F459628

General Info

Members Datasets Scaffolds Average Seq Length
528 199 1056 138

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100003921|Ga0070683_1000039215
Length 157
Sequence LRYDWSSSADRGDLNFVTKNMSKKVSVFRKEHFNAAHRLYNDAWDYGKNEKVFGKCALPNYHGHNYEMEVKVTGEPDKETGYVIDLKLLSDIIRREVVQKFDHKNLNLDTEEFKNLNPTAENIVVVIYKLLRPYIDSKFDLQVRLYETPRNFVEYPV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
174 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.95
Rhizosphere 98.3
Stem 0
Stem Tuber 0
Unclassified 16.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003921 3300005329 Bacteria 12162
2 rootL2_10121209 3300003322 Bacteria 1216
3 rootL2_10380535 3300003322 Bacteria 1775
4 Ga0065704_10110517 3300005289 Unclassified 1978
5 Ga0065704_10174398 3300005289 Bacteria 1272
6 Ga0065704_10350589 3300005289 Bacteria 810
7 Ga0065704_10781763 3300005289 Bacteria 531
8 Ga0065712_10006679 3300005290 Bacteria 4380
9 Ga0065712_10304229 3300005290 Unclassified 854
10 Ga0065715_10127629 3300005293 Bacteria 2083
11 Ga0065715_10808926 3300005293 Bacteria 607
12 Ga0065707_10336952 3300005295 Bacteria 909
13 Ga0070658_10566207 3300005327 Unclassified 984
14 Ga0070676_10042064 3300005328 Bacteria 2651
15 Ga0070676_10100479 3300005328 Bacteria 1786
16 Ga0070676_11320785 3300005328 Unclassified 551
17 Ga0070683_100006131 3300005329 Bacteria 10080
18 Ga0070683_100083308 3300005329 Bacteria 2996
19 Ga0070683_100311440 3300005329 Bacteria 1498
20 Ga0070683_100443105 3300005329 Unclassified 1239
21 Ga0070690_100031153 3300005330 Bacteria 3320
22 Ga0070690_100230523 3300005330 Bacteria 1302
23 Ga0070690_100603174 3300005330 Unclassified 834
24 Ga0070670_100155216 3300005331 Bacteria 1982
25 Ga0070670_100748940 3300005331 Unclassified 880
26 Ga0070670_102147397 3300005331 Unclassified 515
27 Ga0070677_10070792 3300005333 Bacteria 1466
28 Ga0070677_10436374 3300005333 Unclassified 697
29 Ga0068869_100022072 3300005334 Bacteria 4383
30 Ga0068869_100027043 3300005334 Bacteria 3997
31 Ga0068869_100029417 3300005334 Bacteria 3848
32 Ga0068869_100036090 3300005334 Bacteria 3508
33 Ga0068869_100164000 3300005334 Bacteria 1732
34 Ga0068869_100754101 3300005334 Bacteria 833
35 Ga0070666_10110617 3300005335 Bacteria 1900
36 Ga0070666_10150504 3300005335 Bacteria 1623
37 Ga0070666_10728811 3300005335 Unclassified 728
38 Ga0070682_100042105 3300005337 Bacteria 2818
39 Ga0068868_100001962 3300005338 Bacteria 14093
40 Ga0068868_100110602 3300005338 Bacteria 2232
41 Ga0068868_100124256 3300005338 Bacteria 2107
42 Ga0068868_100282731 3300005338 Bacteria 1405
43 Ga0068868_102171804 3300005338 Bacteria 529
44 Ga0070660_100697396 3300005339 Bacteria 851
45 Ga0070689_100003233 3300005340 Bacteria 10800
46 Ga0070689_100025238 3300005340 Bacteria 4463
47 Ga0070689_100086757 3300005340 Bacteria 2461
48 Ga0070689_100213534 3300005340 Bacteria 1580
49 Ga0070689_100997226 3300005340 Unclassified 745
50 Ga0070687_100303603 3300005343 Bacteria 1014
51 Ga0070661_100010040 3300005344 Bacteria 6572
52 Ga0070661_100133335 3300005344 Bacteria 1867
53 Ga0070661_100932149 3300005344 Unclassified 718
54 Ga0070661_100990934 3300005344 Bacteria 697
55 Ga0070661_101261053 3300005344 Bacteria 619
56 Ga0070668_100359885 3300005347 Unclassified 1233
57 Ga0070669_100136658 3300005353 Bacteria 1886
58 Ga0070669_100286317 3300005353 Bacteria 1322
59 Ga0070669_100308864 3300005353 Bacteria 1274
60 Ga0070669_100793255 3300005353 Bacteria 805
61 Ga0070675_100037929 3300005354 Bacteria 3926
62 Ga0070675_100090260 3300005354 Bacteria 2566
63 Ga0070675_100124752 3300005354 Bacteria 2190
64 Ga0070675_100160262 3300005354 Bacteria 1934
65 Ga0070675_100396811 3300005354 Bacteria 1230
66 Ga0070675_100928179 3300005354 Bacteria 798
67 Ga0070671_100037530 3300005355 Bacteria 4018
68 Ga0070671_100115357 3300005355 Bacteria 2258
69 Ga0070671_100280124 3300005355 Bacteria 1418
70 Ga0070673_100269159 3300005364 Bacteria 1491
71 Ga0070673_100981931 3300005364 Bacteria 786
72 Ga0070688_100062258 3300005365 Bacteria 2361
73 Ga0070688_100128554 3300005365 Bacteria 1706
74 Ga0070688_100213391 3300005365 Bacteria 1356
75 Ga0070688_100265748 3300005365 Bacteria 1227
76 Ga0070659_100026506 3300005366 Bacteria 4461
77 Ga0070659_100843948 3300005366 Unclassified 798
78 Ga0070659_101037591 3300005366 Unclassified 721
79 Ga0070667_100156848 3300005367 Bacteria 2002
80 Ga0070667_100226160 3300005367 Bacteria 1667
81 Ga0070667_100238895 3300005367 Bacteria 1622
82 Ga0070667_100551595 3300005367 Bacteria 1059
83 Ga0070667_100624098 3300005367 Unclassified 994
84 Ga0070701_10259002 3300005438 Unclassified 1053
85 Ga0070701_11346760 3300005438 Bacteria 512
86 Ga0070705_100539647 3300005440 Bacteria 892
87 Ga0070705_100579533 3300005440 Bacteria 865
88 Ga0070700_100108676 3300005441 Unclassified 1840
89 Ga0070663_100266202 3300005455 Unclassified 1361
90 Ga0070663_100427473 3300005455 Bacteria 1087
91 Ga0070663_101136042 3300005455 Bacteria 684
92 Ga0070678_100030276 3300005456 Bacteria 3719
