F459646

General Info

Members Datasets Scaffolds Average Seq Length
528 211 1056 259

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100298318|Ga0068852_1002983181
Length 292
Sequence MDIPIRPLPALFLSHGSPMLALEPGATGHFLQQLGPAIDQAFGRPRAILAVSAHTTARVPVLLAGAQHREVHDFGGFPDALFQLRYRPPGAPALAGEVAACLASAGVAARSVNEGGLDHGIWSMLRFMYPDADVPVLPLAWMPGAPPAEQFALGEALAPLRAQGVLLMGTGSITHNLRRIFSAGAPERDAVEITESREFRAWFAERGAARDWDRLWDYRRQAPHAADMHPTDEHLLPWFVAAGSGGREATPLRLHDGVTYGCLGMDAYAFGESAARLAQHLPPSSTGAGQAR

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
38 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
64 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
86 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
87 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
88 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
89 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
90 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
91 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
92 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
173 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
174 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
189 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
190 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
193 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
194 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
195 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
196 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
197 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
198 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
199 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
200 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
201 2738541280 Massilia sp. GV090 Isolate Unclassified
202 2738541297 Duganella sp. GV083 Isolate Unclassified
203 2738541357 Duganella sp. GV053 Isolate Unclassified
204 2738543003 Duganella sp. GV066 Isolate Unclassified
205 2738543026 Duganella sp. GV089 Isolate Unclassified
206 2738543029 Duganella sp. GV039 Isolate Unclassified
207 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
208 2842682962 Bacillus sp. R-72492 Isolate Unclassified
209 2849139964 Bacillus sp. R-71875 Isolate Unclassified
210 2857581216 Bacillus sp. R-71922 Isolate Unclassified
211 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0
Isolates 3.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0.38
Rhizoplane 1.14
Rhizosphere 82.2
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100298318 3300005616 Bacteria 1559
2 JGI24740J21852_10018001 3300001979 Bacteria 2516
3 JGI24739J22299_10023619 3300001989 Bacteria 2171
4 JGI25151J46595_10013357 3300003187 Bacteria 3697
5 JGI25153J46596_10004031 3300003215 Bacteria 8011
6 JGI25153J46596_10031434 3300003215 Bacteria 1787
7 rootL2_10137477 3300003322 Bacteria 1500
8 Ga0055526_1010965 3300003771 Bacteria 4146
9 Ga0055524_1000233 3300003775 Bacteria 58967
10 Ga0055530_10000758 3300003791 Bacteria 26817
11 Ga0055540_1000080 3300003792 Bacteria 111063
12 Ga0065165_1005423 3300005262 Bacteria 7180
13 Ga0070661_100002124 3300005344 Bacteria 13661
14 Ga0070659_100001740 3300005366 Bacteria 15646
15 Ga0070663_100238995 3300005455 Bacteria 1433
16 Ga0070663_100398231 3300005455 Bacteria 1125
17 Ga0068853_100029161 3300005539 Bacteria 4649
18 Ga0068853_100077324 3300005539 Bacteria 2907
19 Ga0068855_100172283 3300005563 Bacteria 2450
20 Ga0070664_100004314 3300005564 Bacteria 11432
21 Ga0068857_100039597 3300005577 Bacteria 4175
22 Ga0068857_100053285 3300005577 Bacteria 3589
23 Ga0068854_100077337 3300005578 Bacteria 2448
24 Ga0068854_100227424 3300005578 Bacteria 1479
25 Ga0068856_100042379 3300005614 Bacteria 4477
26 Ga0068856_100144833 3300005614 Bacteria 2383
27 Ga0068852_100006956 3300005616 Bacteria 8233
28 Ga0068851_10006649 3300005834 Bacteria 5289
29 Ga0075368_10020643 3300006042 Bacteria 2495
30 Ga0075368_10090557 3300006042 Bacteria 1251
31 Ga0075363_100018328 3300006048 Bacteria 3486
32 Ga0075363_100086239 3300006048 Bacteria 1723
33 Ga0075364_10103939 3300006051 Bacteria 1892
34 Ga0075362_10013240 3300006177 Bacteria 3298
35 Ga0075367_10007224 3300006178 Bacteria 5674
36 Ga0075367_10007323 3300006178 Bacteria 5643
37 Ga0075369_10009873 3300006186 Bacteria 3723
38 Ga0075369_10010697 3300006186 Bacteria 3595
39 Ga0075366_10132880 3300006195 Bacteria 1502
40 Ga0075370_10001889 3300006353 Bacteria 9407
41 Ga0079104_1000267 3300006946 Bacteria 68733
42 Ga0105240_10089772 3300009093 Bacteria 3758
43 Ga0105241_10088831 3300009174 Bacteria 2434
44 Ga0105237_10316434 3300009545 Bacteria 1564
45 Ga0105238_10004432 3300009551 Bacteria 13921
46 Ga0105238_10035858 3300009551 Bacteria 5042
47 Ga0105239_10069717 3300010375 Bacteria 3862
48 Ga0105239_10074831 3300010375 Bacteria 3724
49 Ga0157379_10593546 3300014968 Bacteria 1033
50 Ga0183360_10001 3300015689 Bacteria 3943671
51 Ga0207425_1002947 3300025245 Bacteria 5695
52 Ga0209129_1000043 3300025258 Bacteria 298978
53 Ga0209673_1004179 3300025273 Bacteria 7882
54 Ga0209675_1014907 3300025291 Bacteria 2339
