F459698

General Info

Members Datasets Scaffolds Average Seq Length
528 242 1056 690

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000643|Ga0395901_0000643_20112_22319
Length 726
Sequence MAWSRLACVSTGRRFTVTALTTQGTPMKPLIAALLLALVAAPALAGTAVDTTFVKAEGAHPFNVRDLVMMDRVSDPQLSPDGRYAAFGVRSTDYAANKGVSAVYVLDLAKGGQPVKVVDKGGSARWSADGRGLYFTAPAKGVAQLWRVDLGGKDGLNLATHAAPVQVSHGVLDLGGYKLSPDGKQVLLSYEVFTDCATLACTQQRVDARAKDKASGTLYDKLFVRHWDTWADGRRNQLFVARFDGKGQLSGEPMLLSRGIDGDVPSKPFGDEGEFTFAPDGKTVYFNARIAGSSEPWSTNFDVYSVPTDGSAAPKNLTADNKAWDAYPVASPDGKTLYYLAMKTPGFEADRFAVMALDLANGTRHEVDPQWDRSPGGLAISADGKTLYATADDNGQHPLFAIDAASGKVSQLVGEGTVGGFSLAAGKLLLTRDDLKRPADVYLAAADGSGLKQVTHFNAADLKNAKMGDAEFFTFKGWNNETVQGYVVKPAGYQSGKTYPVAFIIHGGPQGAMSNGWSYRWNPQTYAGQGFAVVTVNFHGSTGYGQAFTDSISGDWGGKPLEDLKLGWKAALDKYSFLDGDRACALGASYGGYMTYWIAGVWNQPWKCLVDHDGVFDTRAMYYRENGGTQYEHPENYEKFNPLNHVKDWRVPMLVIHSAKDFRIPDTQGLGAFTALQRRGIPSQLLHFPDENHWVLKPHNSVQWHDAVNAWLKQWTAKDAPKAASH

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
220 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
221 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
222 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
223 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
224 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
225 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
226 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
227 2734482264 Dyella sp. AD052 Isolate Unclassified
228 2738543009 Luteibacter sp. OK325 Isolate Unclassified
229 2739367700 Dyella sp. YR388 Isolate Unclassified
230 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
231 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
232 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
233 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
234 2884411467 Dyella sp. AD56 Isolate Rhizosphere
235 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
236 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
237 2919085039 Luteibacter sp. 1214 Isolate Unclassified
238 2919404418 Luteibacter sp. 3190 Isolate Unclassified
239 2928963466 Dyella japonica 1073 Isolate Unclassified
240 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
241 2941471342 Luteibacter sp. 621 Isolate Unclassified
242 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.08
Metatranscriptomes 0.38
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.56
Nodule 0
Rhizoplane 1.33
Rhizosphere 66.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0000643 3300038443 Bacteria 40418
2 JGI24736J21556_1004463 3300001904 Bacteria 2390
3 JGI24737J22298_10005337 3300001990 Bacteria 4444
4 JGI24735J21928_10006577 3300002067 Bacteria 3820
5 JGI24738J21930_10000093 3300002075 Bacteria 20179
6 JGI25156J39149_1001654 3300002705 Bacteria 9035
7 JGI25156J39149_1004709 3300002705 Bacteria 4094
8 JGI25156J39149_1005330 3300002705 Bacteria 3736
9 JGI25162J39368_1000128 3300002737 Bacteria 83781
10 JGI25162J39368_1000279 3300002737 Bacteria 48608
11 JGI25162J39368_1000512 3300002737 Bacteria 29049
12 JGI25162J39368_1000539 3300002737 Bacteria 28147