93 Ga0070678_101249055 3300005456 Bacteria 690
94 Ga0070678_101264380 3300005456 Bacteria 686
95 Ga0070662_100021345 3300005457 Bacteria 4420
96 Ga0070662_100040464 3300005457 Bacteria 3319
97 Ga0070662_100053379 3300005457 Bacteria 2925
98 Ga0070662_100068677 3300005457 Bacteria 2606
99 Ga0068867_100214438 3300005459 Unclassified 1548
100 Ga0068867_100377450 3300005459 Bacteria 1190
101 Ga0068867_100449483 3300005459 Bacteria 1097
102 Ga0068867_100829967 3300005459 Bacteria 827
103 Ga0070685_10013974 3300005466 Bacteria 4247
104 Ga0070685_10042404 3300005466 Bacteria 2597
105 Ga0070685_10075641 3300005466 Bacteria 2006
106 Ga0070685_10221580 3300005466 Bacteria 1240
107 Ga0070706_101225059 3300005467 Unclassified 689
108 Ga0070698_100064272 3300005471 Bacteria 3698
109 Ga0070684_100005547 3300005535 Bacteria 9683
110 Ga0070684_100007787 3300005535 Bacteria 8354
111 Ga0070684_100520613 3300005535 Unclassified 1102
112 Ga0070697_101380971 3300005536 Bacteria 629
113 Ga0068853_100009368 3300005539 Bacteria 7894
114 Ga0068853_100773707 3300005539 Bacteria 918
115 Ga0068853_101210349 3300005539 Bacteria 729
116 Ga0070672_100296588 3300005543 Bacteria 1369
117 Ga0070672_100927263 3300005543 Bacteria 770
118 Ga0070672_101832827 3300005543 Bacteria 546
119 Ga0070686_100147373 3300005544 Bacteria 1645
120 Ga0070686_100378594 3300005544 Bacteria 1071
121 Ga0070665_100117774 3300005548 Bacteria 2659
122 Ga0070665_100140556 3300005548 Bacteria 2418
123 Ga0070665_100548772 3300005548 Bacteria 1168
124 Ga0070665_100701401 3300005548 Unclassified 1025
125 Ga0070665_101070954 3300005548 Unclassified 818
126 Ga0070704_100609163 3300005549 Bacteria 960
127 Ga0070664_100002349 3300005564 Bacteria 15201
128 Ga0070664_100003069 3300005564 Bacteria 13504
129 Ga0070664_100278842 3300005564 Bacteria 1507
130 Ga0070664_100515600 3300005564 Bacteria 1103
131 Ga0070664_100613335 3300005564 Bacteria 1009
132 Ga0068857_100005320 3300005577 Bacteria 10962
133 Ga0068857_100247253 3300005577 Bacteria 1634
134 Ga0068857_100704456 3300005577 Bacteria 959
135 Ga0068854_100308832 3300005578 Bacteria 1282
136 Ga0068854_100598934 3300005578 Bacteria 941
137 Ga0070702_100526687 3300005615 Unclassified 873
138 Ga0068852_100027217 3300005616 Bacteria 4658
139 Ga0068852_100149899 3300005616 Unclassified 2168
140 Ga0068852_100314437 3300005616 Bacteria 1519
141 Ga0068852_100714487 3300005616 Bacteria 1013
142 Ga0068852_101606709 3300005616 Bacteria 673
143 Ga0068859_100004125 3300005617 Bacteria 14825
144 Ga0068859_100025734 3300005617 Bacteria 5901
145 Ga0068859_100043765 3300005617 Bacteria 4500
146 Ga0068859_100090705 3300005617 Bacteria 3107
147 Ga0068859_100137450 3300005617 Bacteria 2517
148 Ga0068859_100246453 3300005617 Bacteria 1876
149 Ga0068859_100280490 3300005617 Unclassified 1759
150 Ga0068859_100584939 3300005617 Bacteria 1210
151 Ga0068859_101888383 3300005617 Bacteria 659
152 Ga0068864_100017816 3300005618 Bacteria 5924
153 Ga0068864_100097442 3300005618 Bacteria 2604
154 Ga0068864_100098925 3300005618 Bacteria 2584
155 Ga0068864_100302110 3300005618 Bacteria 1499
156 Ga0068864_100610735 3300005618 Unclassified 1059
157 Ga0068864_100624205 3300005618 Bacteria 1048
158 Ga0068864_101139226 3300005618 Bacteria 777
159 Ga0068864_102069302 3300005618 Bacteria 576
160 Ga0068866_10004750 3300005718 Bacteria 5573
161 Ga0068861_100041368 3300005719 Bacteria 3452
162 Ga0068861_100412269 3300005719 Bacteria 1202
163 Ga0068861_100708183 3300005719 Bacteria 936
164 Ga0068851_10131856 3300005834 Unclassified 1352
165 Ga0068870_10137166 3300005840 Bacteria 1428
166 Ga0068870_10261012 3300005840 Bacteria 1078
167 Ga0068863_100427252 3300005841 Bacteria 1298
168 Ga0068863_100707597 3300005841 Unclassified 1001
169 Ga0068863_100860410 3300005841 Bacteria 906
170 Ga0068858_100101862 3300005842 Bacteria 2678
171 Ga0068858_100106517 3300005842 Bacteria 2617
172 Ga0068858_100112306 3300005842 Bacteria 2545
173 Ga0068858_100151364 3300005842 Bacteria 2182
174 Ga0068858_101118136 3300005842 Unclassified 774
175 Ga0068858_101315719 3300005842 Bacteria 711
176 Ga0068860_100014161 3300005843 Bacteria 7822
177 Ga0068860_100062175 3300005843 Bacteria 3548
178 Ga0068860_100187260 3300005843 Bacteria 2002
179 Ga0068860_100428428 3300005843 Bacteria 1312
180 Ga0068860_100877561 3300005843 Unclassified 912
181 Ga0068860_101976328 3300005843 Unclassified 605
182 Ga0068862_100135791 3300005844 Bacteria 2179
183 Ga0068862_100383085 3300005844 Archaea 1312
184 Ga0068862_101529680 3300005844 Bacteria 673
185 Ga0070715_10601317 3300006163 Bacteria 645
186 Ga0075427_10020962 3300006194 Unclassified 1038
187 Ga0097621_100047197 3300006237 Bacteria 3489
188 Ga0097621_100247737 3300006237 Bacteria 1559
189 Ga0097621_100667142 3300006237 Bacteria 955
190 Ga0097621_100832281 3300006237 Bacteria 857
191 Ga0097621_101304104 3300006237 Bacteria 686
192 Ga0068871_100038641 3300006358 Bacteria 3813
193 Ga0068871_100149183 3300006358 Bacteria 1993
194 Ga0068871_100327302 3300006358 Unclassified 1351
