F459674

General Info

Members Datasets Scaffolds Average Seq Length
528 299 1056 198

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10004143|Ga0213872_100041432
Length 205
Sequence MAASNASVPRIAIASAEPLNLYEKLNSQWHEWALLTFMVIVLAHWGEHLAQAYQIWIMGWPRLKANGILGLWFPWLIQSEVLHYSYALVMLLGIWVLRKGFTGLSRKWWTVALVIQFWHHIEHLLLLTQAFILHRNFWGRPVPCSVLQLVFPRIELHLFYNSVVFIPMMIGMYYHMFPPETEAVKAACTCSWHRAETKDGIACAA

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
122 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
123 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
225 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
226 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
295 2501939600 Micromonospora sp. L5 Isolate Unclassified
296 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
297 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
298 649633069 Micromonospora sp. L5 Isolate Unclassified
299 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 3.79
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 6.25
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10004143 3300021361 Bacteria 7794
2 Ga0006777J48905_1021007 3300003308 Bacteria 601
3 Ga0058860_12035151 3300004801 Bacteria 749
4 Ga0065712_10135520 3300005290 Bacteria 1501
5 Ga0065712_10427107 3300005290 Bacteria 706
6 Ga0065715_10618659 3300005293 Unclassified 697
7 Ga0070658_10030661 3300005327 Bacteria 4319
8 Ga0070658_10376939 3300005327 Bacteria 1217
9 Ga0070676_10017067 3300005328 Bacteria 4013
10 Ga0070683_100055330 3300005329 Bacteria 3682
11 Ga0070683_100089409 3300005329 Bacteria 2890
12 Ga0070683_100145302 3300005329 Bacteria 2247
13 Ga0070690_100051438 3300005330 Bacteria 2630
14 Ga0068869_100120912 3300005334 Bacteria 2003
15 Ga0070666_10020949 3300005335 Bacteria 4233
16 Ga0070666_10045018 3300005335 Bacteria 2957
17 Ga0070680_100019083 3300005336 Bacteria 5429
18 Ga0070680_100314195 3300005336 Bacteria 1330
19 Ga0070682_100039497 3300005337 Bacteria 2900
20 Ga0068868_100021723 3300005338 Unclassified 4836
21 Ga0068868_100149185 3300005338 Bacteria 1925
22 Ga0070660_100032795 3300005339 Bacteria 3911
23 Ga0070689_100525828 3300005340 Bacteria 1016
24 Ga0070691_10346756 3300005341 Bacteria 823
25 Ga0070661_100034870 3300005344 Bacteria 3651
26 Ga0070661_100266446 3300005344 Bacteria 1326
27 Ga0070692_10044815 3300005345 Bacteria 2280
28 Ga0070668_100004117 3300005347 Bacteria 10766
29 Ga0070668_100031683 3300005347 Bacteria 4022
30 Ga0070669_100117395 3300005353 Bacteria 2026
31 Ga0070669_100607534 3300005353 Unclassified 917
32 Ga0070674_100316699 3300005356 Bacteria 1249
33 Ga0070688_100855936 3300005365 Bacteria 714
34 Ga0070659_100004678 3300005366 Bacteria 9769
35 Ga0070659_100414713 3300005366 Bacteria 1138
36 Ga0070667_100080768 3300005367 Bacteria 2782
37 Ga0070667_100140185 3300005367 Bacteria 2117
38 Ga0070703_10071338 3300005406 Bacteria 1161
39 Ga0070709_10029856 3300005434 Bacteria 3265
40 Ga0070709_10192042 3300005434 Bacteria 1441
41 Ga0070709_10270073 3300005434 Bacteria 1232
42 Ga0070709_10358408 3300005434 Unclassified 1079
43 Ga0070714_100476091 3300005435 Unclassified 1188
44 Ga0070713_100196594 3300005436 Unclassified 1819
45 Ga0070713_100238497 3300005436 Bacteria 1655
46 Ga0070713_100688084 3300005436 Bacteria 976
47 Ga0070710_10050391 3300005437 Bacteria 2334
48 Ga0070710_10174328 3300005437 Bacteria 1342
49 Ga0070710_10192308 3300005437 Bacteria 1284
50 Ga0070701_10290562 3300005438 Bacteria 1001
51 Ga0070711_100001349 3300005439 Bacteria 13399
52 Ga0070711_100015471 3300005439 Bacteria 4829
53 Ga0070711_100114450 3300005439 Bacteria 1985
54 Ga0070705_100685382 3300005440 Bacteria 803
55 Ga0070700_100078032 3300005441 Bacteria 2131
56 Ga0070708_100000738 3300005445 Bacteria 24771
57 Ga0070708_100171250 3300005445 Bacteria 2027
58 Ga0070663_100029785 3300005455 Bacteria 3734
59 Ga0070678_101362240 3300005456 Bacteria 662
60 Ga0070662_100000633 3300005457 Bacteria 21302
61 Ga0070681_10047604 3300005458 Bacteria 4286
62 Ga0070681_10259018 3300005458 Bacteria 1652
63 Ga0070681_10492937 3300005458 Unclassified 1138
64 Ga0068867_100044815 3300005459 Bacteria 3241
65 Ga0068867_100093233 3300005459 Bacteria 2288
66 Ga0068867_101460210 3300005459 Bacteria 636
67 Ga0070685_10365153 3300005466 Bacteria 990
68 Ga0070706_100000513 3300005467 Bacteria 45430
69 Ga0070706_100006801 3300005467 Bacteria 10795
70 Ga0070707_100752397 3300005468 Unclassified 938
71 Ga0070707_100854079 3300005468 Bacteria 874
72 Ga0070707_100977816 3300005468 Unclassified 812
73 Ga0070699_100581791 3300005518 Bacteria 1020
74 Ga0070679_100013265 3300005530 Bacteria 7887
75 Ga0070679_100331409 3300005530 Bacteria 1470
76 Ga0070684_100009200 3300005535 Bacteria 7773
77 Ga0070684_100017255 3300005535 Bacteria 5919
78 Ga0070684_100170745 3300005535 Bacteria 1975
79 Ga0070684_100703001 3300005535 Bacteria 942
80 Ga0070697_100002640 3300005536 Bacteria 13792
81 Ga0068853_100028408 3300005539 Bacteria 4704
82 Ga0068853_100065157 3300005539 Bacteria 3161