13 JGI25162J39368_1000550 3300002737 Bacteria 27765
14 JGI25157J39369_1000211 3300002741 Bacteria 48410
15 JGI25157J39369_1000276 3300002741 Bacteria 37680
16 JGI25157J39369_1001430 3300002741 Bacteria 9035
17 JGI25163J39215_1000200 3300002771 Bacteria 23294
18 JGI25164J39214_1000030 3300002772 Bacteria 145974
19 JGI25164J39214_1000067 3300002772 Bacteria 103259
20 JGI25164J39214_1000269 3300002772 Bacteria 38654
21 JGI25164J39214_1000339 3300002772 Bacteria 29674
22 JGI25165J46597_1000057 3300003214 Bacteria 217135
23 JGI25165J46597_1000167 3300003214 Bacteria 103259
24 JGI25165J46597_1000535 3300003214 Bacteria 35299
25 rootH2_10019989 3300003320 Bacteria 27211
26 Ga0006562J51391_1000438 3300003578 Bacteria 3280
27 Ga0055539_1000436 3300003752 Bacteria 14640
28 Ga0055533_1000293 3300003756 Bacteria 25431
29 Ga0055533_1000490 3300003756 Bacteria 14640
30 Ga0055533_1001002 3300003756 Bacteria 8209
31 Ga0055533_1001449 3300003756 Bacteria 6263
32 Ga0055525_1000093 3300003759 Bacteria 138423
33 Ga0055527_1000045 3300003760 Bacteria 111375
34 Ga0055527_1000168 3300003760 Bacteria 45167
35 Ga0055535_1000074 3300003761 Bacteria 111974
36 Ga0055535_1000355 3300003761 Bacteria 44649
37 Ga0055535_1000811 3300003761 Bacteria 22607
38 Ga0055535_1001899 3300003761 Bacteria 8800
39 Ga0055542_1000157 3300003762 Bacteria 85679
40 Ga0055542_1000206 3300003762 Bacteria 72609
41 Ga0055542_1000234 3300003762 Bacteria 63993
42 Ga0055542_1000303 3300003762 Bacteria 54819
43 Ga0055542_1000360 3300003762 Bacteria 47620
44 Ga0055542_1000382 3300003762 Bacteria 45167
45 Ga0055529_1000024 3300003763 Bacteria 305218
46 Ga0055529_1000121 3300003763 Bacteria 114639
47 Ga0055529_1000344 3300003763 Bacteria 51835
48 Ga0055529_1000413 3300003763 Bacteria 44586
49 Ga0055529_1001783 3300003763 Bacteria 5262
50 Ga0065165_1000114 3300005262 Bacteria 135928
51 Ga0065165_1006689 3300005262 Bacteria 5937
52 Ga0070683_100000808 3300005329 Bacteria 23168
53 Ga0070666_10000010 3300005335 Bacteria 264789
54 Ga0070680_100002042 3300005336 Bacteria 14887
55 Ga0070680_100008798 3300005336 Bacteria 7746
56 Ga0070680_100079416 3300005336 Bacteria 2704
57 Ga0070682_100002766 3300005337 Bacteria 9710
58 Ga0070689_100005375 3300005340 Bacteria 8733
59 Ga0070661_100006853 3300005344 Bacteria 7857
60 Ga0070661_100040520 3300005344 Bacteria 3398
61 Ga0070661_100081804 3300005344 Bacteria 2385
62 Ga0070659_100012278 3300005366 Bacteria 6351
63 Ga0070714_100000020 3300005435 Bacteria 169262
64 Ga0070714_100000542 3300005435 Bacteria 27222
65 Ga0070663_100013996 3300005455 Bacteria 5137
66 Ga0070662_100033762 3300005457 Bacteria 3604
67 Ga0070681_10000170 3300005458 Bacteria 49540
68 Ga0070681_10003694 3300005458 Bacteria 14358
69 Ga0070681_10009467 3300005458 Bacteria 9587
70 Ga0070681_10018570 3300005458 Bacteria 6952
71 Ga0070681_10030031 3300005458 Bacteria 5454
72 Ga0070681_10109699 3300005458 Bacteria 2699
73 Ga0070685_10001697 3300005466 Bacteria 11572
74 Ga0070685_10018319 3300005466 Bacteria 3763