55 Ga0209025_1007958 3300025294 Bacteria 7756
56 Ga0209564_1000014 3300025295 Bacteria 621501
57 Ga0209758_1000307 3300025297 Bacteria 95192
58 Ga0209758_1000492 3300025297 Bacteria 64511
59 Ga0209050_1000493 3300025298 Bacteria 67885
60 Ga0209050_1000739 3300025298 Bacteria 47380
61 Ga0209050_1028009 3300025298 Bacteria 1840
62 Ga0209256_1000203 3300025299 Bacteria 112500
63 Ga0209051_1000035 3300025303 Bacteria 346999
64 Ga0209257_1000346 3300025304 Bacteria 95662
65 Ga0207656_10160266 3300025321 Bacteria 1070
66 Ga0207654_10001596 3300025911 Bacteria 11905
67 Ga0207695_10000497 3300025913 Bacteria 83894
68 Ga0207695_10196716 3300025913 Bacteria 1932
69 Ga0207649_10001856 3300025920 Bacteria 12074
70 Ga0207694_10003968 3300025924 Bacteria 11669
71 Ga0207679_10007881 3300025945 Bacteria 6767
72 Ga0207667_10017824 3300025949 Bacteria 7983
73 Ga0207667_10238496 3300025949 Bacteria 1861
74 Ga0207667_10278918 3300025949 Bacteria 1708
75 Ga0207640_10021731 3300025981 Bacteria 3828
76 Ga0207640_10045704 3300025981 Bacteria 2813
77 Ga0207639_10060313 3300026041 Bacteria 2926
78 Ga0207678_10042049 3300026067 Bacteria 3961
79 Ga0207702_10001920 3300026078 Bacteria 20319
80 Ga0207676_10328406 3300026095 Bacteria 1407
81 Ga0207674_10003184 3300026116 Bacteria 20210
82 Ga0207674_10005049 3300026116 Bacteria 15751
83 Ga0207698_10241410 3300026142 Bacteria 1647
84 Ga0209281_1000076 3300027111 Bacteria 263350
85 Ga0209974_10004710 3300027876 Bacteria 4846
86 Ga0307515_10000232 3300028794 Bacteria 137778
87 Ga0307515_10004630 3300028794 Bacteria 28261
88 Ga0307515_10022661 3300028794 Bacteria 11055
89 Ga0265330_10011185 3300031235 Bacteria 4213
90 Ga0265332_10002259 3300031238 Bacteria 9879
91 Ga0265332_10019421 3300031238 Bacteria 2999
92 Ga0265328_10035630 3300031239 Bacteria 1840
93 Ga0265325_10055729 3300031241 Bacteria 2020
94 Ga0265329_10008772 3300031242 Bacteria 3813
95 Ga0265340_10004855 3300031247 Bacteria 7477
96 Ga0265339_10004680 3300031249 Bacteria 9291
97 Ga0265339_10022358 3300031249 Bacteria 3665
98 Ga0265331_10004561 3300031250 Bacteria 8621
99 Ga0265331_10022461 3300031250 Bacteria 3218
100 Ga0265327_10003970 3300031251 Bacteria 13507
101 Ga0265316_10057111 3300031344 Bacteria 3045
102 Ga0265313_10045132 3300031595 Bacteria 2147
103 Ga0307508_10001933 3300031616 Bacteria 22733
104 Ga0307514_10001048 3300031649 Bacteria 39659
105 Ga0265314_10031018 3300031711 Bacteria 3951
106 Ga0265342_10000210 3300031712 Bacteria 65961
107 Ga0307516_10010299 3300031730 Bacteria 10292
108 Ga0307507_10043893 3300033179 Bacteria 4429
109 Ga0436361_0883434 3300039447 Bacteria 1268
110 Ga0451807_1833390 3300041486 Bacteria 1627
111 Ga0451841_0922783 3300041498 Bacteria 2160
112 Ga0451845_0532962 3300041501 Bacteria 1847
113 Ga0451849_0172393 3300041505 Bacteria 1683
114 Ga0451843_0229425 3300041509 Bacteria 1155
115 Ga0450919_002169 3300042121 Bacteria 2557
116 Ga0450923_008095 3300042125 Bacteria 1798
117 Ga0450918_000766 3300042531 Bacteria 6794
118 Ga0495617_000012 3300046452 Bacteria 295916
119 Ga0495617_000129 3300046452 Bacteria 50053
120 Ga0495617_011437 3300046452 Bacteria 3027
121 Ga0495627_000007 3300046453 Bacteria 575915
122 Ga0495627_000118 3300046453 Bacteria 99480
123 Ga0495603_0081361 3300046455 Bacteria 1897
124 Ga0495603_0236403 3300046455 Bacteria 1053
125 Ga0495590_0006583 3300046457 Bacteria 4527
126 Ga0495590_0006631 3300046457 Bacteria 4512
127 Ga0495629_0077914 3300046459 Bacteria 2314
128 Ga0495629_0115771 3300046459 Bacteria 1868
129 Ga0495629_0140341 3300046459 Bacteria 1681
130 Ga0495638_0000621 3300046460 Bacteria 39333
131 Ga0495638_0001663 3300046460 Bacteria 19656
132 Ga0495638_0009045 3300046460 Bacteria 7021
133 Ga0495638_0093606 3300046460 Bacteria 1807
134 Ga0495638_0099563 3300046460 Bacteria 1739
135 Ga0495638_0190240 3300046460 Bacteria 1165
136 Ga0495653_0063220 3300046463 Bacteria 2794
137 Ga0495653_0075948 3300046463 Bacteria 2499
138 Ga0495653_0092966 3300046463 Bacteria 2201
139 Ga0495653_0165927 3300046463 Bacteria 1528
140 Ga0495650_0000213 3300046471 Bacteria 123910
141 Ga0495650_0000215 3300046471 Bacteria 122533
142 Ga0495650_0000289 3300046471 Bacteria 93255
143 Ga0495650_0033897 3300046471 Bacteria 2266
144 Ga0495580_0097491 3300046472 Bacteria 2045
145 Ga0495582_0004405 3300046473 Bacteria 7924
146 Ga0495605_0000072 3300046474 Bacteria 133731
147 Ga0495605_0004164 3300046474 Bacteria 8520
148 Ga0495605_0012668 3300046474 Bacteria 4670
149 Ga0495605_0023744 3300046474 Bacteria 3220
150 Ga0495605_0027241 3300046474 Bacteria 2962
151 Ga0495605_0058663 3300046474 Bacteria 1849
152 Ga0495605_0082097 3300046474 Bacteria 1506
153 Ga0495605_0113909 3300046474 Bacteria 1231
154 Ga0495584_0000173 3300046491 Bacteria 45316
155 Ga0495584_0000254 3300046491 Bacteria 38075
156 Ga0495584_0016136 3300046491 Bacteria 3810
157 Ga0495584_0021198 3300046491 Bacteria 3300
158 Ga0495584_0043103 3300046491 Bacteria 2278
159 Ga0495584_0060143 3300046491 Bacteria 1910
160 Ga0495584_0077698 3300046491 Bacteria 1669
161 Ga0495584_0079077 3300046491 Bacteria 1654