83 Ga0068853_100598788 3300005539 Bacteria 1047
84 Ga0070686_100224216 3300005544 Bacteria 1360
85 Ga0070695_100109511 3300005545 Bacteria 1872
86 Ga0070695_100115618 3300005545 Bacteria 1828
87 Ga0070696_100078070 3300005546 Bacteria 2340
88 Ga0070665_100008972 3300005548 Bacteria 10132
89 Ga0070704_100314657 3300005549 Bacteria 1309
90 Ga0070704_101404133 3300005549 Bacteria 641
91 Ga0068855_100123160 3300005563 Bacteria 2967
92 Ga0068855_100257000 3300005563 Bacteria 1947
93 Ga0070664_100034537 3300005564 Bacteria 4242
94 Ga0070664_100073230 3300005564 Bacteria 2939
95 Ga0068857_100651021 3300005577 Bacteria 998
96 Ga0068854_100062264 3300005578 Bacteria 2704
97 Ga0068854_100227369 3300005578 Bacteria 1479
98 Ga0068854_100692508 3300005578 Unclassified 879
99 Ga0068856_100149991 3300005614 Bacteria 2340
100 Ga0068856_100207707 3300005614 Bacteria 1973
101 Ga0068856_100548743 3300005614 Bacteria 1177
102 Ga0068852_100029764 3300005616 Unclassified 4488
103 Ga0068859_100068111 3300005617 Bacteria 3594
104 Ga0068859_100949596 3300005617 Bacteria 943
105 Ga0068864_100049830 3300005618 Bacteria 3603
106 Ga0068866_10081925 3300005718 Bacteria 1734
107 Ga0068861_100250769 3300005719 Bacteria 1510
108 Ga0068861_100338308 3300005719 Bacteria 1316
109 Ga0068851_10008677 3300005834 Bacteria 4708
110 Ga0068863_100238201 3300005841 Bacteria 1756
111 Ga0068863_100238725 3300005841 Bacteria 1754
112 Ga0068863_100244317 3300005841 Bacteria 1733
113 Ga0068858_100300533 3300005842 Bacteria 1531
114 Ga0068858_100366939 3300005842 Bacteria 1380
115 Ga0068858_100644217 3300005842 Bacteria 1029
116 Ga0068860_100001368 3300005843 Bacteria 26474
117 Ga0068860_100090334 3300005843 Unclassified 2917
118 Ga0068860_100314396 3300005843 Bacteria 1536
119 Ga0068860_100581265 3300005843 Bacteria 1124
120 Ga0068862_100100210 3300005844 Bacteria 2533
121 Ga0068862_100294772 3300005844 Bacteria 1491
122 Ga0081538_10002698 3300005981 Bacteria 17073
123 Ga0081538_10090063 3300005981 Bacteria 1590
124 Ga0081538_10187866 3300005981 Bacteria 872
125 Ga0070717_10000937 3300006028 Bacteria 19449
126 Ga0070717_10167952 3300006028 Unclassified 1907
127 Ga0070717_10497147 3300006028 Unclassified 1102
128 Ga0070715_10011378 3300006163 Unclassified 3204
129 Ga0070715_10042663 3300006163 Bacteria 1908
130 Ga0070715_10135280 3300006163 Unclassified 1191
131 Ga0070715_10157490 3300006163 Bacteria 1119
132 Ga0070716_100040079 3300006173 Bacteria 2604
133 Ga0070716_100051232 3300006173 Bacteria 2346
134 Ga0070712_100010193 3300006175 Bacteria 5923
135 Ga0070712_100083691 3300006175 Bacteria 2317
136 Ga0070712_100245138 3300006175 Bacteria 1429
137 Ga0070712_100368725 3300006175 Unclassified 1179
138 Ga0097621_100032690 3300006237 Bacteria 4137
139 Ga0097621_100053436 3300006237 Bacteria 3293
140 Ga0097621_100950414 3300006237 Bacteria 802
141 Ga0068871_100006026 3300006358 Bacteria 8531
142 Ga0068871_100016646 3300006358 Bacteria 5546
143 Ga0075428_100040435 3300006844 Bacteria 5130
144 Ga0075430_100005845 3300006846 Bacteria 10382
145 Ga0075430_100012159 3300006846 Bacteria 7329
146 Ga0075431_100042148 3300006847 Bacteria 4707
147 Ga0075431_100113411 3300006847 Bacteria 2798
148 Ga0075434_100030446 3300006871 Bacteria 5314
149 Ga0075434_100036750 3300006871 Bacteria 4845
150 Ga0075429_100000900 3300006880 Bacteria 23516
151 Ga0068865_100117302 3300006881 Bacteria 1973
152 Ga0075436_100288657 3300006914 Bacteria 1174
153 Ga0097620_100068115 3300006931 Bacteria 3594
154 Ga0097620_100949344 3300006931 Bacteria 943
155 Ga0105240_10170818 3300009093 Bacteria 2576
156 Ga0105240_10514578 3300009093 Bacteria 1329
157 Ga0105240_10666572 3300009093 Bacteria 1139
158 Ga0105240_10865807 3300009093 Bacteria 974
159 Ga0111539_10461436 3300009094 Bacteria 1479
160 Ga0111539_11308511 3300009094 Bacteria 841
161 Ga0105245_10046572 3300009098 Bacteria 3875
162 Ga0105245_10150076 3300009098 Unclassified 2203
163 Ga0105245_10400310 3300009098 Bacteria 1372
164 Ga0105247_10022748 3300009101 Bacteria 3774
165 Ga0105247_10215686 3300009101 Bacteria 1297
166 Ga0105247_10278201 3300009101 Bacteria 1154
167 Ga0105247_10329008 3300009101 Unclassified 1069
168 Ga0114129_10000594 3300009147 Bacteria 44664
169 Ga0114129_10030585 3300009147 Bacteria 7618
170 Ga0114129_10154249 3300009147 Bacteria 3142
171 Ga0105243_10047917 3300009148 Bacteria 3367
172 Ga0105241_10002436 3300009174 Bacteria 13968
173 Ga0105241_10028589 3300009174 Bacteria 4155
174 Ga0105242_10031727 3300009176 Bacteria 4223
175 Ga0105242_10227871 3300009176 Unclassified 1668
176 Ga0105248_10000002 3300009177 Bacteria 1054120
177 Ga0105248_10052839 3300009177 Bacteria 4560
178 Ga0105248_10072512 3300009177 Bacteria 3870
179 Ga0105248_10246107 3300009177 Bacteria 2013
180 Ga0105248_10652070 3300009177 Unclassified 1188
181 Ga0105237_10011561 3300009545 Bacteria 9335
182 Ga0105237_10036842 3300009545 Bacteria 4948
183 Ga0105237_10366841 3300009545 Bacteria 1445
184 Ga0105238_10046127 3300009551 Bacteria 4400