75 Ga0070679_100000161 3300005530 Bacteria 53878
76 Ga0070679_100003260 3300005530 Bacteria 14839
77 Ga0070679_100021771 3300005530 Bacteria 6262
78 Ga0070684_100010336 3300005535 Bacteria 7394
79 Ga0070684_100052728 3300005535 Bacteria 3538
80 Ga0068853_100045438 3300005539 Bacteria 3761
81 Ga0068853_100050708 3300005539 Bacteria 3571
82 Ga0070696_100000339 3300005546 Bacteria 28378
83 Ga0070696_100000539 3300005546 Bacteria 24051
84 Ga0070665_100001241 3300005548 Bacteria 30925
85 Ga0070665_100013521 3300005548 Bacteria 8211
86 Ga0068855_100002334 3300005563 Bacteria 23422
87 Ga0068855_100002841 3300005563 Bacteria 21294
88 Ga0068855_100022395 3300005563 Bacteria 7572
89 Ga0068857_100000762 3300005577 Bacteria 23959
90 Ga0068857_100016825 3300005577 Bacteria 6406
91 Ga0068854_100000513 3300005578 Bacteria 23559
92 Ga0068854_100000518 3300005578 Bacteria 23422
93 Ga0068854_100048472 3300005578 Bacteria 3031
94 Ga0068856_100000496 3300005614 Bacteria 43611
95 Ga0068852_100033316 3300005616 Bacteria 4276
96 Ga0068863_100044655 3300005841 Bacteria 4205
97 Ga0068858_100009466 3300005842 Bacteria 9294
98 Ga0068871_100047314 3300006358 Bacteria 3469
99 Ga0068871_100115383 3300006358 Bacteria 2264
100 Ga0068865_100028244 3300006881 Bacteria 3713
101 Ga0075436_100000055 3300006914 Bacteria 66630
102 Ga0105240_10000343 3300009093 Bacteria 87196
103 Ga0105240_10000359 3300009093 Bacteria 85874
104 Ga0105240_10001368 3300009093 Bacteria 41909
105 Ga0105240_10001602 3300009093 Bacteria 38393
106 Ga0105240_10003284 3300009093 Bacteria 25295
107 Ga0105240_10005345 3300009093 Bacteria 19156
108 Ga0105240_10009559 3300009093 Bacteria 13727
109 Ga0105240_10017999 3300009093 Bacteria 9503
110 Ga0111539_10000003 3300009094 Bacteria 880006
111 Ga0105248_10033309 3300009177 Bacteria 5755
112 Ga0105237_10000007 3300009545 Bacteria 367690
113 Ga0105237_10000055 3300009545 Bacteria 152778
114 Ga0105237_10039325 3300009545 Bacteria 4775
115 Ga0105238_10000377 3300009551 Bacteria 47785
116 Ga0105238_10000630 3300009551 Bacteria 37045
117 Ga0105238_10039330 3300009551 Bacteria 4796
118 Ga0105249_10003855 3300009553 Bacteria 12948
119 Ga0105239_10000020 3300010375 Bacteria 264435
120 Ga0105239_10000023 3300010375 Bacteria 257478
121 Ga0105239_10011439 3300010375 Bacteria 9897
122 Ga0105239_10044574 3300010375 Bacteria 4862
123 Ga0157314_1000409 3300012500 Bacteria 4303
124 Ga0157373_10062852 3300013100 Bacteria 2630
125 Ga0157370_10001015 3300013104 Bacteria 35406
126 Ga0157370_10001812 3300013104 Bacteria 26345
127 Ga0157370_10003247 3300013104 Bacteria 19165
128 Ga0157370_10007781 3300013104 Bacteria 11618
129 Ga0157370_10015685 3300013104 Bacteria 7696
130 Ga0157370_10077496 3300013104 Bacteria 3131
131 Ga0157369_10001904 3300013105 Bacteria 25177
132 Ga0157369_10136621 3300013105 Bacteria 2595
133 Ga0163162_10008505 3300013306 Bacteria 10007
134 Ga0163162_10132316 3300013306 Bacteria 2603
135 Ga0157372_10007324 3300013307 Bacteria 11746
136 Ga0157372_10027397 3300013307 Bacteria 6205
137 Ga0157372_10028738 3300013307 Bacteria 6070