162 Ga0495584_0266830 3300046491 Bacteria 870
163 Ga0495585_0000032 3300046492 Bacteria 143439
164 Ga0495585_0000531 3300046492 Bacteria 36056
165 Ga0495585_0001223 3300046492 Bacteria 20807
166 Ga0495585_0001673 3300046492 Bacteria 16947
167 Ga0495585_0003418 3300046492 Bacteria 10738
168 Ga0495585_0007283 3300046492 Bacteria 6791
169 Ga0495585_0009059 3300046492 Bacteria 5996
170 Ga0495585_0038768 3300046492 Bacteria 2681
171 Ga0495585_0105838 3300046492 Bacteria 1500
172 Ga0495594_0075432 3300046499 Bacteria 1880
173 Ga0495594_0152638 3300046499 Bacteria 1311
174 Ga0495594_0195670 3300046499 Bacteria 1152
175 Ga0495596_0000029 3300046500 Bacteria 103615
176 Ga0495596_0000243 3300046500 Bacteria 36829
177 Ga0495596_0000309 3300046500 Bacteria 32084
178 Ga0495596_0000812 3300046500 Bacteria 18902
179 Ga0495596_0001063 3300046500 Bacteria 16319
180 Ga0495596_0001487 3300046500 Bacteria 13398
181 Ga0495596_0001613 3300046500 Bacteria 12829
182 Ga0495596_0002435 3300046500 Bacteria 10022
183 Ga0495596_0004066 3300046500 Bacteria 7200
184 Ga0495596_0016064 3300046500 Bacteria 3116
185 Ga0495596_0017551 3300046500 Bacteria 2960
186 Ga0495596_0017721 3300046500 Bacteria 2944
187 Ga0495607_0001726 3300046501 Bacteria 18722
188 Ga0495607_0001937 3300046501 Bacteria 17486
189 Ga0495607_0002294 3300046501 Bacteria 15726
190 Ga0495607_0005992 3300046501 Bacteria 8618
191 Ga0495607_0013962 3300046501 Bacteria 5245
192 Ga0495607_0032502 3300046501 Bacteria 3184
193 Ga0495607_0041812 3300046501 Bacteria 2720
194 Ga0495607_0063321 3300046501 Bacteria 2092
195 Ga0495607_0089220 3300046501 Bacteria 1674
196 Ga0495583_0000011 3300046506 Bacteria 350215
197 Ga0495583_0000014 3300046506 Bacteria 320136
198 Ga0495583_0000058 3300046506 Bacteria 200120
199 Ga0495583_0000519 3300046506 Bacteria 54774
200 Ga0495583_0002335 3300046506 Bacteria 16482
201 Ga0495583_0008962 3300046506 Bacteria 6035
202 Ga0495583_0028892 3300046506 Bacteria 2720
203 Ga0495583_0097019 3300046506 Bacteria 1262
204 Ga0495583_0124790 3300046506 Bacteria 1081
205 Ga0495606_0024447 3300046507 Bacteria 4353
206 Ga0495610_0000008 3300046512 Bacteria 622732
207 Ga0495616_0000034 3300046513 Bacteria 129394
208 Ga0495616_0000131 3300046513 Bacteria 65268
209 Ga0495616_0000195 3300046513 Bacteria 50559
210 Ga0495616_0000388 3300046513 Bacteria 34173
211 Ga0495616_0003312 3300046513 Bacteria 10345
212 Ga0495616_0012532 3300046513 Bacteria 4810
213 Ga0495616_0012807 3300046513 Bacteria 4746
214 Ga0495616_0019800 3300046513 Bacteria 3669
215 Ga0495616_0022267 3300046513 Bacteria 3423
216 Ga0495616_0142917 3300046513 Bacteria 1088
217 Ga0495616_0207127 3300046513 Bacteria 859
218 Ga0495631_0004538 3300046518 Bacteria 7376
219 Ga0495631_0004913 3300046518 Bacteria 7044
220 Ga0495631_0011769 3300046518 Bacteria 4291
221 Ga0495631_0017067 3300046518 Bacteria 3441
222 Ga0495631_0033906 3300046518 Bacteria 2290
223 Ga0495631_0046689 3300046518 Bacteria 1903
224 Ga0495631_0091506 3300046518 Bacteria 1309
225 Ga0495631_0132408 3300046518 Bacteria 1071
226 Ga0495631_0155985 3300046518 Bacteria 979
227 Ga0495631_0156627 3300046518 Bacteria 977
228 Ga0495631_0159401 3300046518 Bacteria 968
229 Ga0495632_0000033 3300046519 Bacteria 164240
230 Ga0495632_0000056 3300046519 Bacteria 124483
231 Ga0495632_0000086 3300046519 Bacteria 95327
232 Ga0495632_0000156 3300046519 Bacteria 70702
233 Ga0495632_0000853 3300046519 Bacteria 26790
234 Ga0495632_0030366 3300046519 Bacteria 2805
235 Ga0495632_0050249 3300046519 Bacteria 2057
236 Ga0495632_0118471 3300046519 Bacteria 1238
237 Ga0495637_0001006 3300046520 Bacteria 17776
238 Ga0495637_0001806 3300046520 Bacteria 12251
239 Ga0495637_0010650 3300046520 Bacteria 4439
240 Ga0495637_0016498 3300046520 Bacteria 3451
241 Ga0495637_0057590 3300046520 Bacteria 1605
242 Ga0495643_0000330 3300046522 Bacteria 65068
243 Ga0495643_0000742 3300046522 Bacteria 37024
244 Ga0495643_0006905 3300046522 Bacteria 7391
245 Ga0495643_0010736 3300046522 Bacteria 5625
246 Ga0495643_0014186 3300046522 Bacteria 4746
247 Ga0495643_0039385 3300046522 Bacteria 2585
248 Ga0495643_0044213 3300046522 Bacteria 2421
249 Ga0495643_0054120 3300046522 Bacteria 2150
250 Ga0495643_0068565 3300046522 Bacteria 1866
251 Ga0495644_0000156 3300046523 Bacteria 32480
252 Ga0495644_0002270 3300046523 Bacteria 7688
253 Ga0495644_0012721 3300046523 Bacteria 3235
254 Ga0495644_0016028 3300046523 Bacteria 2871
255 Ga0495644_0055511 3300046523 Bacteria 1488
256 Ga0495648_0000116 3300046524 Bacteria 98123
257 Ga0495648_0000505 3300046524 Bacteria 41982
258 Ga0495648_0001000 3300046524 Bacteria 29021
259 Ga0495648_0003863 3300046524 Bacteria 12994
260 Ga0495648_0004157 3300046524 Bacteria 12444
261 Ga0495648_0005481 3300046524 Bacteria 10528
262 Ga0495648_0007837 3300046524 Bacteria 8495
263 Ga0495648_0051221 3300046524 Bacteria 2517
264 Ga0495648_0058659 3300046524 Bacteria 2300
265 Ga0495666_0029471 3300046526 Bacteria 2700
266 Ga0495666_0046545 3300046526 Bacteria 2091
267 Ga0495642_0000010 3300046528 Bacteria 136557
268 Ga0495642_0000218 3300046528 Bacteria 33005
