F459669

General Info

Members Datasets Scaffolds Average Seq Length
528 274 1056 265

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10077295|Ga0105239_100772952
Length 298
Sequence MWNNKCKKANFSLTKFHISTFAPYFYTKFFVMRTNHEIDYKIFGEELQFVEVELDPGETVIGEPGGFMMMDDGIQMQTIFGDGSQXXXXGGLLDKLFSAGKRVLVGENLFMTAFTNIGQGKRRVSFAAPYTGKIIPLDLQQLGGSIIAQKDAFLCAAKGVSIGIAFQKRLGTGIFGGEGFIMEKLDGDGFAFVHAGGYVMEKELKPGEILKVDTGCVVAFTPTIDFDIEFIKGVKNWMFGGEGLFFALMRGPGKVWLQSLPISRLASRIIQYSPQFGRRREEGSILGGLGNFLDGDGF

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
184 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
187 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
188 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
189 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
230 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
231 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
241 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
242 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
243 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
244 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
245 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
249 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
252 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
255 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
256 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
270 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
271 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
272 2643221656 Pelomonas sp. Root405 Isolate Unclassified
273 2643221660 Methylibium sp. Root1272 Isolate Unclassified
274 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0.76
Rhizoplane 1.33
Rhizosphere 89.02
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10077295 3300010375 Bacteria 3663
2 rootH2_10017245 3300003320 Bacteria 26472
3 rootH2_10059393 3300003320 Bacteria 48659
4 rootH2_10157128 3300003320 Bacteria 1294
5 rootL2_10001557 3300003322 Bacteria 12165
6 rootL2_10230472 3300003322 Bacteria 3134
7 rootL2_10374887 3300003322 Unclassified 1783
8 rootH1_10228124 3300003323 Bacteria 1912
9 Ga0055526_1001717 3300003771 Bacteria 15247
10 Ga0055531_10000089 3300003794 Bacteria 100485
11 Ga0070658_10000626 3300005327 Bacteria 30535
12 Ga0070676_10004792 3300005328 Bacteria 7156
13 Ga0070676_10498238 3300005328 Bacteria 864
14 Ga0070683_100012045 3300005329 Bacteria 7502
15 Ga0070670_100007249 3300005331 Bacteria 9398
16 Ga0070670_100494564 3300005331 Bacteria 1087
17 Ga0070670_100516385 3300005331 Bacteria 1063
18 Ga0068869_100007191 3300005334 Bacteria 7097
19 Ga0068869_100080601 3300005334 Bacteria 2429
20 Ga0070666_10000584 3300005335 Bacteria 22009
21 Ga0070666_10077045 3300005335 Bacteria 2275
22 Ga0070666_10138733 3300005335 Bacteria 1693
23 Ga0070680_100002533 3300005336 Bacteria 13539
24 Ga0070682_100000300 3300005337 Bacteria 34454
25 Ga0070682_100075792 3300005337 Bacteria 2164
26 Ga0070682_100121834 3300005337 Bacteria 1752
27 Ga0070682_100207126 3300005337 Bacteria 1388
28 Ga0068868_100000280 3300005338 Bacteria 34319
29 Ga0068868_100106084 3300005338 Bacteria 2279
30 Ga0070689_100192036 3300005340 Bacteria 1663
31 Ga0070691_10009046 3300005341 Unclassified 4556
32 Ga0070661_100164805 3300005344 Bacteria 1680
33 Ga0070668_100000267 3300005347 Bacteria 34430
34 Ga0070668_100048437 3300005347 Bacteria 3268
35 Ga0070669_100111325 3300005353 Bacteria 2078
36 Ga0070669_100198239 3300005353 Bacteria 1578
37 Ga0070675_100285880 3300005354 Bacteria 1450
38 Ga0070675_100339450 3300005354 Bacteria 1330
39 Ga0070671_100092794 3300005355 Bacteria 2530
40 Ga0070671_100146846 3300005355 Bacteria 1991
41 Ga0070671_100495340 3300005355 Bacteria 1051
42 Ga0070673_100000422 3300005364 Bacteria 22381
43 Ga0070673_100120160 3300005364 Bacteria 2191
44 Ga0070673_100480900 3300005364 Bacteria 1121
45 Ga0070667_100001041 3300005367 Bacteria 25338
46 Ga0070667_100001902 3300005367 Bacteria 18530
47 Ga0070667_100067384 3300005367 Bacteria 3043
48 Ga0070667_100241385 3300005367 Bacteria 1613
49 Ga0070667_100558832 3300005367 Bacteria 1052
50 Ga0070667_100646446 3300005367 Bacteria 976
51 Ga0070708_100210188 3300005445 Bacteria 1823
52 Ga0070678_100051508 3300005456 Bacteria 2985
53 Ga0070678_100170166 3300005456 Bacteria 1774
54 Ga0070678_100366974 3300005456 Bacteria 1242
55 Ga0070662_100006142 3300005457 Bacteria 7724
56 Ga0070681_10070994 3300005458 Bacteria 3447
57 Ga0070681_10346472 3300005458 Unclassified 1396
58 Ga0068867_100000062 3300005459 Bacteria 65188
59 Ga0068867_100003004 3300005459 Bacteria 11885
60 Ga0068867_100063520 3300005459 Bacteria 2744
61 Ga0068867_100339176 3300005459 Bacteria 1251
62 Ga0070698_100368212 3300005471 Bacteria 1369
63 Ga0070699_100069681 3300005518 Bacteria 3056
64 Ga0070679_100014769 3300005530 Bacteria 7503
65 Ga0070684_100003442 3300005535 Bacteria 11875
66 Ga0070684_100003776 3300005535 Bacteria 11430
67 Ga0068853_100012379 3300005539 Bacteria 6939
68 Ga0068853_100037915 3300005539 Bacteria 4104
69 Ga0068853_100061608 3300005539 Bacteria 3245