138 Ga0157375_10017756 3300013308 Bacteria 6432
139 Ga0157375_10067287 3300013308 Bacteria 3579
140 Ga0157376_10076786 3300014969 Bacteria 2855
141 Ga0182006_1000265 3300015261 Bacteria 47845
142 Ga0182006_1002263 3300015261 Bacteria 10623
143 Ga0182005_1000035 3300015265 Bacteria 172168
144 Ga0182005_1006927 3300015265 Bacteria 3429
145 Ga0183369_1013 3300015685 Bacteria 222738
146 Ga0163161_10001049 3300017792 Bacteria 21009
147 Ga0213873_10000001 3300021358 Bacteria 1657979
148 Ga0213876_10000002 3300021384 Bacteria 1168769
149 Ga0209760_100141 3300025207 Bacteria 45264
150 Ga0209784_100011 3300025224 Bacteria 546770
151 Ga0209566_102433 3300025225 Bacteria 3461
152 Ga0209674_100012 3300025226 Bacteria 950162
153 Ga0209674_100107 3300025226 Bacteria 151298
154 Ga0209674_100329 3300025226 Bacteria 29551
155 Ga0209674_100352 3300025226 Bacteria 26526
156 Ga0209674_100354 3300025226 Bacteria 26166
157 Ga0209672_100005 3300025228 Bacteria 1069303
158 Ga0209672_100055 3300025228 Bacteria 221655
159 Ga0209672_100124 3300025228 Bacteria 80646
160 Ga0209672_100261 3300025228 Bacteria 39032
161 Ga0209672_100734 3300025228 Bacteria 16016
162 Ga0209563_100045 3300025230 Bacteria 377102
163 Ga0207427_100026 3300025231 Bacteria 412764
164 Ga0207427_100053 3300025231 Bacteria 217191
165 Ga0207427_100157 3300025231 Bacteria 77115
166 Ga0207427_100235 3300025231 Bacteria 45748
167 Ga0207427_100879 3300025231 Bacteria 13151
168 Ga0209437_100108 3300025233 Bacteria 217191
169 Ga0209437_100202 3300025233 Bacteria 118709
170 Ga0209437_100217 3300025233 Bacteria 105424
171 Ga0209437_100223 3300025233 Bacteria 102763
172 Ga0209437_100254 3300025233 Bacteria 83422
173 Ga0209258_100006 3300025242 Bacteria 1069303
174 Ga0209258_100012 3300025242 Bacteria 825544
175 Ga0209258_100027 3300025242 Bacteria 518449
176 Ga0209258_100055 3300025242 Bacteria 337291
177 Ga0209258_100158 3300025242 Bacteria 156881
178 Ga0209258_100818 3300025242 Bacteria 17723
179 Ga0209258_101585 3300025242 Bacteria 7540
180 Ga0209646_1000336 3300025246 Bacteria 35028
181 Ga0209646_1001412 3300025246 Bacteria 6517
182 Ga0209646_1002676 3300025246 Bacteria 3819
183 Ga0209026_1000018 3300025250 Bacteria 381351
184 Ga0209026_1000139 3300025250 Bacteria 115298
185 Ga0209026_1000172 3300025250 Bacteria 98917
186 Ga0209026_1000242 3300025250 Bacteria 70111
187 Ga0209026_1000879 3300025250 Bacteria 15651
188 Ga0209677_100379 3300025253 Bacteria 27214
189 Ga0209677_100574 3300025253 Bacteria 20207
190 Ga0209148_1000001 3300025254 Bacteria 2545271
191 Ga0209148_1000005 3300025254 Bacteria 1806504
192 Ga0209148_1000012 3300025254 Bacteria 1069303
193 Ga0209148_1000014 3300025254 Bacteria 925277
194 Ga0209148_1000058 3300025254 Bacteria 357482
195 Ga0209148_1000092 3300025254 Bacteria 249076
196 Ga0209759_1000066 3300025256 Bacteria 184163
197 Ga0209759_1000211 3300025256 Bacteria 90002
198 Ga0209759_1000479 3300025256 Bacteria 44510
199 Ga0209759_1000794 3300025256 Bacteria 25805
200 Ga0209759_1002806 3300025256 Bacteria 7356