269 Ga0495642_0000293 3300046528 Bacteria 28229
270 Ga0495642_0000459 3300046528 Bacteria 21479
271 Ga0495642_0011323 3300046528 Bacteria 3426
272 Ga0495642_0014391 3300046528 Bacteria 3065
273 Ga0495642_0023055 3300046528 Bacteria 2456
274 Ga0495642_0042907 3300046528 Bacteria 1844
275 Ga0495642_0080970 3300046528 Bacteria 1367
276 Ga0495654_0000058 3300046530 Bacteria 139884
277 Ga0495654_0004332 3300046530 Bacteria 8458
278 Ga0495654_0005595 3300046530 Bacteria 7271
279 Ga0495654_0067647 3300046530 Bacteria 1700
280 Ga0495665_0001347 3300046531 Bacteria 13125
281 Ga0495665_0015551 3300046531 Bacteria 4096
282 Ga0495586_0006821 3300046535 Bacteria 6089
283 Ga0495586_0014783 3300046535 Bacteria 4149
284 Ga0495587_0001570 3300046536 Bacteria 15194
285 Ga0495587_0105069 3300046536 Bacteria 1625
286 Ga0495609_0000044 3300046538 Bacteria 161642
287 Ga0495609_0000690 3300046538 Bacteria 26016
288 Ga0495609_0003410 3300046538 Bacteria 9117
289 Ga0495609_0007564 3300046538 Bacteria 5401
290 Ga0495609_0008735 3300046538 Bacteria 4937
291 Ga0495609_0045470 3300046538 Bacteria 1967
292 Ga0495609_0064124 3300046538 Bacteria 1621
293 Ga0495609_0119254 3300046538 Bacteria 1135
294 Ga0495597_0000196 3300046542 Bacteria 55404
295 Ga0495597_0002234 3300046542 Bacteria 12647
296 Ga0495597_0007050 3300046542 Bacteria 5754
297 Ga0495597_0008667 3300046542 Bacteria 5083
298 Ga0495597_0016905 3300046542 Bacteria 3441
299 Ga0495597_0120129 3300046542 Bacteria 1096
300 Ga0495597_0248308 3300046542 Bacteria 700
301 Ga0495622_0000167 3300046557 Bacteria 54264
302 Ga0495622_0001500 3300046557 Bacteria 11667
303 Ga0495622_0012995 3300046557 Bacteria 3863
304 Ga0495622_0047983 3300046557 Bacteria 1984
305 Ga0495633_0000703 3300046558 Bacteria 30527
306 Ga0495633_0001090 3300046558 Bacteria 21918
307 Ga0495633_0015052 3300046558 Bacteria 4021
308 Ga0495633_0023232 3300046558 Bacteria 3073
309 Ga0495633_0023994 3300046558 Bacteria 3018
310 Ga0495633_0042261 3300046558 Bacteria 2166
311 Ga0495633_0070457 3300046558 Bacteria 1632
312 Ga0495656_0000077 3300046615 Bacteria 43853
313 Ga0495656_0031426 3300046615 Bacteria 2153
314 Ga0495656_0040277 3300046615 Bacteria 1946
315 Ga0495656_0097851 3300046615 Bacteria 1352
316 Ga0495656_0309966 3300046615 Bacteria 811
317 Ga0495668_0000193 3300046616 Bacteria 89740
318 Ga0495668_0000532 3300046616 Bacteria 47353
319 Ga0495668_0002189 3300046616 Bacteria 16712
320 Ga0495668_0007214 3300046616 Bacteria 7138
321 Ga0495668_0013762 3300046616 Bacteria 4761
322 Ga0495668_0093539 3300046616 Bacteria 1646
323 Ga0495668_0134649 3300046616 Bacteria 1352
324 Ga0495668_0296964 3300046616 Bacteria 885
325 Ga0495611_0000850 3300046648 Bacteria 16737
326 Ga0495611_0002207 3300046648 Bacteria 9048
327 Ga0495611_0002540 3300046648 Bacteria 8294
328 Ga0495611_0023938 3300046648 Bacteria 2653
329 Ga0495611_0195302 3300046648 Bacteria 944
330 Ga0495625_0010704 3300046660 Bacteria 7554
331 Ga0495625_0014629 3300046660 Bacteria 6252
332 Ga0495625_0017544 3300046660 Bacteria 5604
333 Ga0495625_0048384 3300046660 Bacteria 3062
334 Ga0495625_0087641 3300046660 Bacteria 2158
335 Ga0495625_0099607 3300046660 Bacteria 1998
336 Ga0495625_0113126 3300046660 Bacteria 1854
337 Ga0495625_0169509 3300046660 Bacteria 1458
338 Ga0495625_0178259 3300046660 Bacteria 1415
339 Ga0495635_0010634 3300046663 Bacteria 6441
340 Ga0495659_0000003 3300046664 Bacteria 169166
341 Ga0495659_0000041 3300046664 Bacteria 59124
342 Ga0495659_0000538 3300046664 Bacteria 14018
343 Ga0495659_0007813 3300046664 Bacteria 3391
344 Ga0495661_0000426 3300046665 Bacteria 44529
345 Ga0495661_0002490 3300046665 Bacteria 14173
346 Ga0495661_0006243 3300046665 Bacteria 8379
347 Ga0495661_0017956 3300046665 Bacteria 4662
348 Ga0495661_0018907 3300046665 Bacteria 4522
349 Ga0495661_0020199 3300046665 Bacteria 4352
350 Ga0495661_0021810 3300046665 Bacteria 4170
351 Ga0495661_0031061 3300046665 Bacteria 3395
352 Ga0495661_0032380 3300046665 Bacteria 3305
353 Ga0495661_0045891 3300046665 Bacteria 2670
354 Ga0495661_0051794 3300046665 Bacteria 2477
355 Ga0495661_0200583 3300046665 Bacteria 1045
356 Ga0495588_0002966 3300046674 Bacteria 7332
357 Ga0495588_0041029 3300046674 Bacteria 2362
358 Ga0495588_0044110 3300046674 Bacteria 2283
359 Ga0495588_0172954 3300046674 Bacteria 1142
360 Ga0495588_0254507 3300046674 Bacteria 925
361 Ga0495669_0000017 3300046684 Bacteria 131447
362 Ga0495669_0000203 3300046684 Bacteria 36277
363 Ga0495669_0005584 3300046684 Bacteria 5246
364 Ga0495669_0031229 3300046684 Bacteria 2339
365 Ga0495669_0045923 3300046684 Bacteria 1948
366 Ga0495669_0050410 3300046684 Bacteria 1866
367 Ga0495613_0053263 3300046689 Bacteria 2978
368 Ga0495613_0220703 3300046689 Bacteria 1331
369 Ga0495624_0015547 3300046690 Bacteria 5136
370 Ga0495670_0000076 3300046691 Bacteria 43635
371 Ga0495670_0000460 3300046691 Bacteria 19471
372 Ga0495670_0000753 3300046691 Bacteria 15524
373 Ga0495670_0054852 3300046691 Bacteria 1998
374 Ga0495670_0061214 3300046691 Bacteria 1892
375 Ga0495671_0000087 3300046692 Bacteria 87327