185 Ga0105238_10221744 3300009551 Bacteria 1867
186 Ga0105238_10532186 3300009551 Bacteria 1178
187 Ga0105249_10061222 3300009553 Bacteria 3454
188 Ga0105239_10036478 3300010375 Bacteria 5398
189 Ga0105239_10066900 3300010375 Unclassified 3947
190 Ga0105239_10143275 3300010375 Bacteria 2664
191 Ga0105239_10148898 3300010375 Bacteria 2612
192 Ga0105239_10150792 3300010375 Bacteria 2594
193 Ga0105239_10240115 3300010375 Bacteria 2034
194 Ga0105239_10414437 3300010375 Bacteria 1525
195 Ga0105239_10901742 3300010375 Bacteria 1015
196 Ga0105246_10046278 3300011119 Bacteria 2967
197 Ga0157373_10003349 3300013100 Bacteria 12108
198 Ga0157371_10024212 3300013102 Bacteria 4435
199 Ga0157370_10086551 3300013104 Bacteria 2944
200 Ga0157370_10102796 3300013104 Bacteria 2675
201 Ga0157370_10273500 3300013104 Bacteria 1560
202 Ga0157369_10011870 3300013105 Bacteria 9895
203 Ga0157369_10014804 3300013105 Bacteria 8801
204 Ga0157369_10057472 3300013105 Unclassified 4197
205 Ga0157369_10061603 3300013105 Unclassified 4044
206 Ga0157374_10001768 3300013296 Bacteria 18179
207 Ga0157374_10002311 3300013296 Bacteria 16061
208 Ga0157374_10033266 3300013296 Bacteria 4703
209 Ga0157374_10066813 3300013296 Unclassified 3379
210 Ga0157374_10078008 3300013296 Unclassified 3136
211 Ga0157374_10100846 3300013296 Bacteria 2768
212 Ga0157374_10202640 3300013296 Bacteria 1943
213 Ga0157378_10000116 3300013297 Bacteria 76918
214 Ga0157378_10019356 3300013297 Bacteria 5986
215 Ga0157378_10024500 3300013297 Bacteria 5311
216 Ga0157378_10120730 3300013297 Bacteria 2415
217 Ga0157378_10163344 3300013297 Bacteria 2084
218 Ga0157378_10295809 3300013297 Bacteria 1565
219 Ga0157378_10554304 3300013297 Bacteria 1155
220 Ga0163162_10000276 3300013306 Bacteria 46939
221 Ga0163162_10002087 3300013306 Bacteria 18776
222 Ga0163162_10009658 3300013306 Bacteria 9382
223 Ga0163162_10016226 3300013306 Bacteria 7285
224 Ga0163162_10242455 3300013306 Bacteria 1933
225 Ga0157372_10005027 3300013307 Bacteria 14048
226 Ga0157372_10026716 3300013307 Bacteria 6282
227 Ga0157375_10157138 3300013308 Bacteria 2413
228 Ga0157375_10362758 3300013308 Bacteria 1615
229 Ga0163163_10235307 3300014325 Bacteria 1881
230 Ga0157380_11364486 3300014326 Bacteria 758
231 Ga0157379_10004733 3300014968 Bacteria 11677
232 Ga0157379_10017789 3300014968 Bacteria 6261
233 Ga0157379_10156992 3300014968 Unclassified 2053
234 Ga0157376_10024673 3300014969 Bacteria 4725
235 Ga0157376_10037772 3300014969 Bacteria 3924
236 Ga0197907_10176513 3300020069 Bacteria 1261
237 Ga0206356_10204261 3300020070 Bacteria 1264
238 Ga0206349_1974281 3300020075 Bacteria 1715
239 Ga0206355_1044040 3300020076 Bacteria 1152
240 Ga0206351_10008801 3300020077 Bacteria 868
241 Ga0206352_10605626 3300020078 Bacteria 865
242 Ga0206350_10398142 3300020080 Bacteria 1254
243 Ga0206353_10400349 3300020082 Bacteria 1403
244 Ga0154015_1082286 3300020610 Bacteria 1236
245 Ga0213872_10004718 3300021361 Bacteria 7153
246 Ga0224712_10035108 3300022467 Bacteria 1849
247 Ga0224712_10295230 3300022467 Bacteria 757
248 Ga0224570_100306 3300022730 Bacteria 3750
249 Ga0224569_100952 3300022732 Bacteria 2455
250 Ga0224571_100082 3300022734 Bacteria 3567
251 Ga0224572_1001174 3300024225 Bacteria 3738
252 Ga0228598_1002753 3300024227 Bacteria 3806
253 Ga0228598_1006335 3300024227 Bacteria 2452
254 Ga0207656_10061587 3300025321 Bacteria 1647
255 Ga0207642_10007985 3300025899 Bacteria 3604
256 Ga0207710_10032372 3300025900 Bacteria 2290
257 Ga0207710_10284946 3300025900 Bacteria 832
258 Ga0207680_10035426 3300025903 Bacteria 2866
259 Ga0207680_10201910 3300025903 Bacteria 1355
260 Ga0207647_10045784 3300025904 Bacteria 2728
261 Ga0207685_10046550 3300025905 Bacteria 1651
262 Ga0207699_10370028 3300025906 Unclassified 1015
263 Ga0207645_10035737 3300025907 Bacteria 3190
264 Ga0207643_10394260 3300025908 Bacteria 874
265 Ga0207705_10036746 3300025909 Bacteria 3504
266 Ga0207705_10125448 3300025909 Bacteria 1908
267 Ga0207684_10003326 3300025910 Bacteria 15794
268 Ga0207684_10021524 3300025910 Bacteria 5505
269 Ga0207654_10006330 3300025911 Bacteria 5951
270 Ga0207654_10022183 3300025911 Bacteria 3385
271 Ga0207654_10040928 3300025911 Bacteria 2614
272 Ga0207654_10475231 3300025911 Bacteria 880
273 Ga0207707_10004378 3300025912 Bacteria 12481
274 Ga0207695_10055445 3300025913 Bacteria 4130
275 Ga0207695_10087568 3300025913 Bacteria 3137
276 Ga0207671_10043315 3300025914 Bacteria 3329
277 Ga0207671_10330307 3300025914 Bacteria 1207
278 Ga0207693_10000241 3300025915 Bacteria 50544
279 Ga0207693_10001380 3300025915 Bacteria 21546
280 Ga0207693_10014021 3300025915 Bacteria 6453
281 Ga0207693_10354515 3300025915 Bacteria 1148
282 Ga0207663_10001691 3300025916 Bacteria 10369
283 Ga0207663_10108603 3300025916 Bacteria 1879
284 Ga0207663_10426934 3300025916 Bacteria 1018
285 Ga0207660_10016551 3300025917 Bacteria 4882
286 Ga0207660_10311847 3300025917 Bacteria 1255
287 Ga0207657_10000238 3300025919 Bacteria 58154
288 Ga0207657_10084022 3300025919 Bacteria 2670