70 Ga0068853_100087891 3300005539 Unclassified 2728
71 Ga0068853_100094992 3300005539 Unclassified 2628
72 Ga0068853_100361773 3300005539 Bacteria 1352
73 Ga0070672_100000310 3300005543 Bacteria 27579
74 Ga0070672_100084681 3300005543 Bacteria 2546
75 Ga0070672_100574817 3300005543 Bacteria 980
76 Ga0070693_100030155 3300005547 Bacteria 2964
77 Ga0070665_100000002 3300005548 Bacteria 849037
78 Ga0070665_100000916 3300005548 Bacteria 37835
79 Ga0070665_100261765 3300005548 Bacteria 1731
80 Ga0070665_100269322 3300005548 Bacteria 1705
81 Ga0068855_100000303 3300005563 Bacteria 61260
82 Ga0068855_100020445 3300005563 Bacteria 7938
83 Ga0068855_100031414 3300005563 Bacteria 6342
84 Ga0068855_100045306 3300005563 Bacteria 5202
85 Ga0070664_100082775 3300005564 Bacteria 2768
86 Ga0070664_100486706 3300005564 Bacteria 1136
87 Ga0068857_100002628 3300005577 Bacteria 14743
88 Ga0068854_100006844 3300005578 Bacteria 7268
89 Ga0068854_100179067 3300005578 Bacteria 1655
90 Ga0068854_100689940 3300005578 Bacteria 880
91 Ga0068856_100026500 3300005614 Bacteria 5652
92 Ga0068852_100024342 3300005616 Unclassified 4891
93 Ga0068852_100336610 3300005616 Bacteria 1470
94 Ga0068852_100476171 3300005616 Bacteria 1240
95 Ga0068859_100008855 3300005617 Bacteria 10162
96 Ga0068859_100172532 3300005617 Bacteria 2244
97 Ga0068864_100000239 3300005618 Bacteria 49175
98 Ga0068864_100047734 3300005618 Bacteria 3679
99 Ga0068866_10288809 3300005718 Bacteria 1019
100 Ga0068861_100009223 3300005719 Bacteria 6807
101 Ga0068861_100016871 3300005719 Bacteria 5175
102 Ga0068861_100418282 3300005719 Bacteria 1194
103 Ga0068851_10000885 3300005834 Bacteria 12933
104 Ga0068851_10010715 3300005834 Bacteria 4284
105 Ga0068863_100002445 3300005841 Bacteria 18454
106 Ga0068858_100000453 3300005842 Bacteria 42983
107 Ga0068860_100000003 3300005843 Bacteria 575741
108 Ga0068860_100002191 3300005843 Bacteria 20550
109 Ga0068860_100002296 3300005843 Bacteria 20099
110 Ga0068860_100016685 3300005843 Bacteria 7163
111 Ga0068860_100039517 3300005843 Bacteria 4513
112 Ga0068860_100246110 3300005843 Bacteria 1740
113 Ga0068862_100215480 3300005844 Bacteria 1736
114 Ga0075369_10144699 3300006186 Bacteria 1085
115 Ga0075366_10032720 3300006195 Bacteria 3061
116 Ga0097621_100004880 3300006237 Bacteria 9402
117 Ga0097621_100005359 3300006237 Bacteria 9037
118 Ga0097621_100299425 3300006237 Bacteria 1420
119 Ga0075370_10005972 3300006353 Bacteria 6094
120 Ga0068871_100007116 3300006358 Bacteria 7976
121 Ga0068871_100007643 3300006358 Bacteria 7732
122 Ga0075428_100000046 3300006844 Bacteria 96992
123 Ga0075428_100189081 3300006844 Unclassified 2227
124 Ga0075430_100028372 3300006846 Bacteria 4755
125 Ga0075431_100031294 3300006847 Bacteria 5481
126 Ga0075429_100005109 3300006880 Bacteria 11288
127 Ga0075429_100114140 3300006880 Unclassified 2361
128 Ga0068865_100000806 3300006881 Bacteria 17617
129 Ga0097620_100000408 3300006931 Bacteria 42690
130 Ga0097620_100008855 3300006931 Bacteria 10162
131 Ga0097620_100172540 3300006931 Bacteria 2244
132 Ga0079104_1000688 3300006946 Bacteria 31113
133 Ga0079104_1000705 3300006946 Bacteria 30354
134 Ga0105240_10000896 3300009093 Bacteria 53128
135 Ga0105240_10005231 3300009093 Bacteria 19405
136 Ga0105240_10005785 3300009093 Bacteria 18338
137 Ga0105240_10007372 3300009093 Bacteria 15999
138 Ga0105240_10011047 3300009093 Bacteria 12626
139 Ga0105240_10011391 3300009093 Bacteria 12387
140 Ga0105240_10013234 3300009093 Bacteria 11349
141 Ga0105240_10029839 3300009093 Bacteria 7097
142 Ga0105240_10037401 3300009093 Bacteria 6239
143 Ga0105240_10079280 3300009093 Bacteria 4041
144 Ga0111539_10444115 3300009094 Bacteria 1510
145 Ga0105245_10102264 3300009098 Bacteria 2653
146 Ga0105245_10774778 3300009098 Bacteria 996
147 Ga0114129_10014385 3300009147 Bacteria 11278
148 Ga0105243_10007373 3300009148 Bacteria 8456
149 Ga0105241_10006775 3300009174 Bacteria 8430
150 Ga0105241_10040637 3300009174 Unclassified 3512
151 Ga0105241_10137564 3300009174 Bacteria 1985
152 Ga0105242_10089926 3300009176 Bacteria 2582
153 Ga0105242_10118419 3300009176 Bacteria 2268
154 Ga0105248_10011927 3300009177 Bacteria 9585
155 Ga0105237_10001569 3300009545 Bacteria 29799
156 Ga0105237_10002147 3300009545 Bacteria 24833
157 Ga0105237_10021421 3300009545 Bacteria 6645
158 Ga0105238_10005282 3300009551 Bacteria 12772
159 Ga0105238_10152898 3300009551 Bacteria 2282
160 Ga0105238_10369427 3300009551 Bacteria 1425
161 Ga0105238_10577306 3300009551 Bacteria 1130
162 Ga0105249_10032531 3300009553 Bacteria 4719
163 Ga0105249_10105114 3300009553 Bacteria 2662
164 Ga0105249_10591307 3300009553 Bacteria 1164
165 Ga0105239_10000486 3300010375 Bacteria 57901
166 Ga0105239_10006637 3300010375 Bacteria 13391
167 Ga0105239_10054216 3300010375 Bacteria 4397
168 Ga0105239_10057697 3300010375 Bacteria 4258
169 Ga0105239_10867523 3300010375 Bacteria 1035
170 Ga0105246_10143377 3300011119 Bacteria 1799
171 Ga0157373_10012269 3300013100 Bacteria 6299
172 Ga0157373_10027962 3300013100 Bacteria 4068
173 Ga0157373_10052661 3300013100 Unclassified 2895
174 Ga0157373_10417538 3300013100 Unclassified 963