376 Ga0495671_0000092 3300046692 Bacteria 85232
377 Ga0495671_0000116 3300046692 Bacteria 71676
378 Ga0495671_0000484 3300046692 Bacteria 30964
379 Ga0495671_0008571 3300046692 Bacteria 5742
380 Ga0495671_0029436 3300046692 Bacteria 2820
381 Ga0495671_0154790 3300046692 Bacteria 1115
382 Ga0495671_0185734 3300046692 Bacteria 1009
383 Ga0495649_0000166 3300046694 Bacteria 57538
384 Ga0495649_0004095 3300046694 Bacteria 9587
385 Ga0495649_0202577 3300046694 Bacteria 1030
386 Ga0495589_0000035 3300046794 Bacteria 161642
387 Ga0495589_0001393 3300046794 Bacteria 14055
388 Ga0495589_0021653 3300046794 Bacteria 3284
389 Ga0495589_0029314 3300046794 Bacteria 2774
390 Ga0495589_0039790 3300046794 Bacteria 2349
391 Ga0495589_0043858 3300046794 Bacteria 2225
392 Ga0495589_0091012 3300046794 Bacteria 1481
393 Ga0495589_0098576 3300046794 Bacteria 1415
394 Ga0495589_0192919 3300046794 Bacteria 963
395 Ga0495660_0005717 3300046810 Bacteria 7425
396 Ga0495660_0035876 3300046810 Bacteria 2768
397 Ga0495581_0009228 3300047315 Bacteria 5706
398 Ga0495581_0118009 3300047315 Bacteria 1543
399 Ga0495604_0010809 3300047317 Bacteria 7249
400 Ga0495604_0056933 3300047317 Bacteria 3006
401 Ga0495636_0000194 3300047318 Bacteria 23924
402 Ga0495636_0001027 3300047318 Bacteria 10464
403 Ga0495636_0034108 3300047318 Bacteria 2094
404 Ga0495636_0062529 3300047318 Bacteria 1576
405 Ga0495674_0289543 3300047319 Bacteria 1340
406 Ga0495672_0000023 3300047320 Bacteria 419080
407 Ga0495672_0001123 3300047320 Bacteria 27127
408 Ga0495672_0001427 3300047320 Bacteria 23485
409 Ga0495672_0002487 3300047320 Bacteria 16867
410 Ga0495672_0004870 3300047320 Bacteria 10799
411 Ga0495672_0092512 3300047320 Bacteria 1657
412 Ga0495672_0184765 3300047320 Bacteria 1053
413 Ga0495676_0000359 3300047321 Bacteria 37334
414 Ga0495680_0008177 3300047322 Bacteria 9538
415 Ga0495683_0005791 3300047323 Bacteria 6807
416 Ga0495683_0007124 3300047323 Bacteria 6068
417 Ga0495683_0019615 3300047323 Bacteria 3490
418 Ga0495683_0083323 3300047323 Bacteria 1557
419 Ga0495687_000002 3300047443 Bacteria 1085770
420 Ga0495687_000066 3300047443 Bacteria 161642
421 Ga0495687_000725 3300047443 Bacteria 36446
422 Ga0495687_001489 3300047443 Bacteria 21387
423 Ga0495675_0003976 3300047444 Bacteria 8960
424 Ga0495675_0040582 3300047444 Bacteria 2965
425 Ga0495677_0000013 3300047445 Bacteria 138372
426 Ga0495677_0000817 3300047445 Bacteria 12594
427 Ga0495677_0001313 3300047445 Bacteria 9944
428 Ga0495677_0002419 3300047445 Bacteria 7332
429 Ga0495677_0028233 3300047445 Bacteria 2037
430 Ga0495677_0105218 3300047445 Bacteria 1070
431 Ga0495679_014363 3300047446 Bacteria 2937
432 Ga0495679_053454 3300047446 Bacteria 1206
433 Ga0495679_054292 3300047446 Bacteria 1194
434 Ga0495685_000237 3300047447 Bacteria 18986
435 Ga0495685_000626 3300047447 Bacteria 10825
436 Ga0495685_004815 3300047447 Bacteria 4380
437 Ga0495685_007016 3300047447 Bacteria 3708
438 Ga0495685_058530 3300047447 Bacteria 1300
439 Ga0495673_0000003 3300047469 Bacteria 1491337
440 Ga0495673_0038898 3300047469 Bacteria 2161
441 Ga0495673_0094607 3300047469 Bacteria 1216
442 Ga0495681_0000016 3300047470 Bacteria 181322
443 Ga0495681_0010130 3300047470 Bacteria 5732
444 Ga0495681_0024956 3300047470 Bacteria 3135
445 Ga0495681_0039155 3300047470 Bacteria 2317
446 Ga0495681_0112283 3300047470 Bacteria 1179
447 Ga0495686_0000464 3300047472 Bacteria 60897
448 Ga0495593_0002588 3300047673 Bacteria 10877
449 Ga0495593_0039017 3300047673 Bacteria 2563
450 Ga0495593_0100836 3300047673 Bacteria 1480
451 Ga0495614_0004940 3300048089 Bacteria 6014
452 Ga0495614_0009931 3300048089 Bacteria 4201
453 Ga0495626_0000071 3300048091 Bacteria 136767
454 Ga0495626_0002561 3300048091 Bacteria 12453
455 Ga0495626_0002787 3300048091 Bacteria 11725
456 Ga0495626_0003182 3300048091 Bacteria 10692
457 Ga0495626_0003184 3300048091 Bacteria 10689
458 Ga0495626_0004939 3300048091 Bacteria 8002
459 Ga0495626_0007720 3300048091 Bacteria 5962
460 Ga0495626_0014101 3300048091 Bacteria 4134
461 Ga0495626_0023323 3300048091 Bacteria 3048
462 Ga0495626_0044972 3300048091 Bacteria 2063
463 Ga0495626_0052943 3300048091 Bacteria 1870
464 Ga0495626_0069925 3300048091 Bacteria 1580
465 Ga0495626_0120487 3300048091 Bacteria 1128
466 Ga0496102_0016451 3300048905 Bacteria 6462
467 Ga0496103_0101171 3300048906 Bacteria 1824
468 Ga0496110_0014362 3300048913 Bacteria 6573
469 Ga0496111_0030296 3300048914 Bacteria 3848
470 Ga0496114_0051058 3300048917 Bacteria 3443
471 Ga0496122_0006558 3300048925 Bacteria 13306
472 Ga0495678_000035 3300049459 Bacteria 200957
473 Ga0495678_000215 3300049459 Bacteria 66940
474 Ga0495678_000689 3300049459 Bacteria 30888
475 Ga0495678_014909 3300049459 Bacteria 3598
476 Ga0495682_0000224 3300049460 Bacteria 44478
477 Ga0495682_0000365 3300049460 Bacteria 32900
478 Ga0495682_0000677 3300049460 Bacteria 22419
479 Ga0495682_0000706 3300049460 Bacteria 21870
480 Ga0495682_0007037 3300049460 Bacteria 4505
481 Ga0495682_0009210 3300049460 Bacteria 3863
482 Ga0501067_0132937 3300049583 Bacteria 1385
483 Ga0501198_000014 3300049649 Bacteria 106940