289 Ga0207649_10032698 3300025920 Bacteria 3103
290 Ga0207649_10124952 3300025920 Bacteria 1739
291 Ga0207652_10020305 3300025921 Bacteria 5469
292 Ga0207652_10148645 3300025921 Bacteria 2097
293 Ga0207652_10168023 3300025921 Bacteria 1968
294 Ga0207652_10571797 3300025921 Bacteria 1015
295 Ga0207646_10359400 3300025922 Unclassified 1316
296 Ga0207681_10444898 3300025923 Bacteria 1053
297 Ga0207681_10886461 3300025923 Bacteria 747
298 Ga0207694_10067150 3300025924 Bacteria 2799
299 Ga0207694_10263477 3300025924 Bacteria 1412
300 Ga0207694_10269607 3300025924 Bacteria 1396
301 Ga0207694_10430048 3300025924 Bacteria 1100
302 Ga0207687_10016622 3300025927 Bacteria 4833
303 Ga0207687_10034639 3300025927 Bacteria 3429
304 Ga0207700_10366402 3300025928 Unclassified 1257
305 Ga0207700_10785010 3300025928 Unclassified 852
306 Ga0207664_10541425 3300025929 Bacteria 1044
307 Ga0207690_10010614 3300025932 Bacteria 5484
308 Ga0207706_10000491 3300025933 Bacteria 42248
309 Ga0207686_10077605 3300025934 Bacteria 2157
310 Ga0207686_10421285 3300025934 Bacteria 1021
311 Ga0207709_10258425 3300025935 Bacteria 1276
312 Ga0207704_10127673 3300025938 Unclassified 1754
313 Ga0207704_10808862 3300025938 Bacteria 783
314 Ga0207665_10020570 3300025939 Bacteria 4337
315 Ga0207665_10183951 3300025939 Bacteria 1515
316 Ga0207711_10000041 3300025941 Bacteria 158803
317 Ga0207711_10048682 3300025941 Bacteria 3626
318 Ga0207711_10154451 3300025941 Bacteria 2073
319 Ga0207711_10170914 3300025941 Bacteria 1972
320 Ga0207689_10033762 3300025942 Bacteria 4250
321 Ga0207661_10023993 3300025944 Bacteria 4615
322 Ga0207661_10360382 3300025944 Bacteria 1313
323 Ga0207679_10732935 3300025945 Bacteria 898
324 Ga0207667_10074361 3300025949 Bacteria 3530
325 Ga0207667_10407465 3300025949 Bacteria 1384
326 Ga0207668_10002401 3300025972 Bacteria 10953
327 Ga0207668_10028872 3300025972 Bacteria 3631
328 Ga0207640_10010743 3300025981 Bacteria 5164
329 Ga0207640_10211879 3300025981 Bacteria 1477
330 Ga0207658_10072509 3300025986 Bacteria 2611
331 Ga0207658_10252016 3300025986 Bacteria 1500
332 Ga0207677_10050030 3300026023 Unclassified 2825
333 Ga0207677_10087908 3300026023 Bacteria 2251
334 Ga0207703_10286349 3300026035 Bacteria 1498
335 Ga0207703_10343852 3300026035 Bacteria 1372
336 Ga0207639_10348367 3300026041 Bacteria 1322
337 Ga0207639_11123044 3300026041 Bacteria 737
338 Ga0207678_10001218 3300026067 Bacteria 23676
339 Ga0207702_10226624 3300026078 Bacteria 1744
340 Ga0207702_10331641 3300026078 Bacteria 1451
341 Ga0207702_11287479 3300026078 Bacteria 725
342 Ga0207641_10064969 3300026088 Bacteria 3120
343 Ga0207641_10116393 3300026088 Bacteria 2378
344 Ga0207641_10221731 3300026088 Bacteria 1754
345 Ga0207641_10227869 3300026088 Bacteria 1731
346 Ga0207648_10006054 3300026089 Bacteria 12060
347 Ga0207648_10835613 3300026089 Bacteria 858
348 Ga0207674_10005605 3300026116 Bacteria 14882
349 Ga0207675_100194728 3300026118 Bacteria 1945
350 Ga0207683_10699289 3300026121 Bacteria 940
351 Ga0207698_10166056 3300026142 Bacteria 1937
352 Ga0265356_1000156 3300028017 Bacteria 12307
353 Ga0265356_1017488 3300028017 Unclassified 776
354 Ga0268266_10028039 3300028379 Bacteria 4788
355 Ga0268265_10932497 3300028380 Bacteria 854
356 Ga0268264_10051939 3300028381 Bacteria 3417
357 Ga0268264_10252090 3300028381 Bacteria 1640
358 Ga0268264_10745267 3300028381 Bacteria 975
359 Ga0268264_10796286 3300028381 Bacteria 944
360 Ga0307515_10045412 3300028794 Bacteria 6751
361 Ga0265338_10007813 3300028800 Bacteria 13150
362 Ga0265338_10100861 3300028800 Unclassified 2352
363 Ga0307512_10008700 3300030522 Bacteria 9863
364 Ga0265762_1023950 3300030760 Bacteria 1133
365 Ga0265767_101783 3300030836 Unclassified 1093
366 Ga0265770_1009178 3300030878 Unclassified 1422
367 Ga0265765_1003912 3300030879 Unclassified 1512
368 Ga0265765_1007202 3300030879 Unclassified 1194
369 Ga0265760_10003906 3300031090 Bacteria 4312
370 Ga0265332_10133917 3300031238 Bacteria 1039
371 Ga0265325_10110809 3300031241 Bacteria 1334
372 Ga0265331_10319692 3300031250 Bacteria 695
373 Ga0307513_10035616 3300031456 Bacteria 5565
374 Ga0307513_10076694 3300031456 Bacteria 3465
375 Ga0307408_100707711 3300031548 Bacteria 906
376 Ga0265314_10008427 3300031711 Bacteria 8833
377 Ga0265342_10120332 3300031712 Unclassified 1479
378 Ga0265342_10258874 3300031712 Bacteria 926
379 Ga0247548_103921 3300031814 Unclassified 680
380 Ga0307413_10974332 3300031824 Bacteria 725
381 Ga0307406_10068498 3300031901 Bacteria 2317
382 Ga0307406_10155007 3300031901 Bacteria 1639
383 Ga0307406_10170438 3300031901 Bacteria 1575
384 Ga0307414_10167865 3300032004 Bacteria 1751
385 Ga0307411_10292127 3300032005 Bacteria 1303
386 Ga0307411_10389052 3300032005 Bacteria 1149
387 Ga0307415_100131219 3300032126 Bacteria 1897
388 Ga0307415_100683222 3300032126 Bacteria 924
389 Ga0307507_10338642 3300033179 Bacteria 893
390 Ga0316212_1009233 3300033547 Viruses 1417
391 Ga0316212_1016103 3300033547 Unclassified 1056