195 Ga0068871_100555260 3300006358 Unclassified 1040
196 Ga0068871_101660334 3300006358 Bacteria 605
197 Ga0075428_100019960 3300006844 Bacteria 7420
198 Ga0075428_100164168 3300006844 Bacteria 2409
199 Ga0075428_100602176 3300006844 Unclassified 1174
200 Ga0075430_100015046 3300006846 Bacteria 6586
201 Ga0075431_100259046 3300006847 Bacteria 1765
202 Ga0075434_100023016 3300006871 Bacteria 6066
203 Ga0075434_100507227 3300006871 Bacteria 1227
204 Ga0075434_101465854 3300006871 Bacteria 692
205 Ga0075434_101853514 3300006871 Bacteria 609
206 Ga0075429_100103876 3300006880 Bacteria 2481
207 Ga0075429_101694626 3300006880 Bacteria 549
208 Ga0068865_100338215 3300006881 Unclassified 1216
209 Ga0068865_100490268 3300006881 Bacteria 1023
210 Ga0068865_101555644 3300006881 Unclassified 594
211 Ga0097620_100004125 3300006931 Bacteria 14825
212 Ga0097620_100025733 3300006931 Bacteria 5901
213 Ga0097620_100043765 3300006931 Bacteria 4500
214 Ga0097620_100090704 3300006931 Bacteria 3107
215 Ga0097620_100137460 3300006931 Bacteria 2517
216 Ga0097620_100246458 3300006931 Bacteria 1876
217 Ga0097620_100280506 3300006931 Unclassified 1759
218 Ga0097620_100584900 3300006931 Bacteria 1210
219 Ga0097620_101888351 3300006931 Bacteria 659
220 Ga0105251_10125513 3300009011 Bacteria 1165
221 Ga0105251_10157983 3300009011 Bacteria 1022
222 Ga0111539_12534370 3300009094 Bacteria 595
223 Ga0105245_11384595 3300009098 Bacteria 753
224 Ga0114129_10151560 3300009147 Bacteria 3173
225 Ga0114129_10867190 3300009147 Unclassified 1146
226 Ga0105241_10178095 3300009174 Bacteria 1761
227 Ga0105241_10326618 3300009174 Bacteria 1324
228 Ga0105241_10446369 3300009174 Unclassified 1143
229 Ga0105241_11125758 3300009174 Bacteria 740
230 Ga0105242_10054894 3300009176 Bacteria 3258
231 Ga0105242_10070215 3300009176 Bacteria 2904
232 Ga0105242_10155752 3300009176 Bacteria 1996
233 Ga0105242_10852973 3300009176 Bacteria 907
234 Ga0105242_11008309 3300009176 Bacteria 841
235 Ga0105237_10313494 3300009545 Bacteria 1572
236 Ga0105249_10000406 3300009553 Bacteria 41452
237 Ga0105249_10001153 3300009553 Bacteria 23372
238 Ga0105249_10006136 3300009553 Bacteria 10425
239 Ga0105249_10798656 3300009553 Bacteria 1008
240 Ga0105249_11343233 3300009553 Bacteria 786
241 Ga0105249_11947754 3300009553 Bacteria 660
242 Ga0105246_11013276 3300011119 Unclassified 753
243 Ga0157373_10736277 3300013100 Bacteria 724
244 Ga0157373_11401312 3300013100 Bacteria 531
245 Ga0157373_11495407 3300013100 Bacteria 515
246 Ga0157371_10134192 3300013102 Bacteria 1762
247 Ga0157371_10441319 3300013102 Bacteria 956
248 Ga0157370_10048893 3300013104 Bacteria 4051
249 Ga0157370_10765012 3300013104 Bacteria 880
250 Ga0157369_10172139 3300013105 Bacteria 2281
251 Ga0157369_11477682 3300013105 Bacteria 691
252 Ga0157374_10002603 3300013296 Bacteria 15212
253 Ga0157374_10004203 3300013296 Bacteria 12101
254 Ga0157374_10116045 3300013296 Bacteria 2579
255 Ga0157374_10206151 3300013296 Bacteria 1927
256 Ga0157378_10083969 3300013297 Bacteria 2883
257 Ga0157378_10211888 3300013297 Bacteria 1837
258 Ga0163162_10017132 3300013306 Bacteria 7088
259 Ga0163162_10033883 3300013306 Bacteria 5078
260 Ga0163162_10093536 3300013306 Bacteria 3091
261 Ga0163162_10458131 3300013306 Unclassified 1407
262 Ga0163162_10471106 3300013306 Bacteria 1387
263 Ga0163162_10944317 3300013306 Unclassified 974
264 Ga0163162_11160236 3300013306 Bacteria 876
265 Ga0163162_11477429 3300013306 Unclassified 774
266 Ga0163162_12048584 3300013306 Bacteria 656
267 Ga0157372_10043401 3300013307 Bacteria 4978
268 Ga0157372_10243486 3300013307 Bacteria 2087
269 Ga0157372_10265295 3300013307 Bacteria 1994
270 Ga0157372_10355540 3300013307 Bacteria 1707
271 Ga0157372_10567018 3300013307 Bacteria 1323
272 Ga0157372_10716602 3300013307 Bacteria 1164
273 Ga0157372_10849749 3300013307 Bacteria 1060
274 Ga0157375_10031699 3300013308 Bacteria 5003
275 Ga0157375_10049606 3300013308 Bacteria 4114
276 Ga0157375_10050994 3300013308 Bacteria 4061
277 Ga0157375_10075738 3300013308 Bacteria 3390
278 Ga0157375_10155359 3300013308 Bacteria 2426
279 Ga0157375_10209899 3300013308 Bacteria 2104
280 Ga0157375_10804060 3300013308 Bacteria 1089
281 Ga0163163_10001974 3300014325 Bacteria 17348
282 Ga0163163_10075870 3300014325 Bacteria 3356
283 Ga0163163_10190436 3300014325 Bacteria 2100
284 Ga0163163_10206905 3300014325 Unclassified 2011
285 Ga0163163_11119122 3300014325 Bacteria 850
286 Ga0163163_11224774 3300014325 Bacteria 813
287 Ga0163163_11245762 3300014325 Bacteria 806
288 Ga0157380_10862647 3300014326 Bacteria 928
289 Ga0157380_11298360 3300014326 Bacteria 775
290 Ga0157380_11680921 3300014326 Unclassified 692
291 Ga0157377_10019814 3300014745 Bacteria 3517
292 Ga0157377_10022052 3300014745 Bacteria 3358
293 Ga0157377_10025779 3300014745 Bacteria 3139
294 Ga0157377_10208320 3300014745 Bacteria 1245
295 Ga0157377_10242092 3300014745 Bacteria 1165
296 Ga0157379_10066045 3300014968 Bacteria 3234