484 Ga0501206_012860 3300049653 Bacteria 1140
485 Ga0501222_000008 3300049662 Bacteria 120904
486 nmdc:mga03683_10363_c1 3300050489 Bacteria 3341
487 nmdc:mga0yw44_18945_c1 3300050492 Bacteria 3784
488 nmdc:mga0k408_138307_c1 3300050493 Bacteria 1448
489 nmdc:mga0k408_31114_c1 3300050493 Bacteria 3046
490 nmdc:mga0k408_58391_c1 3300050493 Bacteria 2241
491 nmdc:mga04h51_14687_c1 3300050495 Bacteria 2243
492 nmdc:mga07m45_13482_c1 3300050496 Bacteria 4339
493 nmdc:mga07m45_330743_c1 3300050496 Bacteria 886
494 nmdc:mga07m45_74647_c1 3300050496 Bacteria 1932
495 Ga0500578_0000006 3300053086 Bacteria 234598
496 Ga0500651_0037482 3300053093 Bacteria 3055
497 Ga0500641_0005118 3300053096 Bacteria 4646
498 Ga0500562_020087 3300053108 Bacteria 1734
499 Ga0500593_079552 3300053117 Bacteria 1408
500 Ga0500595_007057 3300053119 Bacteria 4702
501 Ga0500628_009680 3300053129 Bacteria 1705
502 Ga0500652_000003 3300053131 Bacteria 221528
503 Ga0500652_000642 3300053131 Bacteria 11936
504 Ga0500655_018886 3300053133 Bacteria 1281
505 Ga0500586_000585 3300053145 Bacteria 7416
506 Ga0500586_047665 3300053145 Unclassified 1471
507 Ga0500619_000201 3300053154 Bacteria 13773
508 Ga0500622_0000221 3300053156 Bacteria 59833
509 2587730797 2585428057 Bacteria 6737412
510 2587737168 2585428058 Bacteria 6853932
511 2587756134 2585428062 Bacteria 6842168
512 2588294633 2588253510 Bacteria 6901809
513 2643971647 2643221592 Bacteria 6608788
514 2644142725 2643221625 Bacteria 6512927
515 2644248723 2643221644 Bacteria 6865017
516 2644272714 2643221648 Bacteria 6521465
517 2672336449 2671180330 Bacteria 5521719
518 2738739698 2738541280 Bacteria 6630198
519 2738830425 2738541297 Bacteria 6549566
520 2739154221 2738541357 Bacteria 6549408
521 2739196246 2738543003 Bacteria 6549560
522 2739322617 2738543026 Bacteria 6549408
523 2739340858 2738543029 Bacteria 6549249
524 2816863086 2816332186 Bacteria 5331395
525 2842683137 2842682962 Bacteria 5589973
526 2849143879 2849139964 Bacteria 5613304
527 2857582831 2857581216 Bacteria 5522813
528 2995952834 2995948881 Bacteria 6358104
529 Ga0068852_100298318
530 JGI24740J21852_10018001
531 JGI24739J22299_10023619
532 JGI25151J46595_10013357
533 JGI25153J46596_10004031
534 JGI25153J46596_10031434
535 rootL2_10137477
536 Ga0055526_1010965
537 Ga0055524_1000233
538 Ga0055530_10000758
539 Ga0055540_1000080
540 Ga0065165_1005423
541 Ga0070661_100002124
542 Ga0070659_100001740
543 Ga0070663_100238995
544 Ga0070663_100398231
545 Ga0068853_100029161
546 Ga0068853_100077324
547 Ga0068855_100172283
548 Ga0070664_100004314
549 Ga0068857_100039597
550 Ga0068857_100053285
551 Ga0068854_100077337
552 Ga0068854_100227424
553 Ga0068856_100042379
554 Ga0068856_100144833
555 Ga0068852_100006956
556 Ga0068851_10006649
557 Ga0075368_10020643
558 Ga0075368_10090557
559 Ga0075363_100018328
560 Ga0075363_100086239
561 Ga0075364_10103939
562 Ga0075362_10013240
563 Ga0075367_10007224
564 Ga0075367_10007323
565 Ga0075369_10009873
566 Ga0075369_10010697
567 Ga0075366_10132880
568 Ga0075370_10001889
569 Ga0079104_1000267
570 Ga0105240_10089772
571 Ga0105241_10088831
572 Ga0105237_10316434
573 Ga0105238_10004432
574 Ga0105238_10035858
575 Ga0105239_10069717
576 Ga0105239_10074831
577 Ga0157379_10593546
578 Ga0183360_10001
579 Ga0207425_1002947
580 Ga0209129_1000043
581 Ga0209673_1004179
582 Ga0209675_1014907
583 Ga0209025_1007958
584 Ga0209564_1000014
585 Ga0209758_1000307
586 Ga0209758_1000492
587 Ga0209050_1000493
588 Ga0209050_1000739
589 Ga0209050_1028009
590 Ga0209256_1000203
591 Ga0209051_1000035
592 Ga0209257_1000346
593 Ga0207656_10160266
594 Ga0207654_10001596
595 Ga0207695_10000497
596 Ga0207695_10196716
597 Ga0207649_10001856
598 Ga0207694_10003968
599 Ga0207679_10007881
600 Ga0207667_10017824
601 Ga0207667_10238496
602 Ga0207667_10278918
603 Ga0207640_10021731
604 Ga0207640_10045704
605 Ga0207639_10060313
606 Ga0207678_10042049
607 Ga0207702_10001920
608 Ga0207676_10328406
609 Ga0207674_10003184
610 Ga0207674_10005049
611 Ga0207698_10241410
612 Ga0209281_1000076
613 Ga0209974_10004710
614 Ga0307515_10000232
615 Ga0307515_10004630
616 Ga0307515_10022661
617 Ga0265330_10011185
618 Ga0265332_10002259
619 Ga0265332_10019421
620 Ga0265328_10035630
621 Ga0265325_10055729
622 Ga0265329_10008772
623 Ga0265340_10004855
624 Ga0265339_10004680
625 Ga0265339_10022358
626 Ga0265331_10004561
627 Ga0265331_10022461
628 Ga0265327_10003970
629 Ga0265316_10057111
630 Ga0265313_10045132
631 Ga0307508_10001933
632 Ga0307514_10001048
633 Ga0265314_10031018
634 Ga0265342_10000210
635 Ga0307516_10010299
636 Ga0307507_10043893
637 Ga0436361_0883434
638 Ga0451807_1833390
639 Ga0451841_0922783
640 Ga0451845_0532962
641 Ga0451849_0172393
642 Ga0451843_0229425
643 Ga0450919_002169
644 Ga0450923_008095
645 Ga0450918_000766
646 Ga0495617_000012
647 Ga0495617_000129
648 Ga0495617_011437
649 Ga0495627_000007
650 Ga0495627_000118
651 Ga0495603_0081361
652 Ga0495603_0236403
653 Ga0495590_0006583
654 Ga0495590_0006631
655 Ga0495629_0077914
656 Ga0495629_0115771
657 Ga0495629_0140341
658 Ga0495638_0000621