392 Ga0373938_0015017 3300034957 Bacteria 1494
393 Ga0373944_0088216 3300035089 Bacteria 1033
394 Ga0373951_0000202 3300035091 Bacteria 21692
395 Ga0373951_0044560 3300035091 Bacteria 1078
396 Ga0373932_0015608 3300035112 Bacteria 1927
397 Ga0373939_0175946 3300035114 Bacteria 795
398 Ga0373941_0033368 3300035115 Bacteria 1547
399 Ga0373954_0106478 3300035118 Unclassified 1355
400 Ga0373957_0062701 3300035120 Unclassified 1443
401 Ga0373955_0039912 3300035172 Bacteria 2508
402 Ga0373955_0294964 3300035172 Bacteria 977
403 Ga0373942_0112670 3300035207 Bacteria 843
404 Ga0373961_0079593 3300035241 Bacteria 1029
405 Ga0373931_0022744 3300035691 Bacteria 3157
406 Ga0373931_0060172 3300035691 Bacteria 2044
407 Ga0373935_0282643 3300035692 Bacteria 1168
408 Ga0373927_0044344 3300035695 Bacteria 2877
409 Ga0373947_0003454 3300035725 Bacteria 9339
410 Ga0373937_0140159 3300036401 Bacteria 2262
411 Ga0373925_0002252 3300037068 Bacteria 15623
412 Ga0373925_0052033 3300037068 Bacteria 3059
413 Ga0373925_0130278 3300037068 Bacteria 1960
414 Ga0373925_0437989 3300037068 Bacteria 1069
415 Ga0395898_0611003 3300037466 Unclassified 1033
416 Ga0436361_0353634 3300039447 Bacteria 2338
417 Ga0436361_0669362 3300039447 Bacteria 30067
418 Ga0436361_0928506 3300039447 Bacteria 12324
419 Ga0451791_1757185 3300041451 Bacteria 1067
420 Ga0450894_015792 3300042131 Bacteria 1001
421 Ga0450918_011878 3300042531 Bacteria 1518
422 Ga0451576_0107725 3300045051 Bacteria 2900
423 Ga0495580_0017593 3300046472 Bacteria 5340
424 Ga0495580_0090596 3300046472 Bacteria 2129
425 Ga0495582_0064687 3300046473 Bacteria 2020
426 Ga0495594_0028206 3300046499 Bacteria 3028
427 Ga0495606_0002986 3300046507 Bacteria 18594
428 Ga0495665_0135991 3300046531 Unclassified 1285
429 Ga0495656_0000011 3300046615 Bacteria 150535
430 Ga0495668_0001427 3300046616 Bacteria 23180
431 Ga0495625_0007391 3300046660 Bacteria 9570
432 Ga0495635_0063126 3300046663 Bacteria 2544
433 Ga0495659_0003255 3300046664 Bacteria 5207
434 Ga0495657_0166835 3300046675 Bacteria 1359
435 Ga0495658_0689768 3300046683 Bacteria 654
436 Ga0495669_0088222 3300046684 Bacteria 1430
437 Ga0495600_0368295 3300046809 Bacteria 898
438 Ga0495581_0073335 3300047315 Bacteria 1981
439 Ga0495581_0148957 3300047315 Bacteria 1366
440 Ga0495626_0000174 3300048091 Bacteria 79833
441 Ga0496100_0012859 3300048903 Bacteria 4812
442 Ga0496100_0088890 3300048903 Bacteria 2103
443 Ga0496100_0279530 3300048903 Bacteria 1244
444 Ga0496101_0184717 3300048904 Bacteria 1607
445 Ga0496101_0457822 3300048904 Bacteria 1007
446 Ga0496102_0006438 3300048905 Bacteria 10012
447 Ga0496102_0025988 3300048905 Bacteria 5218
448 Ga0496102_0101007 3300048905 Bacteria 2679
449 Ga0496103_0013700 3300048906 Bacteria 4811
450 Ga0496103_0265460 3300048906 Bacteria 1104
451 Ga0496103_0280219 3300048906 Unclassified 1072
452 Ga0496104_0707522 3300048907 Bacteria 915
453 Ga0496105_0212147 3300048908 Bacteria 1578
454 Ga0496105_0733136 3300048908 Bacteria 756
455 Ga0496106_0049971 3300048909 Bacteria 3151
456 Ga0496106_0168644 3300048909 Bacteria 1734
457 Ga0496106_0347965 3300048909 Bacteria 1190
458 Ga0496107_0068113 3300048910 Bacteria 2583
459 Ga0496108_0000059 3300048911 Bacteria 123078
460 Ga0496108_0069890 3300048911 Bacteria 2963
461 Ga0496109_0448382 3300048912 Bacteria 1219
462 Ga0496110_0152428 3300048913 Bacteria 2093
463 Ga0496110_0478730 3300048913 Bacteria 1134
464 Ga0496112_0009090 3300048915 Bacteria 8928
465 Ga0496112_0015258 3300048915 Bacteria 7162
466 Ga0496112_0056689 3300048915 Unclassified 3857
467 Ga0496112_0084441 3300048915 Bacteria 3141
468 Ga0496112_0475352 3300048915 Bacteria 1187
469 Ga0496112_0840672 3300048915 Bacteria 842
470 Ga0496113_0035693 3300048916 Bacteria 3637
471 Ga0496113_0070216 3300048916 Bacteria 2662
472 Ga0496115_0027499 3300048918 Bacteria 4449
473 Ga0496126_0008891 3300048929 Bacteria 10757
474 Ga0501292_058550 3300049515 Bacteria 695
475 Ga0501032_0003366 3300049569 Bacteria 12273
476 Ga0501033_0023682 3300049570 Unclassified 4630
477 Ga0501033_0498558 3300049570 Bacteria 842
478 Ga0501034_0026361 3300049571 Bacteria 5919
479 Ga0501034_0052979 3300049571 Bacteria 4087
480 Ga0501036_0000278 3300049572 Bacteria 35218
481 Ga0501037_0008342 3300049573 Bacteria 7594
482 Ga0501037_0026895 3300049573 Bacteria 4249
483 Ga0501038_0027400 3300049574 Bacteria 5069
484 Ga0501039_0002121 3300049575 Bacteria 14698
485 Ga0501040_0236405 3300049576 Bacteria 1302
486 Ga0501043_0002571 3300049579 Bacteria 15351
487 Ga0501046_0001611 3300049580 Bacteria 21590
488 Ga0501047_0036545 3300049581 Bacteria 4747
489 Ga0501047_0039552 3300049581 Bacteria 4561
490 Ga0501047_0303909 3300049581 Bacteria 1437
491 Ga0501048_0144019 3300049582 Unclassified 1685
492 Ga0501067_0045047 3300049583 Bacteria 2450
493 Ga0501068_0002000 3300049584 Bacteria 10840
494 Ga0501070_0028989 3300049586 Bacteria 4642
495 Ga0501072_0086424 3300049588 Bacteria 2488
496 Ga0501073_0062267 3300049589 Bacteria 2602