175 Ga0157371_10012191 3300013102 Bacteria 6581
176 Ga0157371_10065211 3300013102 Unclassified 2579
177 Ga0157371_10067108 3300013102 Bacteria 2540
178 Ga0157370_10006978 3300013104 Bacteria 12338
179 Ga0157370_10007746 3300013104 Bacteria 11642
180 Ga0157370_10013306 3300013104 Bacteria 8476
181 Ga0157370_10039031 3300013104 Bacteria 4591
182 Ga0157369_10053497 3300013105 Bacteria 4363
183 Ga0157369_10084127 3300013105 Unclassified 3401
184 Ga0157374_10000168 3300013296 Bacteria 60649
185 Ga0157374_10053384 3300013296 Bacteria 3768
186 Ga0157374_10258419 3300013296 Bacteria 1715
187 Ga0157374_10448689 3300013296 Bacteria 1291
188 Ga0157378_10019208 3300013297 Bacteria 6006
189 Ga0157378_10065396 3300013297 Bacteria 3255
190 Ga0163162_10000260 3300013306 Bacteria 48090
191 Ga0163162_10000359 3300013306 Bacteria 41296
192 Ga0163162_10001104 3300013306 Bacteria 25036
193 Ga0163162_10010735 3300013306 Bacteria 8910
194 Ga0163162_10784701 3300013306 Bacteria 1071
195 Ga0157372_10007509 3300013307 Bacteria 11594
196 Ga0157372_10031774 3300013307 Bacteria 5783
197 Ga0157372_10038919 3300013307 Bacteria 5248
198 Ga0157372_10049205 3300013307 Bacteria 4687
199 Ga0157372_10123046 3300013307 Unclassified 2981
200 Ga0157372_10181838 3300013307 Bacteria 2434
201 Ga0157372_10220389 3300013307 Bacteria 2199
202 Ga0157372_10225064 3300013307 Bacteria 2175
203 Ga0157372_10383958 3300013307 Bacteria 1636
204 Ga0157372_10496381 3300013307 Bacteria 1423
205 Ga0157372_10583399 3300013307 Bacteria 1303
206 Ga0157372_10738085 3300013307 Bacteria 1145
207 Ga0157375_10001148 3300013308 Bacteria 22891
208 Ga0157375_10051658 3300013308 Bacteria 4038
209 Ga0163163_10000271 3300014325 Bacteria 52036
210 Ga0163163_10007757 3300014325 Bacteria 9485
211 Ga0157380_10012948 3300014326 Bacteria 6062
212 Ga0157380_10153880 3300014326 Bacteria 1991
213 Ga0157380_10531959 3300014326 Bacteria 1149
214 Ga0157377_10000027 3300014745 Bacteria 135472
215 Ga0157379_10000810 3300014968 Bacteria 25369
216 Ga0157376_10000827 3300014969 Bacteria 20261
217 Ga0157376_10005679 3300014969 Bacteria 8738
218 Ga0157376_10007883 3300014969 Bacteria 7637
219 Ga0157376_10466774 3300014969 Bacteria 1234
220 Ga0163161_10257974 3300017792 Bacteria 1361
221 Ga0213872_10000245 3300021361 Bacteria 48030
222 Ga0213872_10000871 3300021361 Bacteria 21851
223 Ga0213872_10035721 3300021361 Bacteria 2271
224 Ga0209563_100005 3300025230 Bacteria 1774893
225 Ga0209673_1003742 3300025273 Bacteria 8680
226 Ga0209564_1000051 3300025295 Bacteria 357748
227 Ga0209050_1005085 3300025298 Bacteria 8481
228 Ga0209050_1007860 3300025298 Bacteria 5857
229 Ga0209257_1000021 3300025304 Bacteria 771986
230 Ga0207656_10001969 3300025321 Bacteria 6835
231 Ga0207656_10034835 3300025321 Bacteria 2104
232 Ga0207642_10047006 3300025899 Bacteria 1927
233 Ga0207680_10039345 3300025903 Bacteria 2743
234 Ga0207680_10087847 3300025903 Bacteria 1970
235 Ga0207647_10047909 3300025904 Unclassified 2656
236 Ga0207645_10006798 3300025907 Bacteria 8165
237 Ga0207645_10037573 3300025907 Bacteria 3107
238 Ga0207705_10001456 3300025909 Bacteria 18884
239 Ga0207654_10000848 3300025911 Bacteria 16866
240 Ga0207654_10029841 3300025911 Unclassified 2989
241 Ga0207654_10031268 3300025911 Bacteria 2931
242 Ga0207707_10000353 3300025912 Bacteria 48229
243 Ga0207707_10342098 3300025912 Bacteria 1290
244 Ga0207707_10605855 3300025912 Unclassified 927
245 Ga0207695_10000051 3300025913 Bacteria 399641
246 Ga0207695_10000056 3300025913 Bacteria 382433
247 Ga0207695_10000066 3300025913 Bacteria 334103
248 Ga0207695_10000081 3300025913 Bacteria 284797
249 Ga0207695_10000584 3300025913 Bacteria 73948
250 Ga0207695_10000725 3300025913 Bacteria 64078
251 Ga0207695_10008032 3300025913 Bacteria 13283
252 Ga0207695_10025034 3300025913 Bacteria 6694
253 Ga0207695_10026375 3300025913 Bacteria 6486
254 Ga0207695_10040358 3300025913 Bacteria 5006
255 Ga0207671_10001546 3300025914 Bacteria 26317
256 Ga0207671_10001963 3300025914 Bacteria 22689
257 Ga0207671_10002080 3300025914 Bacteria 21905
258 Ga0207671_10007592 3300025914 Bacteria 9385
259 Ga0207660_10025794 3300025917 Unclassified 3994
260 Ga0207649_10136571 3300025920 Bacteria 1673
261 Ga0207652_10000925 3300025921 Bacteria 27608
262 Ga0207681_10048674 3300025923 Bacteria 2862
263 Ga0207694_10010753 3300025924 Bacteria 6910
264 Ga0207694_10078946 3300025924 Bacteria 2580
265 Ga0207694_10420430 3300025924 Bacteria 1113
266 Ga0207694_10494985 3300025924 Unclassified 1023
267 Ga0207650_10004964 3300025925 Bacteria 9093
268 Ga0207650_10017228 3300025925 Bacteria 5056
269 Ga0207650_10154721 3300025925 Bacteria 1812
270 Ga0207659_10272917 3300025926 Bacteria 1380
271 Ga0207659_10452297 3300025926 Bacteria 1082
272 Ga0207687_10082900 3300025927 Bacteria 2320
273 Ga0207690_10401613 3300025932 Bacteria 1093
274 Ga0207706_10011497 3300025933 Bacteria 8063
275 Ga0207706_10029010 3300025933 Bacteria 4940
276 Ga0207686_10159420 3300025934 Bacteria 1580
277 Ga0207686_10353099 3300025934 Bacteria 1107
278 Ga0207709_10001223 3300025935 Bacteria 18456