297 Ga0157379_10082050 3300014968 Bacteria 2889
298 Ga0157379_10406386 3300014968 Bacteria 1252
299 Ga0157379_12180418 3300014968 Unclassified 550
300 Ga0157376_10017401 3300014969 Bacteria 5482
301 Ga0157376_10038159 3300014969 Bacteria 3906
302 Ga0157376_10367722 3300014969 Bacteria 1381
303 Ga0157376_10557298 3300014969 Bacteria 1135
304 Ga0157376_11084491 3300014969 Bacteria 826
305 Ga0157376_11555241 3300014969 Unclassified 695
306 Ga0157376_12444203 3300014969 Bacteria 562
307 Ga0163161_10010770 3300017792 Bacteria 6337
308 Ga0163161_10233103 3300017792 Bacteria 1429
309 Ga0163161_10250796 3300017792 Bacteria 1380
310 Ga0163161_11723292 3300017792 Bacteria 555
311 Ga0207666_1017167 3300025271 Bacteria 1043
312 Ga0207697_10285777 3300025315 Bacteria 731
313 Ga0207713_1182290 3300025735 Unclassified 655
314 Ga0207713_1232663 3300025735 Bacteria 550
315 Ga0207682_10168436 3300025893 Unclassified 996
316 Ga0207642_10050890 3300025899 Bacteria 1871
317 Ga0207642_10730698 3300025899 Bacteria 626
318 Ga0207688_10102323 3300025901 Bacteria 1655
319 Ga0207680_10031233 3300025903 Bacteria 3015
320 Ga0207680_10096754 3300025903 Bacteria 1889
321 Ga0207680_10299170 3300025903 Bacteria 1121
322 Ga0207647_10000532 3300025904 Bacteria 30386
323 Ga0207647_10038030 3300025904 Bacteria 3046
324 Ga0207685_10505515 3300025905 Unclassified 637
325 Ga0207645_10702332 3300025907 Unclassified 687
326 Ga0207643_10121937 3300025908 Bacteria 1545
327 Ga0207643_10533663 3300025908 Unclassified 752
328 Ga0207654_10714375 3300025911 Unclassified 720
329 Ga0207662_10380155 3300025918 Unclassified 954
330 Ga0207657_10173177 3300025919 Bacteria 1748
331 Ga0207649_10017776 3300025920 Bacteria 4032
332 Ga0207649_10244009 3300025920 Bacteria 1291
333 Ga0207649_10386952 3300025920 Bacteria 1044
334 Ga0207649_10648770 3300025920 Bacteria 815
335 Ga0207649_11118384 3300025920 Bacteria 622
336 Ga0207646_10161401 3300025922 Bacteria 2023
337 Ga0207681_10286295 3300025923 Bacteria 1299
338 Ga0207681_10495949 3300025923 Bacteria 999
339 Ga0207681_10496250 3300025923 Unclassified 999
340 Ga0207681_10572853 3300025923 Bacteria 931
341 Ga0207650_10047013 3300025925 Bacteria 3179
342 Ga0207650_10175879 3300025925 Bacteria 1703
343 Ga0207650_10626215 3300025925 Bacteria 906
344 Ga0207659_10089847 3300025926 Bacteria 2291
345 Ga0207659_10339556 3300025926 Bacteria 1244
346 Ga0207659_10478525 3300025926 Bacteria 1052
347 Ga0207659_10626687 3300025926 Bacteria 918
348 Ga0207659_10782462 3300025926 Bacteria 819
349 Ga0207644_10096100 3300025931 Bacteria 2217
350 Ga0207644_10212186 3300025931 Bacteria 1531
351 Ga0207644_10318972 3300025931 Bacteria 1256
352 Ga0207644_10928483 3300025931 Unclassified 730
353 Ga0207690_10020181 3300025932 Bacteria 4113
354 Ga0207690_10181716 3300025932 Unclassified 1584
355 Ga0207690_10638768 3300025932 Unclassified 871
356 Ga0207690_11021628 3300025932 Unclassified 688
357 Ga0207706_10002223 3300025933 Bacteria 18940
358 Ga0207706_10043302 3300025933 Bacteria 3990
359 Ga0207706_10123537 3300025933 Bacteria 2277
360 Ga0207706_10178786 3300025933 Bacteria 1864
361 Ga0207686_10008317 3300025934 Bacteria 5597
362 Ga0207686_10241814 3300025934 Unclassified 1314
363 Ga0207686_10258177 3300025934 Bacteria 1276
364 Ga0207670_10037359 3300025936 Bacteria 3164
365 Ga0207670_10039054 3300025936 Bacteria 3106
366 Ga0207670_10125772 3300025936 Bacteria 1870
367 Ga0207670_10542498 3300025936 Bacteria 949
368 Ga0207670_11300592 3300025936 Unclassified 616
369 Ga0207704_10068888 3300025938 Unclassified 2233
370 Ga0207704_10194913 3300025938 Bacteria 1477
371 Ga0207704_10582903 3300025938 Bacteria 913
372 Ga0207665_11404822 3300025939 Bacteria 556
373 Ga0207691_10032717 3300025940 Bacteria 4846
374 Ga0207691_10204589 3300025940 Bacteria 1717
375 Ga0207691_10508235 3300025940 Bacteria 1023
376 Ga0207691_10670177 3300025940 Bacteria 876
377 Ga0207689_10008520 3300025942 Bacteria 8941
378 Ga0207689_10014292 3300025942 Bacteria 6756
379 Ga0207689_10023906 3300025942 Bacteria 5126
380 Ga0207689_10092180 3300025942 Bacteria 2489
381 Ga0207689_10109282 3300025942 Bacteria 2272
382 Ga0207661_10038385 3300025944 Bacteria 3753
383 Ga0207661_10091273 3300025944 Bacteria 2537
384 Ga0207661_10129032 3300025944 Bacteria 2163
385 Ga0207661_10322748 3300025944 Bacteria 1388
386 Ga0207661_10466779 3300025944 Unclassified 1151
387 Ga0207679_10003416 3300025945 Bacteria 9800
388 Ga0207679_10035643 3300025945 Bacteria 3522
389 Ga0207679_10339256 3300025945 Bacteria 1306
390 Ga0207679_11991986 3300025945 Bacteria 529
391 Ga0207667_10802407 3300025949 Bacteria 938
392 Ga0207651_10065746 3300025960 Bacteria 2545
393 Ga0207651_10135576 3300025960 Bacteria 1893
394 Ga0207651_11192446 3300025960 Bacteria 683
395 Ga0207651_11467557 3300025960 Bacteria 614
396 Ga0207712_10002804 3300025961 Bacteria 11154
397 Ga0207712_10015807 3300025961 Bacteria 4875
398 Ga0207712_10783192 3300025961 Bacteria 837
399 Ga0207668_10247622 3300025972 Unclassified 1446
400 Ga0207668_12138369 3300025972 Bacteria 504