497 Ga0501074_0034461 3300049590 Unclassified 3669
498 Ga0501077_0026605 3300049593 Unclassified 3671
499 Ga0501079_0054590 3300049741 Unclassified 3081
500 Ga0501080_0001259 3300049742 Bacteria 21077
501 Ga0501080_0073504 3300049742 Bacteria 3181
502 Ga0501083_0006817 3300049744 Bacteria 8109
503 Ga0501035_0020005 3300049822 Bacteria 6148
504 Ga0501044_0014256 3300049823 Bacteria 8582
505 Ga0501044_0069693 3300049823 Bacteria 3579
506 nmdc:mga06z11_151078_c1 3300050494 Bacteria 1320
507 nmdc:mga05p37_7102_c1 3300050507 Bacteria 13202
508 nmdc:mga09592_23721_c1 3300050508 Bacteria 5068
509 nmdc:mga09592_4848_c1 3300050508 Bacteria 10894
510 nmdc:mga09592_486671_c1 3300050508 Bacteria 1063
511 nmdc:mga0qj67_1317_c1 3300050509 Bacteria 17437
512 nmdc:mga0qj67_253811_c1 3300050509 Bacteria 1427
513 nmdc:mga06r32_2313_c1 3300050510 Bacteria 17057
514 nmdc:mga06r32_246669_c1 3300050510 Bacteria 1773
515 nmdc:mga06r32_573_c4 3300050510 Bacteria 5207
516 nmdc:mga06r32_59402_c1 3300050510 Unclassified 3677
517 nmdc:mga0n895_33656_c1 3300050512 Unclassified 4927
518 nmdc:mga0n895_80651_c1 3300050512 Bacteria 3242
519 nmdc:mga08x19_215831_c1 3300050514 Bacteria 1317
520 Ga0500595_008533 3300053119 Unclassified 4181
521 Ga0501084_0004610 3300054114 Bacteria 11258
522 Ga0501082_0071507 3300060353 Bacteria 2987
523 Ga0530510_0105715 3300061734 Bacteria 2060
524 2501942588 2501939600 Bacteria 6907073
525 2856862211 2856858025 Bacteria 7255264
526 2873318451 2873314349 Bacteria 8512634
527 649815995 649633069 Bacteria 6962533
528 8055066705 8055066027 Bacteria 9479577
529 Ga0213872_10004143
530 Ga0006777J48905_1021007
531 Ga0058860_12035151
532 Ga0065712_10135520
533 Ga0065712_10427107
534 Ga0065715_10618659
535 Ga0070658_10030661
536 Ga0070658_10376939
537 Ga0070676_10017067
538 Ga0070683_100055330
539 Ga0070683_100089409
540 Ga0070683_100145302
541 Ga0070690_100051438
542 Ga0068869_100120912
543 Ga0070666_10020949
544 Ga0070666_10045018
545 Ga0070680_100019083
546 Ga0070680_100314195
547 Ga0070682_100039497
548 Ga0068868_100021723
549 Ga0068868_100149185
550 Ga0070660_100032795
551 Ga0070689_100525828
552 Ga0070691_10346756
553 Ga0070661_100034870
554 Ga0070661_100266446
555 Ga0070692_10044815
556 Ga0070668_100004117
557 Ga0070668_100031683
558 Ga0070669_100117395
559 Ga0070669_100607534
560 Ga0070674_100316699
561 Ga0070688_100855936
562 Ga0070659_100004678
563 Ga0070659_100414713
564 Ga0070667_100080768
565 Ga0070667_100140185
566 Ga0070703_10071338
567 Ga0070709_10029856
568 Ga0070709_10192042
569 Ga0070709_10270073
570 Ga0070709_10358408
571 Ga0070714_100476091
572 Ga0070713_100196594
573 Ga0070713_100238497
574 Ga0070713_100688084
575 Ga0070710_10050391
576 Ga0070710_10174328
577 Ga0070710_10192308
578 Ga0070701_10290562
579 Ga0070711_100001349
580 Ga0070711_100015471
581 Ga0070711_100114450
582 Ga0070705_100685382
583 Ga0070700_100078032
584 Ga0070708_100000738
585 Ga0070708_100171250
586 Ga0070663_100029785
587 Ga0070678_101362240
588 Ga0070662_100000633
589 Ga0070681_10047604
590 Ga0070681_10259018
591 Ga0070681_10492937
592 Ga0068867_100044815
593 Ga0068867_100093233
594 Ga0068867_101460210
595 Ga0070685_10365153
596 Ga0070706_100000513
597 Ga0070706_100006801
598 Ga0070707_100752397
599 Ga0070707_100854079
600 Ga0070707_100977816
601 Ga0070699_100581791
602 Ga0070679_100013265
603 Ga0070679_100331409
604 Ga0070684_100009200
605 Ga0070684_100017255
606 Ga0070684_100170745
607 Ga0070684_100703001
608 Ga0070697_100002640
609 Ga0068853_100028408
610 Ga0068853_100065157
611 Ga0068853_100598788
612 Ga0070686_100224216
613 Ga0070695_100109511
614 Ga0070695_100115618
615 Ga0070696_100078070
616 Ga0070665_100008972
617 Ga0070704_100314657
618 Ga0070704_101404133
619 Ga0068855_100123160
620 Ga0068855_100257000
621 Ga0070664_100034537
622 Ga0070664_100073230
623 Ga0068857_100651021
624 Ga0068854_100062264
625 Ga0068854_100227369
626 Ga0068854_100692508
627 Ga0068856_100149991
628 Ga0068856_100207707
629 Ga0068856_100548743
630 Ga0068852_100029764
631 Ga0068859_100068111
632 Ga0068859_100949596
633 Ga0068864_100049830
634 Ga0068866_10081925
635 Ga0068861_100250769
636 Ga0068861_100338308
637 Ga0068851_10008677
638 Ga0068863_100238201
639 Ga0068863_100238725
640 Ga0068863_100244317
641 Ga0068858_100300533
642 Ga0068858_100366939
643 Ga0068858_100644217
644 Ga0068860_100001368
645 Ga0068860_100090334
646 Ga0068860_100314396
647 Ga0068860_100581265
648 Ga0068862_100100210
649 Ga0068862_100294772
650 Ga0081538_10002698
651 Ga0081538_10090063
652 Ga0081538_10187866
653 Ga0070717_10000937
654 Ga0070717_10167952
655 Ga0070717_10497147
656 Ga0070715_10011378
657 Ga0070715_10042663
658 Ga0070715_10135280
659 Ga0070715_10157490
660 Ga0070716_100040079
661 Ga0070716_100051232
662 Ga0070712_100010193
663 Ga0070712_100083691
664 Ga0070712_100245138
665 Ga0070712_100368725
666 Ga0097621_100032690
667 Ga0097621_100053436
668 Ga0097621_100950414
669 Ga0068871_100006026
670 Ga0068871_100016646
671 Ga0075428_100040435
672 Ga0075430_100005845