279 Ga0207670_10013108 3300025936 Bacteria 4878
280 Ga0207670_10081279 3300025936 Bacteria 2268
281 Ga0207669_10098929 3300025937 Bacteria 1922
282 Ga0207704_10003294 3300025938 Bacteria 7337
283 Ga0207691_10000234 3300025940 Bacteria 54055
284 Ga0207691_10025214 3300025940 Bacteria 5584
285 Ga0207691_10110817 3300025940 Bacteria 2441
286 Ga0207711_10027850 3300025941 Bacteria 4750
287 Ga0207689_10001444 3300025942 Bacteria 22712
288 Ga0207689_10020414 3300025942 Bacteria 5575
289 Ga0207661_10001240 3300025944 Bacteria 17050
290 Ga0207679_10007377 3300025945 Bacteria 6974
291 Ga0207679_10029476 3300025945 Bacteria 3822
292 Ga0207679_10085798 3300025945 Bacteria 2419
293 Ga0207667_10003397 3300025949 Bacteria 19647
294 Ga0207667_10016825 3300025949 Bacteria 8249
295 Ga0207667_10031292 3300025949 Bacteria 5745
296 Ga0207667_10102060 3300025949 Bacteria 2959
297 Ga0207651_10427977 3300025960 Bacteria 1131
298 Ga0207651_10465622 3300025960 Bacteria 1087
299 Ga0207712_10068796 3300025961 Bacteria 2538
300 Ga0207712_10394573 3300025961 Bacteria 1161
301 Ga0207668_10003318 3300025972 Bacteria 9424
302 Ga0207668_10134424 3300025972 Bacteria 1893
303 Ga0207640_10012045 3300025981 Bacteria 4915
304 Ga0207658_10000950 3300025986 Bacteria 23916
305 Ga0207658_10001572 3300025986 Bacteria 17671
306 Ga0207677_10043619 3300026023 Unclassified 2983
307 Ga0207677_10091042 3300026023 Bacteria 2218
308 Ga0207677_10092837 3300026023 Bacteria 2199
309 Ga0207677_10294243 3300026023 Bacteria 1339
310 Ga0207703_10064758 3300026035 Bacteria 3001
311 Ga0207639_10015758 3300026041 Bacteria 5333
312 Ga0207639_10028109 3300026041 Bacteria 4103
313 Ga0207639_10109115 3300026041 Unclassified 2251
314 Ga0207639_10187934 3300026041 Bacteria 1762
315 Ga0207708_10057282 3300026075 Bacteria 2973
316 Ga0207702_10033690 3300026078 Bacteria 4280
317 Ga0207702_10070672 3300026078 Bacteria 3003
318 Ga0207641_10001042 3300026088 Bacteria 28066
319 Ga0207641_10623380 3300026088 Bacteria 1058
320 Ga0207648_10000119 3300026089 Bacteria 76875
321 Ga0207648_10002569 3300026089 Bacteria 19457
322 Ga0207648_10014354 3300026089 Bacteria 7322
323 Ga0207648_10196961 3300026089 Bacteria 1786
324 Ga0207676_10004399 3300026095 Bacteria 9965
325 Ga0207676_10037575 3300026095 Bacteria 3691
326 Ga0207674_10002340 3300026116 Bacteria 23974
327 Ga0207674_10643762 3300026116 Bacteria 1024
328 Ga0207675_100001157 3300026118 Bacteria 26215
329 Ga0207675_100023157 3300026118 Bacteria 5776
330 Ga0207675_100082781 3300026118 Bacteria 3010
331 Ga0207683_10010579 3300026121 Bacteria 7870
332 Ga0207683_10255309 3300026121 Bacteria 1600
333 Ga0207683_10662171 3300026121 Unclassified 967
334 Ga0207698_10055836 3300026142 Bacteria 3046
335 Ga0207698_10110770 3300026142 Bacteria 2300
336 Ga0207698_10191562 3300026142 Bacteria 1822
337 Ga0209281_1000042 3300027111 Bacteria 344748
338 Ga0209281_1000357 3300027111 Bacteria 75457
339 Ga0268266_10000073 3300028379 Bacteria 232074
340 Ga0268266_10003852 3300028379 Bacteria 14643
341 Ga0268266_10245726 3300028379 Bacteria 1653
342 Ga0268265_10152014 3300028380 Bacteria 1954
343 Ga0268264_10000063 3300028381 Bacteria 301702
344 Ga0268264_10003545 3300028381 Bacteria 13435
345 Ga0268264_10007323 3300028381 Bacteria 9225
346 Ga0268264_10020330 3300028381 Bacteria 5426
347 Ga0268264_10283292 3300028381 Bacteria 1553
348 Ga0268264_10714930 3300028381 Bacteria 996
349 Ga0307515_10000001 3300028794 Bacteria 4259510
350 Ga0307515_10000101 3300028794 Bacteria 199593
351 Ga0307515_10001683 3300028794 Bacteria 49294
352 Ga0307515_10009043 3300028794 Bacteria 19330
353 Ga0307511_10000232 3300030521 Bacteria 56875
354 Ga0265328_10052863 3300031239 Bacteria 1490
355 Ga0265331_10035584 3300031250 Bacteria 2449
356 Ga0265327_10000012 3300031251 Bacteria 530403
357 Ga0265327_10003620 3300031251 Bacteria 14550
358 Ga0265327_10090397 3300031251 Bacteria 1494
359 Ga0265327_10157887 3300031251 Bacteria 1050
360 Ga0307513_10193579 3300031456 Bacteria 1882
361 Ga0307408_100000743 3300031548 Bacteria 26347
362 Ga0316578_10059001 3300031728 Bacteria 2257
363 Ga0307516_10000675 3300031730 Bacteria 46218
364 Ga0307516_10006751 3300031730 Bacteria 13407
365 Ga0307516_10006807 3300031730 Bacteria 13337
366 Ga0307516_10036754 3300031730 Bacteria 4900
367 Ga0307516_10102364 3300031730 Bacteria 2679
368 Ga0307413_10044325 3300031824 Bacteria 2629
369 Ga0307414_10369248 3300032004 Bacteria 1237
370 Ga0307414_10515618 3300032004 Bacteria 1060
371 Ga0307414_10697544 3300032004 Bacteria 919
372 Ga0307411_10000432 3300032005 Bacteria 14287
373 Ga0307510_10001580 3300033180 Bacteria 25178
374 Ga0307510_10386329 3300033180 Bacteria 844
375 Ga0373940_0005769 3300035088 Bacteria 2704
376 Ga0373951_0017004 3300035091 Bacteria 1643
377 Ga0373932_0026208 3300035112 Bacteria 1584
378 Ga0373939_0000008 3300035114 Bacteria 77597
379 Ga0373960_0006004 3300035121 Bacteria 2831
380 Ga0373962_0006156 3300035242 Bacteria 2900
381 Ga0373931_0000801 3300035691 Bacteria 13152
382 Ga0373937_0084010 3300036401 Bacteria 2946
383 Ga0373937_0772998 3300036401 Unclassified 908
384 Ga0395900_0031383 3300037418 Bacteria 5459