401 Ga0207640_10258294 3300025981 Unclassified 1356
402 Ga0207640_10939909 3300025981 Bacteria 757
403 Ga0207658_10069507 3300025986 Bacteria 2661
404 Ga0207658_10389839 3300025986 Bacteria 1222
405 Ga0207677_10075922 3300026023 Bacteria 2390
406 Ga0207677_10137320 3300026023 Bacteria 1866
407 Ga0207677_10224322 3300026023 Bacteria 1509
408 Ga0207677_10250134 3300026023 Bacteria 1439
409 Ga0207677_11295459 3300026023 Bacteria 669
410 Ga0207677_11817295 3300026023 Bacteria 566
411 Ga0207703_10190442 3300026035 Unclassified 1816
412 Ga0207703_10192393 3300026035 Bacteria 1808
413 Ga0207703_10402475 3300026035 Bacteria 1270
414 Ga0207703_10910725 3300026035 Bacteria 842
415 Ga0207639_10208852 3300026041 Unclassified 1679
416 Ga0207639_10246035 3300026041 Unclassified 1557
417 Ga0207678_10020400 3300026067 Bacteria 5812
418 Ga0207678_10285481 3300026067 Bacteria 1417
419 Ga0207678_10613217 3300026067 Bacteria 954
420 Ga0207708_10051447 3300026075 Bacteria 3136
421 Ga0207708_11378962 3300026075 Bacteria 618
422 Ga0207702_11585591 3300026078 Bacteria 648
423 Ga0207641_10000394 3300026088 Bacteria 51467
424 Ga0207641_10339900 3300026088 Bacteria 1428
425 Ga0207641_10428752 3300026088 Bacteria 1274
426 Ga0207641_10513005 3300026088 Bacteria 1165
427 Ga0207641_10522983 3300026088 Bacteria 1154
428 Ga0207648_10029517 3300026089 Bacteria 4863
429 Ga0207648_10042168 3300026089 Bacteria 4006
430 Ga0207648_10134746 3300026089 Bacteria 2175
431 Ga0207648_10463631 3300026089 Bacteria 1155
432 Ga0207648_10622220 3300026089 Bacteria 996
433 Ga0207648_11071624 3300026089 Bacteria 755
434 Ga0207676_10055828 3300026095 Bacteria 3103
435 Ga0207676_10058028 3300026095 Bacteria 3051
436 Ga0207676_10161574 3300026095 Bacteria 1941
437 Ga0207676_10358634 3300026095 Bacteria 1350
438 Ga0207676_10581625 3300026095 Bacteria 1073
439 Ga0207676_10611032 3300026095 Bacteria 1048
440 Ga0207674_10002768 3300026116 Bacteria 21856
441 Ga0207674_10063717 3300026116 Bacteria 3720
442 Ga0207674_10086254 3300026116 Bacteria 3134
443 Ga0207674_10134321 3300026116 Bacteria 2437
444 Ga0207674_10368853 3300026116 Bacteria 1388
445 Ga0207674_10867858 3300026116 Bacteria 870
446 Ga0207675_100048494 3300026118 Bacteria 3964
447 Ga0207675_100432348 3300026118 Unclassified 1302
448 Ga0207675_101164975 3300026118 Bacteria 791
449 Ga0207683_10001406 3300026121 Bacteria 21739
450 Ga0207683_10103636 3300026121 Bacteria 2542
451 Ga0207683_10904476 3300026121 Unclassified 819
452 Ga0207698_10018430 3300026142 Bacteria 4756
453 Ga0207698_10063590 3300026142 Bacteria 2889
454 Ga0207698_10191445 3300026142 Bacteria 1822
455 Ga0207698_10373783 3300026142 Bacteria 1354
456 Ga0207698_10421759 3300026142 Bacteria 1280
457 Ga0207698_10468583 3300026142 Unclassified 1219
458 Ga0207698_10848730 3300026142 Bacteria 918
459 Ga0209981_1014380 3300027378 Bacteria 1103
460 Ga0209968_1063169 3300027526 Unclassified 654
461 Ga0268266_10161049 3300028379 Bacteria 2030
462 Ga0268266_11334767 3300028379 Unclassified 693
463 Ga0268265_10388972 3300028380 Unclassified 1285
464 Ga0268265_10486695 3300028380 Bacteria 1160
465 Ga0268265_10755864 3300028380 Unclassified 944
466 Ga0268265_10879506 3300028380 Unclassified 878
467 Ga0268265_12275632 3300028380 Bacteria 549
468 Ga0268264_10021029 3300028381 Bacteria 5332
469 Ga0268264_10040412 3300028381 Bacteria 3854
470 Ga0268264_10834847 3300028381 Unclassified 922
471 Ga0268264_10835599 3300028381 Unclassified 922
472 Ga0265327_10025866 3300031251 Bacteria 3412
473 Ga0307509_10038932 3300031507 Bacteria 5182
474 Ga0307509_10719138 3300031507 Bacteria 665
475 Ga0307408_100401498 3300031548 Bacteria 1177
476 Ga0265313_10306247 3300031595 Bacteria 637
477 Ga0316576_10228923 3300031727 Bacteria 1398
478 Ga0316578_10318036 3300031728 Bacteria 929
479 Ga0316577_10008966 3300031733 Bacteria 5370
480 Ga0307410_10043611 3300031852 Bacteria 2974
481 Ga0307416_100743429 3300032002 Bacteria 1073
482 Ga0316585_10048630 3300032137 Bacteria 1359
483 Ga0373953_0155747 3300035117 Bacteria 981
484 Ga0373955_0011907 3300035172 Bacteria 4166
485 Ga0373955_0714446 3300035172 Bacteria 615
486 Ga0373924_0242436 3300035410 Bacteria 797
487 Ga0373935_0157643 3300035692 Bacteria 1545
488 Ga0373933_0086726 3300035724 Bacteria 1927
489 Ga0373947_0254199 3300035725 Unclassified 1163
490 Ga0373947_0285370 3300035725 Bacteria 1098
491 Ga0373937_0004502 3300036401 Bacteria 11833
492 Ga0316582_0022059 3300036647 Bacteria 3774
493 Ga0316584_0015025 3300036712 Bacteria 5530
494 Ga0395899_0505014 3300037312 Bacteria 784
495 Ga0395905_0155078 3300037471 Bacteria 2154
496 Ga0439465_0009961 3300041413 Bacteria 2992
497 Ga0451789_0976914 3300041443 Bacteria 1039
498 Ga0451793_1589203 3300041452 Bacteria 1109
499 Ga0439441_004420 3300042001 Bacteria 2131
500 Ga0439454_015457 3300042011 Unclassified 1069
501 Ga0453683_0078117 3300044673 Bacteria 2073
502 Ga0495639_0445110 3300046475 Unclassified 658
503 Ga0495662_0294996 3300046476 Unclassified 798