201 Ga0209129_1000374 3300025258 Bacteria 36288
202 Ga0209129_1000770 3300025258 Bacteria 20350
203 Ga0209233_1000002 3300025261 Bacteria 2501366
204 Ga0209233_1000125 3300025261 Bacteria 217190
205 Ga0209233_1000252 3300025261 Bacteria 83708
206 Ga0209233_1000272 3300025261 Bacteria 73393
207 Ga0209455_1000008 3300025272 Bacteria 1069303
208 Ga0209455_1000014 3300025272 Bacteria 806601
209 Ga0209455_1000018 3300025272 Bacteria 718034
210 Ga0209455_1000019 3300025272 Bacteria 705658
211 Ga0209455_1000095 3300025272 Bacteria 217487
212 Ga0209758_1000448 3300025297 Bacteria 68898
213 Ga0209758_1014802 3300025297 Bacteria 4109
214 Ga0209256_1015981 3300025299 Bacteria 2587
215 Ga0209051_1003822 3300025303 Bacteria 9636
216 Ga0207680_10000002 3300025903 Bacteria 1018646
217 Ga0207647_10000428 3300025904 Bacteria 34421
218 Ga0207647_10001174 3300025904 Bacteria 20182
219 Ga0207647_10008903 3300025904 Bacteria 7158
220 Ga0207647_10049021 3300025904 Bacteria 2621
221 Ga0207705_10070442 3300025909 Bacteria 2534
222 Ga0207707_10000249 3300025912 Bacteria 59150
223 Ga0207707_10000334 3300025912 Bacteria 49704
224 Ga0207707_10013371 3300025912 Bacteria 7155
225 Ga0207707_10020383 3300025912 Bacteria 5789
226 Ga0207695_10000014 3300025913 Bacteria 812599
227 Ga0207695_10000709 3300025913 Bacteria 64887
228 Ga0207695_10000777 3300025913 Bacteria 60373
229 Ga0207695_10001092 3300025913 Bacteria 47304
230 Ga0207695_10001389 3300025913 Bacteria 40906
231 Ga0207695_10006001 3300025913 Bacteria 15882
232 Ga0207695_10007946 3300025913 Bacteria 13383
233 Ga0207695_10008727 3300025913 Bacteria 12639
234 Ga0207695_10011789 3300025913 Bacteria 10551
235 Ga0207695_10024228 3300025913 Bacteria 6833
236 Ga0207695_10032328 3300025913 Bacteria 5727
237 Ga0207671_10000038 3300025914 Bacteria 227066
238 Ga0207671_10000347 3300025914 Bacteria 67818
239 Ga0207671_10020468 3300025914 Bacteria 5035
240 Ga0207660_10000655 3300025917 Bacteria 23360
241 Ga0207660_10010320 3300025917 Bacteria 6058
242 Ga0207660_10038164 3300025917 Bacteria 3353
243 Ga0207649_10004305 3300025920 Bacteria 7739
244 Ga0207652_10000134 3300025921 Bacteria 78533
245 Ga0207652_10000449 3300025921 Bacteria 42477
246 Ga0207652_10006441 3300025921 Bacteria 9468
247 Ga0207652_10053983 3300025921 Bacteria 3453
248 Ga0207652_10067468 3300025921 Bacteria 3102
249 Ga0207694_10000394 3300025924 Bacteria 40768
250 Ga0207694_10001084 3300025924 Bacteria 23580
251 Ga0207694_10044748 3300025924 Bacteria 3418
252 Ga0207694_10048826 3300025924 Bacteria 3275
253 Ga0207664_10000023 3300025929 Bacteria 204730
254 Ga0207690_10000207 3300025932 Bacteria 45657
255 Ga0207690_10002365 3300025932 Bacteria 11443
256 Ga0207690_10002413 3300025932 Bacteria 11297
257 Ga0207690_10017225 3300025932 Bacteria 4408
258 Ga0207706_10000915 3300025933 Bacteria 30339
259 Ga0207706_10015931 3300025933 Bacteria 6793
260 Ga0207670_10002693 3300025936 Bacteria 9341
261 Ga0207711_10021925 3300025941 Bacteria 5336
262 Ga0207661_10002376 3300025944 Bacteria 12953