385 Ga0395905_0017395 3300037471 Bacteria 6826
386 Ga0395905_0043709 3300037471 Bacteria 4203
387 Ga0395901_0015893 3300038443 Bacteria 7669
388 Ga0400483_108838 3300039062 Bacteria 6478
389 Ga0400483_120491 3300039062 Bacteria 10818
390 Ga0400483_150751 3300039062 Bacteria 2868
391 Ga0400483_196821 3300039062 Bacteria 8559
392 Ga0436361_0182228 3300039447 Bacteria 7484
393 Ga0436361_0254808 3300039447 Bacteria 14252
394 Ga0436361_0767394 3300039447 Bacteria 56110
395 Ga0436361_0854850 3300039447 Bacteria 1319
396 Ga0439438_020749 3300041405 Bacteria 1841
397 Ga0439453_0008491 3300041408 Bacteria 1652
398 Ga0451797_0517402 3300041453 Bacteria 1168
399 Ga0439431_0007494 3300041997 Bacteria 2435
400 Ga0439449_0001694 3300042007 Bacteria 8676
401 Ga0439455_0020344 3300042012 Bacteria 1573
402 Ga0439457_004483 3300042014 Bacteria 3630
403 Ga0439457_014220 3300042014 Bacteria 1783
404 Ga0450917_000321 3300042120 Bacteria 3563
405 Ga0450888_000039 3300042126 Bacteria 9250
406 Ga0450890_003444 3300042127 Bacteria 2100
407 Ga0450891_000577 3300042129 Bacteria 3815
408 Ga0450892_000102 3300042130 Bacteria 9468
409 Ga0450894_004633 3300042131 Bacteria 1785
410 Ga0450902_028625 3300042137 Bacteria 935
411 Ga0439434_0009138 3300042435 Bacteria 2914
412 Ga0439434_0051186 3300042435 Bacteria 1280
413 Ga0450893_0006102 3300042532 Bacteria 1944
414 Ga0451577_0000498 3300042876 Bacteria 66109
415 Ga0451577_0003560 3300042876 Bacteria 17186
416 Ga0451577_0013934 3300042876 Bacteria 7504
417 Ga0451577_0033467 3300042876 Bacteria 4633
418 Ga0451577_0122633 3300042876 Bacteria 2328
419 Ga0451577_0215743 3300042876 Bacteria 1734
420 Ga0466972_0030302 3300044658 Bacteria 2663
421 Ga0453683_0002009 3300044673 Bacteria 16426
422 Ga0453683_0014720 3300044673 Bacteria 5076
423 Ga0466965_0084540 3300044683 Bacteria 1607
424 Ga0466964_0088678 3300044706 Bacteria 1342
425 Ga0453684_0002188 3300044712 Bacteria 48703
426 Ga0453684_0089246 3300044712 Bacteria 3814
427 Ga0453684_0231895 3300044712 Bacteria 2131
428 Ga0453684_0519071 3300044712 Bacteria 1316
429 Ga0466971_0007043 3300044719 Bacteria 4893
430 Ga0466957_0078923 3300044842 Bacteria 2048
431 Ga0466960_0073666 3300044901 Bacteria 1705
432 Ga0466960_0355920 3300044901 Bacteria 836
433 Ga0466959_0015868 3300045049 Bacteria 5496
434 Ga0451576_0006261 3300045051 Bacteria 14649
435 Ga0451576_0009658 3300045051 Bacteria 11163
436 Ga0451576_0034521 3300045051 Bacteria 5371
437 Ga0451576_0060174 3300045051 Bacteria 3962
438 Ga0451576_0062740 3300045051 Bacteria 3874
439 Ga0451576_0132360 3300045051 Bacteria 2600
440 Ga0466958_0031842 3300045836 Bacteria 3135
441 Ga0495627_000003 3300046453 Bacteria 704557
442 Ga0495603_0068127 3300046455 Bacteria 2094
443 Ga0495629_0018507 3300046459 Bacteria 4985
444 Ga0495629_0060756 3300046459 Bacteria 2641
445 Ga0495638_0036508 3300046460 Bacteria 3131
446 Ga0495650_0093344 3300046471 Bacteria 1141
447 Ga0495582_0004882 3300046473 Bacteria 7513
448 Ga0495582_0077566 3300046473 Bacteria 1843
449 Ga0495639_0026942 3300046475 Bacteria 2543
450 Ga0495639_0085323 3300046475 Bacteria 1476
451 Ga0495594_0208527 3300046499 Bacteria 1114
452 Ga0495606_0006396 3300046507 Bacteria 10872
453 Ga0495648_0001549 3300046524 Bacteria 22452
454 Ga0495654_0000001 3300046530 Bacteria 1513197
455 Ga0495587_0181403 3300046536 Bacteria 1194
456 Ga0495633_0000002 3300046558 Bacteria 488754
457 Ga0495668_0000202 3300046616 Bacteria 87083
458 Ga0495611_0000037 3300046648 Bacteria 101602
459 Ga0495611_0041109 3300046648 Bacteria 2062
460 Ga0495658_0001794 3300046683 Bacteria 11051
461 Ga0495658_0257148 3300046683 Bacteria 1099
462 Ga0495636_0000082 3300047318 Bacteria 40011
463 Ga0495676_0034610 3300047321 Bacteria 4236
464 Ga0495680_0086703 3300047322 Bacteria 2355
465 Ga0495687_000040 3300047443 Bacteria 230786
466 Ga0495686_0000010 3300047472 Bacteria 573229
467 Ga0495686_0015893 3300047472 Bacteria 5119
468 Ga0495686_0023463 3300047472 Bacteria 4068
469 Ga0495686_0063158 3300047472 Bacteria 2296
470 Ga0495686_0099167 3300047472 Bacteria 1759
471 Ga0496104_0487675 3300048907 Bacteria 1144
472 Ga0496108_0078457 3300048911 Bacteria 2795
473 Ga0496109_0152064 3300048912 Bacteria 2167
474 Ga0496109_0259987 3300048912 Bacteria 1635
475 Ga0496114_0298584 3300048917 Bacteria 1422
476 Ga0496114_0557916 3300048917 Unclassified 1012
477 Ga0501295_061926 3300049518 Bacteria 821
478 Ga0501298_021938 3300049521 Bacteria 1199
479 Ga0501300_001526 3300049523 Bacteria 3476
480 Ga0501032_0208337 3300049569 Unclassified 1275
481 Ga0501034_0000004 3300049571 Bacteria 382255
482 Ga0501034_0234856 3300049571 Unclassified 1781
483 Ga0501040_0143580 3300049576 Bacteria 1682
484 Ga0501047_0042291 3300049581 Bacteria 4404
485 Ga0501067_0024184 3300049583 Bacteria 3368
486 Ga0501069_0056749 3300049585 Bacteria 2182
487 Ga0501071_0086034 3300049587 Unclassified 2306
488 Ga0501073_0058420 3300049589 Bacteria 2695
489 Ga0501198_000035 3300049649 Bacteria 54148
490 Ga0501202_001660 3300049652 Bacteria 3601
491 Ga0501206_004858 3300049653 Bacteria 1723
492 Ga0501211_000970 3300049658 Bacteria 3009