504 Ga0495608_0061078 3300046511 Bacteria 2479
505 Ga0495644_0140562 3300046523 Bacteria 922
506 Ga0495642_0168689 3300046528 Bacteria 951
507 Ga0495586_0181637 3300046535 Bacteria 1190
508 Ga0495598_0334144 3300046537 Bacteria 580
509 Ga0495599_0136893 3300046678 Bacteria 1520
510 Ga0495624_0457308 3300046690 Bacteria 765
511 Ga0495670_0261971 3300046691 Bacteria 923
512 Ga0495600_0761782 3300046809 Unclassified 579
513 Ga0495674_1194376 3300047319 Bacteria 575
514 Ga0495676_0022930 3300047321 Bacteria 5425
515 Ga0495686_0226498 3300047472 Bacteria 1061
516 Ga0496104_0854035 3300048907 Unclassified 816
517 Ga0496110_0206585 3300048913 Bacteria 1785
518 Ga0496111_0897627 3300048914 Bacteria 638
519 Ga0501270_090055 3300049767 Bacteria 625
520 nmdc:mga05p37_257087_c1 3300050507 Bacteria 2092
521 nmdc:mga05p37_715351_c1 3300050507 Unclassified 1110
522 nmdc:mga09592_520928_c1 3300050508 Bacteria 1023
523 nmdc:mga0qj67_68111_c1 3300050509 Bacteria 2837
524 nmdc:mga06r32_353534_c1 3300050510 Bacteria 1454
525 nmdc:mga08y16_442458_c1 3300050511 Bacteria 1326
526 nmdc:mga08y16_607934_c1 3300050511 Bacteria 1101
527 nmdc:mga0n895_162704_c1 3300050512 Unclassified 2263
528 nmdc:mga0n895_486457_c1 3300050512 Bacteria 1244
529 Ga0070683_100003921
530 rootL2_10121209
531 rootL2_10380535
532 Ga0065704_10110517
533 Ga0065704_10174398
534 Ga0065704_10350589
535 Ga0065704_10781763
536 Ga0065712_10006679
537 Ga0065712_10304229
538 Ga0065715_10127629
539 Ga0065715_10808926
540 Ga0065707_10336952
541 Ga0070658_10566207
542 Ga0070676_10042064
543 Ga0070676_10100479
544 Ga0070676_11320785
545 Ga0070683_100006131
546 Ga0070683_100083308
547 Ga0070683_100311440
548 Ga0070683_100443105
549 Ga0070690_100031153
550 Ga0070690_100230523
551 Ga0070690_100603174
552 Ga0070670_100155216
553 Ga0070670_100748940
554 Ga0070670_102147397
555 Ga0070677_10070792
556 Ga0070677_10436374
557 Ga0068869_100022072
558 Ga0068869_100027043
559 Ga0068869_100029417
560 Ga0068869_100036090
561 Ga0068869_100164000
562 Ga0068869_100754101
563 Ga0070666_10110617
564 Ga0070666_10150504
565 Ga0070666_10728811
566 Ga0070682_100042105
567 Ga0068868_100001962
568 Ga0068868_100110602
569 Ga0068868_100124256
570 Ga0068868_100282731
571 Ga0068868_102171804
572 Ga0070660_100697396
573 Ga0070689_100003233
574 Ga0070689_100025238
575 Ga0070689_100086757
576 Ga0070689_100213534
577 Ga0070689_100997226
578 Ga0070687_100303603
579 Ga0070661_100010040
580 Ga0070661_100133335
581 Ga0070661_100932149
582 Ga0070661_100990934
583 Ga0070661_101261053
584 Ga0070668_100359885
585 Ga0070669_100136658
586 Ga0070669_100286317
587 Ga0070669_100308864
588 Ga0070669_100793255
589 Ga0070675_100037929
590 Ga0070675_100090260
591 Ga0070675_100124752
592 Ga0070675_100160262
593 Ga0070675_100396811
594 Ga0070675_100928179
595 Ga0070671_100037530
596 Ga0070671_100115357
597 Ga0070671_100280124
598 Ga0070673_100269159
599 Ga0070673_100981931
600 Ga0070688_100062258
601 Ga0070688_100128554
602 Ga0070688_100213391
603 Ga0070688_100265748
604 Ga0070659_100026506
605 Ga0070659_100843948
606 Ga0070659_101037591
607 Ga0070667_100156848
608 Ga0070667_100226160
609 Ga0070667_100238895
610 Ga0070667_100551595
611 Ga0070667_100624098
612 Ga0070701_10259002
613 Ga0070701_11346760
614 Ga0070705_100539647
615 Ga0070705_100579533
616 Ga0070700_100108676
617 Ga0070663_100266202
618 Ga0070663_100427473
619 Ga0070663_101136042
620 Ga0070678_100030276
621 Ga0070678_101249055
622 Ga0070678_101264380
623 Ga0070662_100021345
624 Ga0070662_100040464
625 Ga0070662_100053379
626 Ga0070662_100068677
627 Ga0068867_100214438
628 Ga0068867_100377450
629 Ga0068867_100449483
630 Ga0068867_100829967
631 Ga0070685_10013974
632 Ga0070685_10042404
633 Ga0070685_10075641
634 Ga0070685_10221580
635 Ga0070706_101225059
636 Ga0070698_100064272
637 Ga0070684_100005547
638 Ga0070684_100007787
639 Ga0070684_100520613
640 Ga0070697_101380971
641 Ga0068853_100009368
642 Ga0068853_100773707
643 Ga0068853_101210349
644 Ga0070672_100296588
645 Ga0070672_100927263
646 Ga0070672_101832827
647 Ga0070686_100147373
648 Ga0070686_100378594
649 Ga0070665_100117774
650 Ga0070665_100140556
651 Ga0070665_100548772
652 Ga0070665_100701401
653 Ga0070665_101070954
654 Ga0070704_100609163
655 Ga0070664_100002349
656 Ga0070664_100003069
657 Ga0070664_100278842
658 Ga0070664_100515600
659 Ga0070664_100613335
660 Ga0068857_100005320
661 Ga0068857_100247253
662 Ga0068857_100704456
663 Ga0068854_100308832
664 Ga0068854_100598934
665 Ga0070702_100526687
666 Ga0068852_100027217
667 Ga0068852_100149899
668 Ga0068852_100314437
669 Ga0068852_100714487
670 Ga0068852_101606709
671 Ga0068859_100004125
672 Ga0068859_100025734
673 Ga0068859_100043765
674 Ga0068859_100090705
675 Ga0068859_100137450
676 Ga0068859_100246453
677 Ga0068859_100280490
678 Ga0068859_100584939
679 Ga0068859_101888383
680 Ga0068864_100017816
681 Ga0068864_100097442
682 Ga0068864_100098925
683 Ga0068864_100302110
684 Ga0068864_100610735
685 Ga0068864_100624205
686 Ga0068864_101139226