263 Ga0207667_10000917 3300025949 Bacteria 37580
264 Ga0207667_10001266 3300025949 Bacteria 31692
265 Ga0207667_10010447 3300025949 Bacteria 10850
266 Ga0207667_10015491 3300025949 Bacteria 8655
267 Ga0207667_10055933 3300025949 Bacteria 4146
268 Ga0207712_10001541 3300025961 Bacteria 15605
269 Ga0207640_10000196 3300025981 Bacteria 43199
270 Ga0207640_10000694 3300025981 Bacteria 19609
271 Ga0207640_10002016 3300025981 Bacteria 10969
272 Ga0207703_10002034 3300026035 Bacteria 17860
273 Ga0207639_10003185 3300026041 Bacteria 11032
274 Ga0207639_10004997 3300026041 Bacteria 8934
275 Ga0207639_10011502 3300026041 Bacteria 6150
276 Ga0207639_10023620 3300026041 Bacteria 4440
277 Ga0207678_10010093 3300026067 Bacteria 8287
278 Ga0207678_10013888 3300026067 Bacteria 7076
279 Ga0207678_10060334 3300026067 Bacteria 3262
280 Ga0207702_10000138 3300026078 Bacteria 87882
281 Ga0207702_10000154 3300026078 Bacteria 80923
282 Ga0207641_10016607 3300026088 Bacteria 6027
283 Ga0207674_10000342 3300026116 Bacteria 59945
284 Ga0207674_10062917 3300026116 Bacteria 3747
285 Ga0207683_10024372 3300026121 Bacteria 5211
286 Ga0207698_10010800 3300026142 Bacteria 5891
287 Ga0207698_10022163 3300026142 Bacteria 4408
288 Ga0207428_10000001 3300027907 Bacteria 1034622
289 Ga0268266_10000004 3300028379 Bacteria 1495817
290 Ga0268266_10000013 3300028379 Bacteria 649715
291 Ga0268266_10001074 3300028379 Bacteria 34257
292 Ga0265334_10028225 3300028573 Bacteria 2256
293 Ga0265338_10009475 3300028800 Bacteria 11604
294 Ga0265760_10000717 3300031090 Bacteria 9438
295 Ga0265313_10024032 3300031595 Bacteria 3265
296 Ga0316575_10002160 3300031665 Bacteria 6563
297 Ga0307516_10089312 3300031730 Bacteria 2912
298 Ga0307412_10001722 3300031911 Bacteria 12101
299 Ga0307510_10000083 3300033180 Bacteria 71584
300 Ga0373929_0000001 3300035085 Bacteria 956023
301 Ga0395899_0000477 3300037312 Bacteria 44765
302 Ga0395900_0000024 3300037418 Bacteria 323480
303 Ga0395900_0000060 3300037418 Bacteria 205509
304 Ga0395900_0000514 3300037418 Bacteria 54749
305 Ga0395898_0000520 3300037466 Bacteria 73491
306 Ga0395898_0000961 3300037466 Bacteria 45890
307 Ga0395898_0001948 3300037466 Bacteria 26115
308 Ga0395898_0017534 3300037466 Bacteria 7309
309 Ga0395898_0027797 3300037466 Bacteria 5671
310 Ga0395901_0000863 3300038443 Bacteria 33387
311 Ga0395901_0001108 3300038443 Bacteria 28639
312 Ga0395901_0002883 3300038443 Bacteria 17357
313 Ga0395901_0006149 3300038443 Bacteria 12163
314 Ga0395901_0022074 3300038443 Bacteria 6522
315 Ga0395901_0031002 3300038443 Bacteria 5511
316 Ga0436365_0146694 3300039437 Bacteria 22638
317 Ga0436362_0887974 3300039453 Bacteria 104210
318 Ga0439436_0000017 3300041404 Bacteria 73771
319 Ga0439465_0000857 3300041413 Bacteria 9605
320 Ga0439459_0001415 3300042438 Bacteria 3524
321 Ga0466969_0000125 3300044656 Bacteria 41354
322 Ga0466969_0001904 3300044656 Bacteria 11164
323 Ga0466982_0000066 3300044672 Bacteria 28894
324 Ga0466966_0000369 3300044684 Bacteria 29348
325 Ga0466966_0000407 3300044684 Bacteria 27601