659 Ga0495638_0001663
660 Ga0495638_0009045
661 Ga0495638_0093606
662 Ga0495638_0099563
663 Ga0495638_0190240
664 Ga0495653_0063220
665 Ga0495653_0075948
666 Ga0495653_0092966
667 Ga0495653_0165927
668 Ga0495650_0000213
669 Ga0495650_0000215
670 Ga0495650_0000289
671 Ga0495650_0033897
672 Ga0495580_0097491
673 Ga0495582_0004405
674 Ga0495605_0000072
675 Ga0495605_0004164
676 Ga0495605_0012668
677 Ga0495605_0023744
678 Ga0495605_0027241
679 Ga0495605_0058663
680 Ga0495605_0082097
681 Ga0495605_0113909
682 Ga0495584_0000173
683 Ga0495584_0000254
684 Ga0495584_0016136
685 Ga0495584_0021198
686 Ga0495584_0043103
687 Ga0495584_0060143
688 Ga0495584_0077698
689 Ga0495584_0079077
690 Ga0495584_0266830
691 Ga0495585_0000032
692 Ga0495585_0000531
693 Ga0495585_0001223
694 Ga0495585_0001673
695 Ga0495585_0003418
696 Ga0495585_0007283
697 Ga0495585_0009059
698 Ga0495585_0038768
699 Ga0495585_0105838
700 Ga0495594_0075432
701 Ga0495594_0152638
702 Ga0495594_0195670
703 Ga0495596_0000029
704 Ga0495596_0000243
705 Ga0495596_0000309
706 Ga0495596_0000812
707 Ga0495596_0001063
708 Ga0495596_0001487
709 Ga0495596_0001613
710 Ga0495596_0002435
711 Ga0495596_0004066
712 Ga0495596_0016064
713 Ga0495596_0017551
714 Ga0495596_0017721
715 Ga0495607_0001726
716 Ga0495607_0001937
717 Ga0495607_0002294
718 Ga0495607_0005992
719 Ga0495607_0013962
720 Ga0495607_0032502
721 Ga0495607_0041812
722 Ga0495607_0063321
723 Ga0495607_0089220
724 Ga0495583_0000011
725 Ga0495583_0000014
726 Ga0495583_0000058
727 Ga0495583_0000519
728 Ga0495583_0002335
729 Ga0495583_0008962
730 Ga0495583_0028892
731 Ga0495583_0097019
732 Ga0495583_0124790
733 Ga0495606_0024447
734 Ga0495610_0000008
735 Ga0495616_0000034
736 Ga0495616_0000131
737 Ga0495616_0000195
738 Ga0495616_0000388
739 Ga0495616_0003312
740 Ga0495616_0012532
741 Ga0495616_0012807
742 Ga0495616_0019800
743 Ga0495616_0022267
744 Ga0495616_0142917
745 Ga0495616_0207127
746 Ga0495631_0004538
747 Ga0495631_0004913
748 Ga0495631_0011769
749 Ga0495631_0017067
750 Ga0495631_0033906
751 Ga0495631_0046689
752 Ga0495631_0091506
753 Ga0495631_0132408
754 Ga0495631_0155985
755 Ga0495631_0156627
756 Ga0495631_0159401
757 Ga0495632_0000033
758 Ga0495632_0000056
759 Ga0495632_0000086
760 Ga0495632_0000156
761 Ga0495632_0000853
762 Ga0495632_0030366
763 Ga0495632_0050249
764 Ga0495632_0118471
765 Ga0495637_0001006
766 Ga0495637_0001806
767 Ga0495637_0010650
768 Ga0495637_0016498
769 Ga0495637_0057590
770 Ga0495643_0000330
771 Ga0495643_0000742
772 Ga0495643_0006905
773 Ga0495643_0010736
774 Ga0495643_0014186
775 Ga0495643_0039385
776 Ga0495643_0044213
777 Ga0495643_0054120
778 Ga0495643_0068565
779 Ga0495644_0000156
780 Ga0495644_0002270
781 Ga0495644_0012721
782 Ga0495644_0016028
783 Ga0495644_0055511
784 Ga0495648_0000116
785 Ga0495648_0000505
786 Ga0495648_0001000
787 Ga0495648_0003863
788 Ga0495648_0004157
789 Ga0495648_0005481
790 Ga0495648_0007837
791 Ga0495648_0051221
792 Ga0495648_0058659
793 Ga0495666_0029471
794 Ga0495666_0046545
795 Ga0495642_0000010
796 Ga0495642_0000218
797 Ga0495642_0000293
798 Ga0495642_0000459
799 Ga0495642_0011323
800 Ga0495642_0014391
801 Ga0495642_0023055
802 Ga0495642_0042907
803 Ga0495642_0080970
804 Ga0495654_0000058
805 Ga0495654_0004332
806 Ga0495654_0005595
807 Ga0495654_0067647
808 Ga0495665_0001347
809 Ga0495665_0015551
810 Ga0495586_0006821
811 Ga0495586_0014783
812 Ga0495587_0001570
813 Ga0495587_0105069
814 Ga0495609_0000044
815 Ga0495609_0000690
816 Ga0495609_0003410
817 Ga0495609_0007564
818 Ga0495609_0008735
819 Ga0495609_0045470
820 Ga0495609_0064124
821 Ga0495609_0119254
822 Ga0495597_0000196
823 Ga0495597_0002234
824 Ga0495597_0007050
825 Ga0495597_0008667
826 Ga0495597_0016905
827 Ga0495597_0120129
828 Ga0495597_0248308
829 Ga0495622_0000167
830 Ga0495622_0001500
831 Ga0495622_0012995
832 Ga0495622_0047983
833 Ga0495633_0000703
834 Ga0495633_0001090
835 Ga0495633_0015052
836 Ga0495633_0023232
837 Ga0495633_0023994
838 Ga0495633_0042261
839 Ga0495633_0070457
840 Ga0495656_0000077
841 Ga0495656_0031426
842 Ga0495656_0040277
843 Ga0495656_0097851
844 Ga0495656_0309966
845 Ga0495668_0000193
846 Ga0495668_0000532
847 Ga0495668_0002189
848 Ga0495668_0007214
849 Ga0495668_0013762
850 Ga0495668_0093539
851 Ga0495668_0134649
852 Ga0495668_0296964
853 Ga0495611_0000850
854 Ga0495611_0002207
855 Ga0495611_0002540
856 Ga0495611_0023938
857 Ga0495611_0195302
858 Ga0495625_0010704
859 Ga0495625_0014629
860 Ga0495625_0017544
861 Ga0495625_0048384
862 Ga0495625_0087641
863 Ga0495625_0099607
864 Ga0495625_0113126
865 Ga0495625_0169509
866 Ga0495625_0178259
867 Ga0495635_0010634
868 Ga0495659_0000003
869 Ga0495659_0000041
870 Ga0495659_0000538
871 Ga0495659_0007813
872 Ga0495661_0000426
873 Ga0495661_0002490
874 Ga0495661_0006243
875 Ga0495661_0017956
876 Ga0495661_0018907
877 Ga0495661_0020199
878 Ga0495661_0021810
879 Ga0495661_0031061
880 Ga0495661_0032380
881 Ga0495661_0045891
882 Ga0495661_0051794
883 Ga0495661_0200583
884 Ga0495588_0002966
885 Ga0495588_0041029
886 Ga0495588_0044110
887 Ga0495588_0172954
888 Ga0495588_0254507