687 Ga0068864_102069302
688 Ga0068866_10004750
689 Ga0068861_100041368
690 Ga0068861_100412269
691 Ga0068861_100708183
692 Ga0068851_10131856
693 Ga0068870_10137166
694 Ga0068870_10261012
695 Ga0068863_100427252
696 Ga0068863_100707597
697 Ga0068863_100860410
698 Ga0068858_100101862
699 Ga0068858_100106517
700 Ga0068858_100112306
701 Ga0068858_100151364
702 Ga0068858_101118136
703 Ga0068858_101315719
704 Ga0068860_100014161
705 Ga0068860_100062175
706 Ga0068860_100187260
707 Ga0068860_100428428
708 Ga0068860_100877561
709 Ga0068860_101976328
710 Ga0068862_100135791
711 Ga0068862_100383085
712 Ga0068862_101529680
713 Ga0070715_10601317
714 Ga0075427_10020962
715 Ga0097621_100047197
716 Ga0097621_100247737
717 Ga0097621_100667142
718 Ga0097621_100832281
719 Ga0097621_101304104
720 Ga0068871_100038641
721 Ga0068871_100149183
722 Ga0068871_100327302
723 Ga0068871_100555260
724 Ga0068871_101660334
725 Ga0075428_100019960
726 Ga0075428_100164168
727 Ga0075428_100602176
728 Ga0075430_100015046
729 Ga0075431_100259046
730 Ga0075434_100023016
731 Ga0075434_100507227
732 Ga0075434_101465854
733 Ga0075434_101853514
734 Ga0075429_100103876
735 Ga0075429_101694626
736 Ga0068865_100338215
737 Ga0068865_100490268
738 Ga0068865_101555644
739 Ga0097620_100004125
740 Ga0097620_100025733
741 Ga0097620_100043765
742 Ga0097620_100090704
743 Ga0097620_100137460
744 Ga0097620_100246458
745 Ga0097620_100280506
746 Ga0097620_100584900
747 Ga0097620_101888351
748 Ga0105251_10125513
749 Ga0105251_10157983
750 Ga0111539_12534370
751 Ga0105245_11384595
752 Ga0114129_10151560
753 Ga0114129_10867190
754 Ga0105241_10178095
755 Ga0105241_10326618
756 Ga0105241_10446369
757 Ga0105241_11125758
758 Ga0105242_10054894
759 Ga0105242_10070215
760 Ga0105242_10155752
761 Ga0105242_10852973
762 Ga0105242_11008309
763 Ga0105237_10313494
764 Ga0105249_10000406
765 Ga0105249_10001153
766 Ga0105249_10006136
767 Ga0105249_10798656
768 Ga0105249_11343233
769 Ga0105249_11947754
770 Ga0105246_11013276
771 Ga0157373_10736277
772 Ga0157373_11401312
773 Ga0157373_11495407
774 Ga0157371_10134192
775 Ga0157371_10441319
776 Ga0157370_10048893
777 Ga0157370_10765012
778 Ga0157369_10172139
779 Ga0157369_11477682
780 Ga0157374_10002603
781 Ga0157374_10004203
782 Ga0157374_10116045
783 Ga0157374_10206151
784 Ga0157378_10083969
785 Ga0157378_10211888
786 Ga0163162_10017132
787 Ga0163162_10033883
788 Ga0163162_10093536
789 Ga0163162_10458131
790 Ga0163162_10471106
791 Ga0163162_10944317
792 Ga0163162_11160236
793 Ga0163162_11477429
794 Ga0163162_12048584
795 Ga0157372_10043401
796 Ga0157372_10243486
797 Ga0157372_10265295
798 Ga0157372_10355540
799 Ga0157372_10567018
800 Ga0157372_10716602
801 Ga0157372_10849749
802 Ga0157375_10031699
803 Ga0157375_10049606
804 Ga0157375_10050994
805 Ga0157375_10075738
806 Ga0157375_10155359
807 Ga0157375_10209899
808 Ga0157375_10804060
809 Ga0163163_10001974
810 Ga0163163_10075870
811 Ga0163163_10190436
812 Ga0163163_10206905
813 Ga0163163_11119122
814 Ga0163163_11224774
815 Ga0163163_11245762
816 Ga0157380_10862647
817 Ga0157380_11298360
818 Ga0157380_11680921
819 Ga0157377_10019814
820 Ga0157377_10022052
821 Ga0157377_10025779
822 Ga0157377_10208320
823 Ga0157377_10242092
824 Ga0157379_10066045
825 Ga0157379_10082050
826 Ga0157379_10406386
827 Ga0157379_12180418
828 Ga0157376_10017401
829 Ga0157376_10038159
830 Ga0157376_10367722
831 Ga0157376_10557298
832 Ga0157376_11084491
833 Ga0157376_11555241
834 Ga0157376_12444203
835 Ga0163161_10010770
836 Ga0163161_10233103
837 Ga0163161_10250796
838 Ga0163161_11723292
839 Ga0207666_1017167
840 Ga0207697_10285777
841 Ga0207713_1182290
842 Ga0207713_1232663
843 Ga0207682_10168436
844 Ga0207642_10050890
845 Ga0207642_10730698
846 Ga0207688_10102323
847 Ga0207680_10031233
848 Ga0207680_10096754
849 Ga0207680_10299170
850 Ga0207647_10000532
851 Ga0207647_10038030
852 Ga0207685_10505515
853 Ga0207645_10702332
854 Ga0207643_10121937
855 Ga0207643_10533663
856 Ga0207654_10714375
857 Ga0207662_10380155
858 Ga0207657_10173177
859 Ga0207649_10017776
860 Ga0207649_10244009
861 Ga0207649_10386952
862 Ga0207649_10648770
863 Ga0207649_11118384
864 Ga0207646_10161401
865 Ga0207681_10286295
866 Ga0207681_10495949
867 Ga0207681_10496250
868 Ga0207681_10572853
869 Ga0207650_10047013
870 Ga0207650_10175879
871 Ga0207650_10626215
872 Ga0207659_10089847
873 Ga0207659_10339556
874 Ga0207659_10478525
875 Ga0207659_10626687
876 Ga0207659_10782462
877 Ga0207644_10096100
878 Ga0207644_10212186
879 Ga0207644_10318972
880 Ga0207644_10928483
881 Ga0207690_10020181
882 Ga0207690_10181716
883 Ga0207690_10638768
884 Ga0207690_11021628
885 Ga0207706_10002223
886 Ga0207706_10043302
887 Ga0207706_10123537
888 Ga0207706_10178786
889 Ga0207686_10008317
890 Ga0207686_10241814
891 Ga0207686_10258177
892 Ga0207670_10037359
893 Ga0207670_10039054
894 Ga0207670_10125772
895 Ga0207670_10542498
896 Ga0207670_11300592
897 Ga0207704_10068888
898 Ga0207704_10194913
899 Ga0207704_10582903
900 Ga0207665_11404822
901 Ga0207691_10032717