493 Ga0501217_001078 3300049661 Bacteria 4958
494 Ga0501222_000039 3300049662 Bacteria 50352
495 Ga0501222_005818 3300049662 Bacteria 1660
496 Ga0501223_001814 3300049663 Bacteria 4819
497 Ga0501233_002533 3300049668 Bacteria 3229
498 Ga0501242_003683 3300049674 Bacteria 1668
499 Ga0501243_003226 3300049675 Bacteria 2405
500 Ga0501221_001662 3300049704 Bacteria 3691
501 Ga0501221_008984 3300049704 Bacteria 1747
502 Ga0501234_001440 3300049707 Bacteria 3738
503 Ga0501245_000364 3300049708 Bacteria 5422
504 Ga0501083_0042950 3300049744 Unclassified 3063
505 Ga0501266_008640 3300049763 Bacteria 1283
506 Ga0501272_004236 3300049769 Bacteria 1485
507 Ga0501283_024293 3300049779 Bacteria 987
508 Ga0501035_0100601 3300049822 Bacteria 2538
509 nmdc:mga03683_1559_c1 3300050489 Bacteria 6835
510 nmdc:mga05p37_421099_c1 3300050507 Bacteria 1554
511 nmdc:mga09592_296995_c1 3300050508 Unclassified 1401
512 nmdc:mga09592_4095_c1 3300050508 Bacteria 11773
513 nmdc:mga0qj67_110320_c1 3300050509 Unclassified 2221
514 nmdc:mga06r32_130066_c1 3300050510 Bacteria 2489
515 nmdc:mga0sz30_44906_c1 3300050516 Bacteria 1862
516 Ga0500568_0015835 3300053139 Bacteria 3365
517 Ga0500568_0015893 3300053139 Bacteria 3358
518 Ga0500622_0000712 3300053156 Bacteria 29089
519 Ga0500622_0003235 3300053156 Bacteria 11065
520 Ga0500637_0262764 3300053178 Bacteria 958
521 Ga0501084_0124387 3300054114 Bacteria 2169
522 Ga0466962_0015115 3300061719 Bacteria 3722
523 2587942655 2585428115 Bacteria 4420269
524 2644217594 2643221639 Bacteria 6649903
525 2644258670 2643221646 Bacteria 6433402
526 2644314619 2643221656 Bacteria 5809961
527 2644337376 2643221660 Bacteria 4208257
528 2929159747 2929154850 Bacteria 6753285
529 Ga0105239_10077295
530 rootH2_10017245
531 rootH2_10059393
532 rootH2_10157128
533 rootL2_10001557
534 rootL2_10230472
535 rootL2_10374887
536 rootH1_10228124
537 Ga0055526_1001717
538 Ga0055531_10000089
539 Ga0070658_10000626
540 Ga0070676_10004792
541 Ga0070676_10498238
542 Ga0070683_100012045
543 Ga0070670_100007249
544 Ga0070670_100494564
545 Ga0070670_100516385
546 Ga0068869_100007191
547 Ga0068869_100080601
548 Ga0070666_10000584
549 Ga0070666_10077045
550 Ga0070666_10138733
551 Ga0070680_100002533
552 Ga0070682_100000300
553 Ga0070682_100075792
554 Ga0070682_100121834
555 Ga0070682_100207126
556 Ga0068868_100000280
557 Ga0068868_100106084
558 Ga0070689_100192036
559 Ga0070691_10009046
560 Ga0070661_100164805
561 Ga0070668_100000267
562 Ga0070668_100048437
563 Ga0070669_100111325
564 Ga0070669_100198239
565 Ga0070675_100285880
566 Ga0070675_100339450
567 Ga0070671_100092794
568 Ga0070671_100146846
569 Ga0070671_100495340
570 Ga0070673_100000422
571 Ga0070673_100120160
572 Ga0070673_100480900
573 Ga0070667_100001041
574 Ga0070667_100001902
575 Ga0070667_100067384
576 Ga0070667_100241385
577 Ga0070667_100558832
578 Ga0070667_100646446
579 Ga0070708_100210188
580 Ga0070678_100051508
581 Ga0070678_100170166
582 Ga0070678_100366974
583 Ga0070662_100006142
584 Ga0070681_10070994
585 Ga0070681_10346472
586 Ga0068867_100000062
587 Ga0068867_100003004
588 Ga0068867_100063520
589 Ga0068867_100339176
590 Ga0070698_100368212
591 Ga0070699_100069681
592 Ga0070679_100014769
593 Ga0070684_100003442
594 Ga0070684_100003776
595 Ga0068853_100012379
596 Ga0068853_100037915
597 Ga0068853_100061608
598 Ga0068853_100087891
599 Ga0068853_100094992
600 Ga0068853_100361773
601 Ga0070672_100000310
602 Ga0070672_100084681
603 Ga0070672_100574817
604 Ga0070693_100030155
605 Ga0070665_100000002
606 Ga0070665_100000916
607 Ga0070665_100261765
608 Ga0070665_100269322
609 Ga0068855_100000303
610 Ga0068855_100020445
611 Ga0068855_100031414
612 Ga0068855_100045306
613 Ga0070664_100082775
614 Ga0070664_100486706
615 Ga0068857_100002628
616 Ga0068854_100006844
617 Ga0068854_100179067
618 Ga0068854_100689940
619 Ga0068856_100026500
620 Ga0068852_100024342
621 Ga0068852_100336610
622 Ga0068852_100476171
623 Ga0068859_100008855
624 Ga0068859_100172532
625 Ga0068864_100000239
626 Ga0068864_100047734
627 Ga0068866_10288809
628 Ga0068861_100009223
629 Ga0068861_100016871
630 Ga0068861_100418282
631 Ga0068851_10000885
632 Ga0068851_10010715
633 Ga0068863_100002445
634 Ga0068858_100000453
635 Ga0068860_100000003
636 Ga0068860_100002191
637 Ga0068860_100002296
638 Ga0068860_100016685
639 Ga0068860_100039517
640 Ga0068860_100246110
641 Ga0068862_100215480
642 Ga0075369_10144699
643 Ga0075366_10032720
644 Ga0097621_100004880
645 Ga0097621_100005359
646 Ga0097621_100299425
647 Ga0075370_10005972
648 Ga0068871_100007116
649 Ga0068871_100007643
650 Ga0075428_100000046
651 Ga0075428_100189081
652 Ga0075430_100028372
653 Ga0075431_100031294
654 Ga0075429_100005109
655 Ga0075429_100114140
656 Ga0068865_100000806
657 Ga0097620_100000408
658 Ga0097620_100008855
659 Ga0097620_100172540
660 Ga0079104_1000688
661 Ga0079104_1000705
662 Ga0105240_10000896
663 Ga0105240_10005231
664 Ga0105240_10005785
665 Ga0105240_10007372
666 Ga0105240_10011047
667 Ga0105240_10011391
668 Ga0105240_10013234
669 Ga0105240_10029839
670 Ga0105240_10037401
671 Ga0105240_10079280