889 Ga0495669_0000017
890 Ga0495669_0000203
891 Ga0495669_0005584
892 Ga0495669_0031229
893 Ga0495669_0045923
894 Ga0495669_0050410
895 Ga0495613_0053263
896 Ga0495613_0220703
897 Ga0495624_0015547
898 Ga0495670_0000076
899 Ga0495670_0000460
900 Ga0495670_0000753
901 Ga0495670_0054852
902 Ga0495670_0061214
903 Ga0495671_0000087
904 Ga0495671_0000092
905 Ga0495671_0000116
906 Ga0495671_0000484
907 Ga0495671_0008571
908 Ga0495671_0029436
909 Ga0495671_0154790
910 Ga0495671_0185734
911 Ga0495649_0000166
912 Ga0495649_0004095
913 Ga0495649_0202577
914 Ga0495589_0000035
915 Ga0495589_0001393
916 Ga0495589_0021653
917 Ga0495589_0029314
918 Ga0495589_0039790
919 Ga0495589_0043858
920 Ga0495589_0091012
921 Ga0495589_0098576
922 Ga0495589_0192919
923 Ga0495660_0005717
924 Ga0495660_0035876
925 Ga0495581_0009228
926 Ga0495581_0118009
927 Ga0495604_0010809
928 Ga0495604_0056933
929 Ga0495636_0000194
930 Ga0495636_0001027
931 Ga0495636_0034108
932 Ga0495636_0062529
933 Ga0495674_0289543
934 Ga0495672_0000023
935 Ga0495672_0001123
936 Ga0495672_0001427
937 Ga0495672_0002487
938 Ga0495672_0004870
939 Ga0495672_0092512
940 Ga0495672_0184765
941 Ga0495676_0000359
942 Ga0495680_0008177
943 Ga0495683_0005791
944 Ga0495683_0007124
945 Ga0495683_0019615
946 Ga0495683_0083323
947 Ga0495687_000002
948 Ga0495687_000066
949 Ga0495687_000725
950 Ga0495687_001489
951 Ga0495675_0003976
952 Ga0495675_0040582
953 Ga0495677_0000013
954 Ga0495677_0000817
955 Ga0495677_0001313
956 Ga0495677_0002419
957 Ga0495677_0028233
958 Ga0495677_0105218
959 Ga0495679_014363
960 Ga0495679_053454
961 Ga0495679_054292
962 Ga0495685_000237
963 Ga0495685_000626
964 Ga0495685_004815
965 Ga0495685_007016
966 Ga0495685_058530
967 Ga0495673_0000003
968 Ga0495673_0038898
969 Ga0495673_0094607
970 Ga0495681_0000016
971 Ga0495681_0010130
972 Ga0495681_0024956
973 Ga0495681_0039155
974 Ga0495681_0112283
975 Ga0495686_0000464
976 Ga0495593_0002588
977 Ga0495593_0039017
978 Ga0495593_0100836
979 Ga0495614_0004940
980 Ga0495614_0009931
981 Ga0495626_0000071
982 Ga0495626_0002561
983 Ga0495626_0002787
984 Ga0495626_0003182
985 Ga0495626_0003184
986 Ga0495626_0004939
987 Ga0495626_0007720
988 Ga0495626_0014101
989 Ga0495626_0023323
990 Ga0495626_0044972
991 Ga0495626_0052943
992 Ga0495626_0069925
993 Ga0495626_0120487
994 Ga0496102_0016451
995 Ga0496103_0101171
996 Ga0496110_0014362
997 Ga0496111_0030296
998 Ga0496114_0051058
999 Ga0496122_0006558
1000 Ga0495678_000035
1001 Ga0495678_000215
1002 Ga0495678_000689
1003 Ga0495678_014909
1004 Ga0495682_0000224
1005 Ga0495682_0000365
1006 Ga0495682_0000677
1007 Ga0495682_0000706
1008 Ga0495682_0007037
1009 Ga0495682_0009210
1010 Ga0501067_0132937
1011 Ga0501198_000014
1012 Ga0501206_012860
1013 Ga0501222_000008
1014 nmdc:mga03683_10363_c1
1015 nmdc:mga0yw44_18945_c1
1016 nmdc:mga0k408_138307_c1
1017 nmdc:mga0k408_31114_c1
1018 nmdc:mga0k408_58391_c1
1019 nmdc:mga04h51_14687_c1
1020 nmdc:mga07m45_13482_c1
1021 nmdc:mga07m45_330743_c1
1022 nmdc:mga07m45_74647_c1
1023 Ga0500578_0000006
1024 Ga0500651_0037482
1025 Ga0500641_0005118
1026 Ga0500562_020087
1027 Ga0500593_079552
1028 Ga0500595_007057
1029 Ga0500628_009680
1030 Ga0500652_000003
1031 Ga0500652_000642
1032 Ga0500655_018886
1033 Ga0500586_000585
1034 Ga0500586_047665
1035 Ga0500619_000201
1036 Ga0500622_0000221
1037 2587730797
1038 2587737168
1039 2587756134
1040 2588294633
1041 2643971647
1042 2644142725
1043 2644248723
1044 2644272714
1045 2672336449
1046 2738739698
1047 2738830425
1048 2739154221
1049 2739196246
1050 2739322617
1051 2739340858
1052 2816863086
1053 2842683137
1054 2849143879
1055 2857582831
1056 2995952834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

9

271

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8746 12 267
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8646 12 267
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.8055 11 267
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7787 10 270
3vsj-assembly1.cif.gz_D crystal structure of 1,6-apd (2-animophenol-1,6-dioxygenase) complexed with intermediate products 0.7612 10 267
ID Description Score Start End Superfamily
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9567 14 268 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9317 14 268 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.921 10 269 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9081 1 267 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8943 10 269 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A239I298-F1-model_v4 4,5-DOPA dioxygenase extradiol 0.9894 10 269 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A847VKX5-F1-model_v4 Dioxygenase 0.9869 65 268 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A401IHF5-F1-model_v4 Extradiol ring-cleavage dioxygenase class III enzyme subunit B domain-containing protein 0.9865 10 270 GO:0008198
GO:0008270
GO:0016701
AF-A0A1E4JJS9-F1-model_v4 Dioxygenase 0.9853 12 268 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7X1FZ99-F1-model_v4 Dioxygenase 0.9842 13 269 GO:0008198
GO:0008270
GO:0016701
GO:0051213

Map