673 Ga0075430_100012159
674 Ga0075431_100042148
675 Ga0075431_100113411
676 Ga0075434_100030446
677 Ga0075434_100036750
678 Ga0075429_100000900
679 Ga0068865_100117302
680 Ga0075436_100288657
681 Ga0097620_100068115
682 Ga0097620_100949344
683 Ga0105240_10170818
684 Ga0105240_10514578
685 Ga0105240_10666572
686 Ga0105240_10865807
687 Ga0111539_10461436
688 Ga0111539_11308511
689 Ga0105245_10046572
690 Ga0105245_10150076
691 Ga0105245_10400310
692 Ga0105247_10022748
693 Ga0105247_10215686
694 Ga0105247_10278201
695 Ga0105247_10329008
696 Ga0114129_10000594
697 Ga0114129_10030585
698 Ga0114129_10154249
699 Ga0105243_10047917
700 Ga0105241_10002436
701 Ga0105241_10028589
702 Ga0105242_10031727
703 Ga0105242_10227871
704 Ga0105248_10000002
705 Ga0105248_10052839
706 Ga0105248_10072512
707 Ga0105248_10246107
708 Ga0105248_10652070
709 Ga0105237_10011561
710 Ga0105237_10036842
711 Ga0105237_10366841
712 Ga0105238_10046127
713 Ga0105238_10221744
714 Ga0105238_10532186
715 Ga0105249_10061222
716 Ga0105239_10036478
717 Ga0105239_10066900
718 Ga0105239_10143275
719 Ga0105239_10148898
720 Ga0105239_10150792
721 Ga0105239_10240115
722 Ga0105239_10414437
723 Ga0105239_10901742
724 Ga0105246_10046278
725 Ga0157373_10003349
726 Ga0157371_10024212
727 Ga0157370_10086551
728 Ga0157370_10102796
729 Ga0157370_10273500
730 Ga0157369_10011870
731 Ga0157369_10014804
732 Ga0157369_10057472
733 Ga0157369_10061603
734 Ga0157374_10001768
735 Ga0157374_10002311
736 Ga0157374_10033266
737 Ga0157374_10066813
738 Ga0157374_10078008
739 Ga0157374_10100846
740 Ga0157374_10202640
741 Ga0157378_10000116
742 Ga0157378_10019356
743 Ga0157378_10024500
744 Ga0157378_10120730
745 Ga0157378_10163344
746 Ga0157378_10295809
747 Ga0157378_10554304
748 Ga0163162_10000276
749 Ga0163162_10002087
750 Ga0163162_10009658
751 Ga0163162_10016226
752 Ga0163162_10242455
753 Ga0157372_10005027
754 Ga0157372_10026716
755 Ga0157375_10157138
756 Ga0157375_10362758
757 Ga0163163_10235307
758 Ga0157380_11364486
759 Ga0157379_10004733
760 Ga0157379_10017789
761 Ga0157379_10156992
762 Ga0157376_10024673
763 Ga0157376_10037772
764 Ga0197907_10176513
765 Ga0206356_10204261
766 Ga0206349_1974281
767 Ga0206355_1044040
768 Ga0206351_10008801
769 Ga0206352_10605626
770 Ga0206350_10398142
771 Ga0206353_10400349
772 Ga0154015_1082286
773 Ga0213872_10004718
774 Ga0224712_10035108
775 Ga0224712_10295230
776 Ga0224570_100306
777 Ga0224569_100952
778 Ga0224571_100082
779 Ga0224572_1001174
780 Ga0228598_1002753
781 Ga0228598_1006335
782 Ga0207656_10061587
783 Ga0207642_10007985
784 Ga0207710_10032372
785 Ga0207710_10284946
786 Ga0207680_10035426
787 Ga0207680_10201910
788 Ga0207647_10045784
789 Ga0207685_10046550
790 Ga0207699_10370028
791 Ga0207645_10035737
792 Ga0207643_10394260
793 Ga0207705_10036746
794 Ga0207705_10125448
795 Ga0207684_10003326
796 Ga0207684_10021524
797 Ga0207654_10006330
798 Ga0207654_10022183
799 Ga0207654_10040928
800 Ga0207654_10475231
801 Ga0207707_10004378
802 Ga0207695_10055445
803 Ga0207695_10087568
804 Ga0207671_10043315
805 Ga0207671_10330307
806 Ga0207693_10000241
807 Ga0207693_10001380
808 Ga0207693_10014021
809 Ga0207693_10354515
810 Ga0207663_10001691
811 Ga0207663_10108603
812 Ga0207663_10426934
813 Ga0207660_10016551
814 Ga0207660_10311847
815 Ga0207657_10000238
816 Ga0207657_10084022
817 Ga0207649_10032698
818 Ga0207649_10124952
819 Ga0207652_10020305
820 Ga0207652_10148645
821 Ga0207652_10168023
822 Ga0207652_10571797
823 Ga0207646_10359400
824 Ga0207681_10444898
825 Ga0207681_10886461
826 Ga0207694_10067150
827 Ga0207694_10263477
828 Ga0207694_10269607
829 Ga0207694_10430048
830 Ga0207687_10016622
831 Ga0207687_10034639
832 Ga0207700_10366402
833 Ga0207700_10785010
834 Ga0207664_10541425
835 Ga0207690_10010614
836 Ga0207706_10000491
837 Ga0207686_10077605
838 Ga0207686_10421285
839 Ga0207709_10258425
840 Ga0207704_10127673
841 Ga0207704_10808862
842 Ga0207665_10020570
843 Ga0207665_10183951
844 Ga0207711_10000041
845 Ga0207711_10048682
846 Ga0207711_10154451
847 Ga0207711_10170914
848 Ga0207689_10033762
849 Ga0207661_10023993
850 Ga0207661_10360382
851 Ga0207679_10732935
852 Ga0207667_10074361
853 Ga0207667_10407465
854 Ga0207668_10002401
855 Ga0207668_10028872
856 Ga0207640_10010743
857 Ga0207640_10211879
858 Ga0207658_10072509
859 Ga0207658_10252016
860 Ga0207677_10050030
861 Ga0207677_10087908
862 Ga0207703_10286349
863 Ga0207703_10343852
864 Ga0207639_10348367
865 Ga0207639_11123044
866 Ga0207678_10001218
867 Ga0207702_10226624
868 Ga0207702_10331641
869 Ga0207702_11287479
870 Ga0207641_10064969
871 Ga0207641_10116393
872 Ga0207641_10221731
873 Ga0207641_10227869
874 Ga0207648_10006054
875 Ga0207648_10835613
876 Ga0207674_10005605
877 Ga0207675_100194728
878 Ga0207683_10699289
879 Ga0207698_10166056
880 Ga0265356_1000156
881 Ga0265356_1017488
882 Ga0268266_10028039
883 Ga0268265_10932497
884 Ga0268264_10051939
885 Ga0268264_10252090
886 Ga0268264_10745267
887 Ga0268264_10796286
888 Ga0307515_10045412
889 Ga0265338_10007813
890 Ga0265338_10100861