672 Ga0111539_10444115
673 Ga0105245_10102264
674 Ga0105245_10774778
675 Ga0114129_10014385
676 Ga0105243_10007373
677 Ga0105241_10006775
678 Ga0105241_10040637
679 Ga0105241_10137564
680 Ga0105242_10089926
681 Ga0105242_10118419
682 Ga0105248_10011927
683 Ga0105237_10001569
684 Ga0105237_10002147
685 Ga0105237_10021421
686 Ga0105238_10005282
687 Ga0105238_10152898
688 Ga0105238_10369427
689 Ga0105238_10577306
690 Ga0105249_10032531
691 Ga0105249_10105114
692 Ga0105249_10591307
693 Ga0105239_10000486
694 Ga0105239_10006637
695 Ga0105239_10054216
696 Ga0105239_10057697
697 Ga0105239_10867523
698 Ga0105246_10143377
699 Ga0157373_10012269
700 Ga0157373_10027962
701 Ga0157373_10052661
702 Ga0157373_10417538
703 Ga0157371_10012191
704 Ga0157371_10065211
705 Ga0157371_10067108
706 Ga0157370_10006978
707 Ga0157370_10007746
708 Ga0157370_10013306
709 Ga0157370_10039031
710 Ga0157369_10053497
711 Ga0157369_10084127
712 Ga0157374_10000168
713 Ga0157374_10053384
714 Ga0157374_10258419
715 Ga0157374_10448689
716 Ga0157378_10019208
717 Ga0157378_10065396
718 Ga0163162_10000260
719 Ga0163162_10000359
720 Ga0163162_10001104
721 Ga0163162_10010735
722 Ga0163162_10784701
723 Ga0157372_10007509
724 Ga0157372_10031774
725 Ga0157372_10038919
726 Ga0157372_10049205
727 Ga0157372_10123046
728 Ga0157372_10181838
729 Ga0157372_10220389
730 Ga0157372_10225064
731 Ga0157372_10383958
732 Ga0157372_10496381
733 Ga0157372_10583399
734 Ga0157372_10738085
735 Ga0157375_10001148
736 Ga0157375_10051658
737 Ga0163163_10000271
738 Ga0163163_10007757
739 Ga0157380_10012948
740 Ga0157380_10153880
741 Ga0157380_10531959
742 Ga0157377_10000027
743 Ga0157379_10000810
744 Ga0157376_10000827
745 Ga0157376_10005679
746 Ga0157376_10007883
747 Ga0157376_10466774
748 Ga0163161_10257974
749 Ga0213872_10000245
750 Ga0213872_10000871
751 Ga0213872_10035721
752 Ga0209563_100005
753 Ga0209673_1003742
754 Ga0209564_1000051
755 Ga0209050_1005085
756 Ga0209050_1007860
757 Ga0209257_1000021
758 Ga0207656_10001969
759 Ga0207656_10034835
760 Ga0207642_10047006
761 Ga0207680_10039345
762 Ga0207680_10087847
763 Ga0207647_10047909
764 Ga0207645_10006798
765 Ga0207645_10037573
766 Ga0207705_10001456
767 Ga0207654_10000848
768 Ga0207654_10029841
769 Ga0207654_10031268
770 Ga0207707_10000353
771 Ga0207707_10342098
772 Ga0207707_10605855
773 Ga0207695_10000051
774 Ga0207695_10000056
775 Ga0207695_10000066
776 Ga0207695_10000081
777 Ga0207695_10000584
778 Ga0207695_10000725
779 Ga0207695_10008032
780 Ga0207695_10025034
781 Ga0207695_10026375
782 Ga0207695_10040358
783 Ga0207671_10001546
784 Ga0207671_10001963
785 Ga0207671_10002080
786 Ga0207671_10007592
787 Ga0207660_10025794
788 Ga0207649_10136571
789 Ga0207652_10000925
790 Ga0207681_10048674
791 Ga0207694_10010753
792 Ga0207694_10078946
793 Ga0207694_10420430
794 Ga0207694_10494985
795 Ga0207650_10004964
796 Ga0207650_10017228
797 Ga0207650_10154721
798 Ga0207659_10272917
799 Ga0207659_10452297
800 Ga0207687_10082900
801 Ga0207690_10401613
802 Ga0207706_10011497
803 Ga0207706_10029010
804 Ga0207686_10159420
805 Ga0207686_10353099
806 Ga0207709_10001223
807 Ga0207670_10013108
808 Ga0207670_10081279
809 Ga0207669_10098929
810 Ga0207704_10003294
811 Ga0207691_10000234
812 Ga0207691_10025214
813 Ga0207691_10110817
814 Ga0207711_10027850
815 Ga0207689_10001444
816 Ga0207689_10020414
817 Ga0207661_10001240
818 Ga0207679_10007377
819 Ga0207679_10029476
820 Ga0207679_10085798
821 Ga0207667_10003397
822 Ga0207667_10016825
823 Ga0207667_10031292
824 Ga0207667_10102060
825 Ga0207651_10427977
826 Ga0207651_10465622
827 Ga0207712_10068796
828 Ga0207712_10394573
829 Ga0207668_10003318
830 Ga0207668_10134424
831 Ga0207640_10012045
832 Ga0207658_10000950
833 Ga0207658_10001572
834 Ga0207677_10043619
835 Ga0207677_10091042
836 Ga0207677_10092837
837 Ga0207677_10294243
838 Ga0207703_10064758
839 Ga0207639_10015758
840 Ga0207639_10028109
841 Ga0207639_10109115
842 Ga0207639_10187934
843 Ga0207708_10057282
844 Ga0207702_10033690
845 Ga0207702_10070672
846 Ga0207641_10001042
847 Ga0207641_10623380
848 Ga0207648_10000119
849 Ga0207648_10002569
850 Ga0207648_10014354
851 Ga0207648_10196961
852 Ga0207676_10004399
853 Ga0207676_10037575
854 Ga0207674_10002340
855 Ga0207674_10643762
856 Ga0207675_100001157
857 Ga0207675_100023157
858 Ga0207675_100082781
859 Ga0207683_10010579
860 Ga0207683_10255309
861 Ga0207683_10662171
862 Ga0207698_10055836
863 Ga0207698_10110770
864 Ga0207698_10191562
865 Ga0209281_1000042
866 Ga0209281_1000357
867 Ga0268266_10000073
868 Ga0268266_10003852
869 Ga0268266_10245726
870 Ga0268265_10152014
871 Ga0268264_10000063
872 Ga0268264_10003545
873 Ga0268264_10007323
874 Ga0268264_10020330
875 Ga0268264_10283292
876 Ga0268264_10714930
877 Ga0307515_10000001
878 Ga0307515_10000101
879 Ga0307515_10001683
880 Ga0307515_10009043
881 Ga0307511_10000232
882 Ga0265328_10052863
883 Ga0265331_10035584
884 Ga0265327_10000012
885 Ga0265327_10003620
886 Ga0265327_10090397
887 Ga0265327_10157887
888 Ga0307513_10193579
889 Ga0307408_100000743
890 Ga0316578_10059001
891 Ga0307516_10000675
892 Ga0307516_10006751
893 Ga0307516_10006807
