680
903 2824604066
904 2824610335
905 2824617933
906 2824626601
907 2824638618
908 2824646086
909 2824658024
910 2824668301
911 2824672429
912 2824685868
913 2824689016
914 2824702480
915 2824716272
916 2824726571
917 2824735309
918 2824746590
919 2824759539
920 2824771710
921 2824775437
922 2838123531
923 2841949631
924 2841958872
925 2841971861
926 2841983645
927 2842782361
928 2844535604
929 2847936426
930 2847946772
931 2849079121
932 2857514103
933 2857576927
934 2874176649
935 2874598242
936 2874615120
937 2874632065
938 2874652703
939 2876764736
940 2876778280
941 2876825851
942 2879082074
943 2879090206
944 2879105699
945 2879135221
946 2879145420
947 2881368643
948 2883088596
949 2885373523
950 2885387762
951 2888384272
952 2888424736
953 2904428850
954 2904714883
955 2908780384
956 2921648436
957 2922374619
958 2922400591
959 2929618293
960 2929632481
961 2932790576
962 2932798147
963 2932806996
964 2932810997
965 2932823673
966 2932830207
967 2933580220
968 2935609065
969 2935622567
970 2935642633
971 2935653225
972 2935660456
973 2935668063
974 2935676096
975 2935686080
976 2935701294
977 2935705923
978 2935714632
979 2935725251
980 2935732389
981 2935741768
982 2935752045
983 2935766393
984 2935771844
985 2935778719
986 2935788895
987 2935795305
988 2935802921
989 2935814239
990 2935822225
991 2935831376
992 2935838236
993 2935847807
994 2935860816
995 2935869847
996 2935878734
997 2935886875
998 2935908921
999 2935919639
1000 2935926505
1001 2935934955
1002 2935943405
1003 2935951843
1004 2935960617
1005 2935967968
1006 2935978596
1007 2935987551
1008 2935994870
1009 2936003513
1010 2936016095
1011 2936024728
1012 2936031824
1013 2936039795
1014 2936049685
1015 2936060789
1016 2940557152
1017 2941533019
1018 2941539096
1019 2945938894
1020 2990708894
1021 3005484524
1022 3005510521
1023 3005715102
1024 642421041
1025 642597572
1026 8016522102
1027 8016529417
1028 8016534628
1029 8016547849
1030 8016554286
1031 8016562662
1032 8016572971
1033 8016577125
1034 8016593065
1035 8016600444
1036 8016610297
1037 8016614634
1038 8016626363
1039 8016640123
1040 8017063566
1041 8019534391
1042 8019582885
1043 8019590680
1044 8019600669
1045 8019617877
1046 8019628381
1047 8019634247
1048 8019658610
1049 8019662122
1050 8019684461
1051 8019690267
1052 8055306988
1053 8055746119
1054 8056684951

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03729

DUF308

Short repeat of unknown function (DUF308)

76

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dwl-assembly1.cif.gz_E avd molecule from bordetella bacteriophage dgr 0.57 49 151
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.5497 13 194
4dwl-assembly1.cif.gz_E avd molecule from bordetella bacteriophage dgr 0.5288 49 151
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.5151 13 194
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.5143 46 152
ID Description Score Start End Superfamily
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7002 106 152 1.10.287.470
af_Q55C26_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6305 46 152 1.20.140.150
af_Q6ZIT5_31_179_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5971 45 152 1.20.140.40
af_D4A4D6_43_144_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.596 107 193 1.20.140.150
af_Q9D3F6_43_142_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.595 107 193 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1V9V3L0-F1-model_v4 DUF308 domain-containing protein 0.9701 14 190 GO:0016020
AF-A0A5B6TNP1-F1-model_v4 DUF308 domain-containing protein 0.9516 13 187 GO:0016020
AF-A0A7W7K2Y7-F1-model_v4 Uncharacterized membrane protein HdeD (DUF308 family) 0.9514 11 182 GO:0016020
AF-A0A1V1T255-F1-model_v4 DUF308 domain-containing protein 0.9508 10 194 GO:0016020
AF-A0A543M1T9-F1-model_v4 deleted 0.9499 14 191

Map