902 Ga0207691_10204589
903 Ga0207691_10508235
904 Ga0207691_10670177
905 Ga0207689_10008520
906 Ga0207689_10014292
907 Ga0207689_10023906
908 Ga0207689_10092180
909 Ga0207689_10109282
910 Ga0207661_10038385
911 Ga0207661_10091273
912 Ga0207661_10129032
913 Ga0207661_10322748
914 Ga0207661_10466779
915 Ga0207679_10003416
916 Ga0207679_10035643
917 Ga0207679_10339256
918 Ga0207679_11991986
919 Ga0207667_10802407
920 Ga0207651_10065746
921 Ga0207651_10135576
922 Ga0207651_11192446
923 Ga0207651_11467557
924 Ga0207712_10002804
925 Ga0207712_10015807
926 Ga0207712_10783192
927 Ga0207668_10247622
928 Ga0207668_12138369
929 Ga0207640_10258294
930 Ga0207640_10939909
931 Ga0207658_10069507
932 Ga0207658_10389839
933 Ga0207677_10075922
934 Ga0207677_10137320
935 Ga0207677_10224322
936 Ga0207677_10250134
937 Ga0207677_11295459
938 Ga0207677_11817295
939 Ga0207703_10190442
940 Ga0207703_10192393
941 Ga0207703_10402475
942 Ga0207703_10910725
943 Ga0207639_10208852
944 Ga0207639_10246035
945 Ga0207678_10020400
946 Ga0207678_10285481
947 Ga0207678_10613217
948 Ga0207708_10051447
949 Ga0207708_11378962
950 Ga0207702_11585591
951 Ga0207641_10000394
952 Ga0207641_10339900
953 Ga0207641_10428752
954 Ga0207641_10513005
955 Ga0207641_10522983
956 Ga0207648_10029517
957 Ga0207648_10042168
958 Ga0207648_10134746
959 Ga0207648_10463631
960 Ga0207648_10622220
961 Ga0207648_11071624
962 Ga0207676_10055828
963 Ga0207676_10058028
964 Ga0207676_10161574
965 Ga0207676_10358634
966 Ga0207676_10581625
967 Ga0207676_10611032
968 Ga0207674_10002768
969 Ga0207674_10063717
970 Ga0207674_10086254
971 Ga0207674_10134321
972 Ga0207674_10368853
973 Ga0207674_10867858
974 Ga0207675_100048494
975 Ga0207675_100432348
976 Ga0207675_101164975
977 Ga0207683_10001406
978 Ga0207683_10103636
979 Ga0207683_10904476
980 Ga0207698_10018430
981 Ga0207698_10063590
982 Ga0207698_10191445
983 Ga0207698_10373783
984 Ga0207698_10421759
985 Ga0207698_10468583
986 Ga0207698_10848730
987 Ga0209981_1014380
988 Ga0209968_1063169
989 Ga0268266_10161049
990 Ga0268266_11334767
991 Ga0268265_10388972
992 Ga0268265_10486695
993 Ga0268265_10755864
994 Ga0268265_10879506
995 Ga0268265_12275632
996 Ga0268264_10021029
997 Ga0268264_10040412
998 Ga0268264_10834847
999 Ga0268264_10835599
1000 Ga0265327_10025866
1001 Ga0307509_10038932
1002 Ga0307509_10719138
1003 Ga0307408_100401498
1004 Ga0265313_10306247
1005 Ga0316576_10228923
1006 Ga0316578_10318036
1007 Ga0316577_10008966
1008 Ga0307410_10043611
1009 Ga0307416_100743429
1010 Ga0316585_10048630
1011 Ga0373953_0155747
1012 Ga0373955_0011907
1013 Ga0373955_0714446
1014 Ga0373924_0242436
1015 Ga0373935_0157643
1016 Ga0373933_0086726
1017 Ga0373947_0254199
1018 Ga0373947_0285370
1019 Ga0373937_0004502
1020 Ga0316582_0022059
1021 Ga0316584_0015025
1022 Ga0395899_0505014
1023 Ga0395905_0155078
1024 Ga0439465_0009961
1025 Ga0451789_0976914
1026 Ga0451793_1589203
1027 Ga0439441_004420
1028 Ga0439454_015457
1029 Ga0453683_0078117
1030 Ga0495639_0445110
1031 Ga0495662_0294996
1032 Ga0495608_0061078
1033 Ga0495644_0140562
1034 Ga0495642_0168689
1035 Ga0495586_0181637
1036 Ga0495598_0334144
1037 Ga0495599_0136893
1038 Ga0495624_0457308
1039 Ga0495670_0261971
1040 Ga0495600_0761782
1041 Ga0495674_1194376
1042 Ga0495676_0022930
1043 Ga0495686_0226498
1044 Ga0496104_0854035
1045 Ga0496110_0206585
1046 Ga0496111_0897627
1047 Ga0501270_090055
1048 nmdc:mga05p37_257087_c1
1049 nmdc:mga05p37_715351_c1
1050 nmdc:mga09592_520928_c1
1051 nmdc:mga0qj67_68111_c1
1052 nmdc:mga06r32_353534_c1
1053 nmdc:mga08y16_442458_c1
1054 nmdc:mga08y16_607934_c1
1055 nmdc:mga0n895_162704_c1
1056 nmdc:mga0n895_486457_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

26

156

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9139 1 138
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9115 1 138
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9105 3 136
4ntm-assembly1.cif.gz_A qued soaked with sepiapterin (selenomethionine substituted protein) 0.9072 3 136
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8982 5 135
ID Description Score Start End Superfamily
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9083 5 136 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9062 1 138 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8999 1 138 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8892 3 136 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8877 2 138 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A090X5N0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9763 64 138 GO:0046872
GO:0070497
AF-A0A381S0C9-F1-model_v4 6-pyruvoyl tetrahydrobiopterin synthase 0.9714 54 138 GO:0016829
GO:0046872
AF-A0A090X5N0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9636 64 138 GO:0046872
GO:0070497
AF-A0A350BT81-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.963 42 138 GO:0046872
GO:0070497
AF-A0A1K1PN93-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9623 3 136 GO:0008616
GO:0046872
GO:0070497

Map