894 Ga0307516_10036754
895 Ga0307516_10102364
896 Ga0307413_10044325
897 Ga0307414_10369248
898 Ga0307414_10515618
899 Ga0307414_10697544
900 Ga0307411_10000432
901 Ga0307510_10001580
902 Ga0307510_10386329
903 Ga0373940_0005769
904 Ga0373951_0017004
905 Ga0373932_0026208
906 Ga0373939_0000008
907 Ga0373960_0006004
908 Ga0373962_0006156
909 Ga0373931_0000801
910 Ga0373937_0084010
911 Ga0373937_0772998
912 Ga0395900_0031383
913 Ga0395905_0017395
914 Ga0395905_0043709
915 Ga0395901_0015893
916 Ga0400483_108838
917 Ga0400483_120491
918 Ga0400483_150751
919 Ga0400483_196821
920 Ga0436361_0182228
921 Ga0436361_0254808
922 Ga0436361_0767394
923 Ga0436361_0854850
924 Ga0439438_020749
925 Ga0439453_0008491
926 Ga0451797_0517402
927 Ga0439431_0007494
928 Ga0439449_0001694
929 Ga0439455_0020344
930 Ga0439457_004483
931 Ga0439457_014220
932 Ga0450917_000321
933 Ga0450888_000039
934 Ga0450890_003444
935 Ga0450891_000577
936 Ga0450892_000102
937 Ga0450894_004633
938 Ga0450902_028625
939 Ga0439434_0009138
940 Ga0439434_0051186
941 Ga0450893_0006102
942 Ga0451577_0000498
943 Ga0451577_0003560
944 Ga0451577_0013934
945 Ga0451577_0033467
946 Ga0451577_0122633
947 Ga0451577_0215743
948 Ga0466972_0030302
949 Ga0453683_0002009
950 Ga0453683_0014720
951 Ga0466965_0084540
952 Ga0466964_0088678
953 Ga0453684_0002188
954 Ga0453684_0089246
955 Ga0453684_0231895
956 Ga0453684_0519071
957 Ga0466971_0007043
958 Ga0466957_0078923
959 Ga0466960_0073666
960 Ga0466960_0355920
961 Ga0466959_0015868
962 Ga0451576_0006261
963 Ga0451576_0009658
964 Ga0451576_0034521
965 Ga0451576_0060174
966 Ga0451576_0062740
967 Ga0451576_0132360
968 Ga0466958_0031842
969 Ga0495627_000003
970 Ga0495603_0068127
971 Ga0495629_0018507
972 Ga0495629_0060756
973 Ga0495638_0036508
974 Ga0495650_0093344
975 Ga0495582_0004882
976 Ga0495582_0077566
977 Ga0495639_0026942
978 Ga0495639_0085323
979 Ga0495594_0208527
980 Ga0495606_0006396
981 Ga0495648_0001549
982 Ga0495654_0000001
983 Ga0495587_0181403
984 Ga0495633_0000002
985 Ga0495668_0000202
986 Ga0495611_0000037
987 Ga0495611_0041109
988 Ga0495658_0001794
989 Ga0495658_0257148
990 Ga0495636_0000082
991 Ga0495676_0034610
992 Ga0495680_0086703
993 Ga0495687_000040
994 Ga0495686_0000010
995 Ga0495686_0015893
996 Ga0495686_0023463
997 Ga0495686_0063158
998 Ga0495686_0099167
999 Ga0496104_0487675
1000 Ga0496108_0078457
1001 Ga0496109_0152064
1002 Ga0496109_0259987
1003 Ga0496114_0298584
1004 Ga0496114_0557916
1005 Ga0501295_061926
1006 Ga0501298_021938
1007 Ga0501300_001526
1008 Ga0501032_0208337
1009 Ga0501034_0000004
1010 Ga0501034_0234856
1011 Ga0501040_0143580
1012 Ga0501047_0042291
1013 Ga0501067_0024184
1014 Ga0501069_0056749
1015 Ga0501071_0086034
1016 Ga0501073_0058420
1017 Ga0501198_000035
1018 Ga0501202_001660
1019 Ga0501206_004858
1020 Ga0501211_000970
1021 Ga0501217_001078
1022 Ga0501222_000039
1023 Ga0501222_005818
1024 Ga0501223_001814
1025 Ga0501233_002533
1026 Ga0501242_003683
1027 Ga0501243_003226
1028 Ga0501221_001662
1029 Ga0501221_008984
1030 Ga0501234_001440
1031 Ga0501245_000364
1032 Ga0501083_0042950
1033 Ga0501266_008640
1034 Ga0501272_004236
1035 Ga0501283_024293
1036 Ga0501035_0100601
1037 nmdc:mga03683_1559_c1
1038 nmdc:mga05p37_421099_c1
1039 nmdc:mga09592_296995_c1
1040 nmdc:mga09592_4095_c1
1041 nmdc:mga0qj67_110320_c1
1042 nmdc:mga06r32_130066_c1
1043 nmdc:mga0sz30_44906_c1
1044 Ga0500568_0015835
1045 Ga0500568_0015893
1046 Ga0500622_0000712
1047 Ga0500622_0003235
1048 Ga0500637_0262764
1049 Ga0501084_0124387
1050 Ga0466962_0015115
1051 2587942655
1052 2644217594
1053 2644258670
1054 2644314619
1055 2644337376
1056 2929159747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01987

AIM24

Mitochondrial biogenesis AIM24

40

260

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yox-assembly1.cif.gz_C structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9188 6 240
1yox-assembly1.cif.gz_B structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9168 5 242
1yox-assembly2.cif.gz_D structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9124 5 242
1yox-assembly2.cif.gz_F structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9079 5 240
1yox-assembly1.cif.gz_A structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa 0.9069 6 240
ID Description Score Start End Superfamily
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.9027 6 240 3.60.160.10
1yoxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8522 6 240 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.8027 1 240 3.60.160.10
af_Q54F06_101_330_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7929 1 240 3.60.160.10
1pg6A00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7823 8 241 3.60.160.10
ID Description Score Start End GO Terms
AF-A0A6M0BLV1-F1-model_v4 AIM24 family protein 0.9394 101 248
AF-A0A2V7VFC8-F1-model_v4 TIGR00266 family protein 0.9305 106 244
AF-A0A4Q3R9G4-F1-model_v4 AIM24 family protein 0.9276 98 234
AF-A0A7S1GJ19-F1-model_v4 Altered inheritance of mitochondria protein 24, mitochondrial 0.9264 101 231
AF-A0A2D9JSE9-F1-model_v4 TIGR00266 family protein 0.9233 83 240

Map