891 Ga0307512_10008700
892 Ga0265762_1023950
893 Ga0265767_101783
894 Ga0265770_1009178
895 Ga0265765_1003912
896 Ga0265765_1007202
897 Ga0265760_10003906
898 Ga0265332_10133917
899 Ga0265325_10110809
900 Ga0265331_10319692
901 Ga0307513_10035616
902 Ga0307513_10076694
903 Ga0307408_100707711
904 Ga0265314_10008427
905 Ga0265342_10120332
906 Ga0265342_10258874
907 Ga0247548_103921
908 Ga0307413_10974332
909 Ga0307406_10068498
910 Ga0307406_10155007
911 Ga0307406_10170438
912 Ga0307414_10167865
913 Ga0307411_10292127
914 Ga0307411_10389052
915 Ga0307415_100131219
916 Ga0307415_100683222
917 Ga0307507_10338642
918 Ga0316212_1009233
919 Ga0316212_1016103
920 Ga0373938_0015017
921 Ga0373944_0088216
922 Ga0373951_0000202
923 Ga0373951_0044560
924 Ga0373932_0015608
925 Ga0373939_0175946
926 Ga0373941_0033368
927 Ga0373954_0106478
928 Ga0373957_0062701
929 Ga0373955_0039912
930 Ga0373955_0294964
931 Ga0373942_0112670
932 Ga0373961_0079593
933 Ga0373931_0022744
934 Ga0373931_0060172
935 Ga0373935_0282643
936 Ga0373927_0044344
937 Ga0373947_0003454
938 Ga0373937_0140159
939 Ga0373925_0002252
940 Ga0373925_0052033
941 Ga0373925_0130278
942 Ga0373925_0437989
943 Ga0395898_0611003
944 Ga0436361_0353634
945 Ga0436361_0669362
946 Ga0436361_0928506
947 Ga0451791_1757185
948 Ga0450894_015792
949 Ga0450918_011878
950 Ga0451576_0107725
951 Ga0495580_0017593
952 Ga0495580_0090596
953 Ga0495582_0064687
954 Ga0495594_0028206
955 Ga0495606_0002986
956 Ga0495665_0135991
957 Ga0495656_0000011
958 Ga0495668_0001427
959 Ga0495625_0007391
960 Ga0495635_0063126
961 Ga0495659_0003255
962 Ga0495657_0166835
963 Ga0495658_0689768
964 Ga0495669_0088222
965 Ga0495600_0368295
966 Ga0495581_0073335
967 Ga0495581_0148957
968 Ga0495626_0000174
969 Ga0496100_0012859
970 Ga0496100_0088890
971 Ga0496100_0279530
972 Ga0496101_0184717
973 Ga0496101_0457822
974 Ga0496102_0006438
975 Ga0496102_0025988
976 Ga0496102_0101007
977 Ga0496103_0013700
978 Ga0496103_0265460
979 Ga0496103_0280219
980 Ga0496104_0707522
981 Ga0496105_0212147
982 Ga0496105_0733136
983 Ga0496106_0049971
984 Ga0496106_0168644
985 Ga0496106_0347965
986 Ga0496107_0068113
987 Ga0496108_0000059
988 Ga0496108_0069890
989 Ga0496109_0448382
990 Ga0496110_0152428
991 Ga0496110_0478730
992 Ga0496112_0009090
993 Ga0496112_0015258
994 Ga0496112_0056689
995 Ga0496112_0084441
996 Ga0496112_0475352
997 Ga0496112_0840672
998 Ga0496113_0035693
999 Ga0496113_0070216
1000 Ga0496115_0027499
1001 Ga0496126_0008891
1002 Ga0501292_058550
1003 Ga0501032_0003366
1004 Ga0501033_0023682
1005 Ga0501033_0498558
1006 Ga0501034_0026361
1007 Ga0501034_0052979
1008 Ga0501036_0000278
1009 Ga0501037_0008342
1010 Ga0501037_0026895
1011 Ga0501038_0027400
1012 Ga0501039_0002121
1013 Ga0501040_0236405
1014 Ga0501043_0002571
1015 Ga0501046_0001611
1016 Ga0501047_0036545
1017 Ga0501047_0039552
1018 Ga0501047_0303909
1019 Ga0501048_0144019
1020 Ga0501067_0045047
1021 Ga0501068_0002000
1022 Ga0501070_0028989
1023 Ga0501072_0086424
1024 Ga0501073_0062267
1025 Ga0501074_0034461
1026 Ga0501077_0026605
1027 Ga0501079_0054590
1028 Ga0501080_0001259
1029 Ga0501080_0073504
1030 Ga0501083_0006817
1031 Ga0501035_0020005
1032 Ga0501044_0014256
1033 Ga0501044_0069693
1034 nmdc:mga06z11_151078_c1
1035 nmdc:mga05p37_7102_c1
1036 nmdc:mga09592_23721_c1
1037 nmdc:mga09592_4848_c1
1038 nmdc:mga09592_486671_c1
1039 nmdc:mga0qj67_1317_c1
1040 nmdc:mga0qj67_253811_c1
1041 nmdc:mga06r32_2313_c1
1042 nmdc:mga06r32_246669_c1
1043 nmdc:mga06r32_573_c4
1044 nmdc:mga06r32_59402_c1
1045 nmdc:mga0n895_33656_c1
1046 nmdc:mga0n895_80651_c1
1047 nmdc:mga08x19_215831_c1
1048 Ga0500595_008533
1049 Ga0501084_0004610
1050 Ga0501082_0071507
1051 Ga0530510_0105715
1052 2501942588
1053 2856862211
1054 2873318451
1055 649815995
1056 8055066705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.6315 13 156
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.6296 15 158
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.6181 15 158
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.6071 13 156
8j0h-assembly3.cif.gz_C crystal structure of the fission yeast rex1bd protein(c4h3.06) 0.5476 14 152
ID Description Score Start End Superfamily
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6035 19 158 1.20.120.1770
af_A0A1D6E5W5_56_186_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.594 19 152 1.20.120.290
af_Q4DB10_34_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5929 18 164 1.20.120.1770
af_Q54RB8_187_364_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5825 3 158 1.20.120.1770
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5815 6 158 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A840W210-F1-model_v4 Uncharacterized protein 0.9878 2 173 GO:0016020
AF-A0A2V7SE59-F1-model_v4 HXXEE domain-containing protein 0.9836 4 159 GO:0016020
AF-A0A7X0C8H9-F1-model_v4 Uncharacterized protein 0.9798 1 173 GO:0016020
AF-A0A1V2QQV2-F1-model_v4 Uncharacterized protein 0.979 4 174 GO:0016020
AF-E5WTA2-F1-model_v4 deleted 0.9776 6 173

Map