326 Ga0466966_0000996 3300044684 Bacteria 18133
327 Ga0466961_0000335 3300044693 Bacteria 30912
328 Ga0466961_0001205 3300044693 Bacteria 15904
329 Ga0466961_0005052 3300044693 Bacteria 8297
330 Ga0466961_0005671 3300044693 Bacteria 7892
331 Ga0453684_0000136 3300044712 Bacteria 323402
332 Ga0453684_0050523 3300044712 Bacteria 5468
333 Ga0466968_0007990 3300044735 Bacteria 4041
334 Ga0466970_0000484 3300044765 Bacteria 19601
335 Ga0466970_0000541 3300044765 Bacteria 18476
336 Ga0466957_0000868 3300044842 Bacteria 15533
337 Ga0466959_0000375 3300045049 Bacteria 26445
338 Ga0466959_0007374 3300045049 Bacteria 7715
339 Ga0466959_0021818 3300045049 Bacteria 4727
340 Ga0451576_0000025 3300045051 Bacteria 427980
341 Ga0495617_000555 3300046452 Bacteria 19217
342 Ga0495617_001260 3300046452 Bacteria 11352
343 Ga0495617_003093 3300046452 Bacteria 6340
344 Ga0495638_0000059 3300046460 Bacteria 191461
345 Ga0495638_0000100 3300046460 Bacteria 139296
346 Ga0495638_0000497 3300046460 Bacteria 46775
347 Ga0495638_0000608 3300046460 Bacteria 40068
348 Ga0495650_0000203 3300046471 Bacteria 129364
349 Ga0495650_0000561 3300046471 Bacteria 52692
350 Ga0495650_0000945 3300046471 Bacteria 33609
351 Ga0495585_0000131 3300046492 Bacteria 81427
352 Ga0495585_0010494 3300046492 Bacteria 5510
353 Ga0495607_0000012 3300046501 Bacteria 195369
354 Ga0495607_0000121 3300046501 Bacteria 82194
355 Ga0495607_0007518 3300046501 Bacteria 7527
356 Ga0495583_0001693 3300046506 Bacteria 21296
357 Ga0495606_0000016 3300046507 Bacteria 284865
358 Ga0495606_0000490 3300046507 Bacteria 64820
359 Ga0495606_0001564 3300046507 Bacteria 30026
360 Ga0495606_0001685 3300046507 Bacteria 28532
361 Ga0495606_0015112 3300046507 Bacteria 5973
362 Ga0495606_0090339 3300046507 Bacteria 1885
363 Ga0495610_0000533 3300046512 Bacteria 38314
364 Ga0495610_0001365 3300046512 Bacteria 21684
365 Ga0495616_0000027 3300046513 Bacteria 136712
366 Ga0495616_0000377 3300046513 Bacteria 34744
367 Ga0495616_0000439 3300046513 Bacteria 31705
368 Ga0495616_0013258 3300046513 Bacteria 4657
369 Ga0495620_0000294 3300046515 Bacteria 35435
370 Ga0495620_0002353 3300046515 Bacteria 10950
371 Ga0495631_0000522 3300046518 Bacteria 25801
372 Ga0495631_0001362 3300046518 Bacteria 14910
373 Ga0495632_0000019 3300046519 Bacteria 215713
374 Ga0495632_0000787 3300046519 Bacteria 28245
375 Ga0495648_0000563 3300046524 Bacteria 39619
376 Ga0495648_0002219 3300046524 Bacteria 18188
377 Ga0495609_0003581 3300046538 Bacteria 8828
378 Ga0495668_0005797 3300046616 Bacteria 8257
379 Ga0495611_0000001 3300046648 Bacteria 2628469
380 Ga0495611_0000027 3300046648 Bacteria 116663
381 Ga0495625_0000037 3300046660 Bacteria 219383
382 Ga0495625_0004279 3300046660 Bacteria 13583
383 Ga0495625_0011633 3300046660 Bacteria 7158
384 Ga0495625_0056909 3300046660 Bacteria 2782
385 Ga0495661_0000593 3300046665 Bacteria 37395
386 Ga0495670_0013196 3300046691 Bacteria 4064
387 Ga0495670_0020441 3300046691 Bacteria 3265
388 Ga0495670_0024315 3300046691 Bacteria 2994
389 Ga0495671_0000527 3300046692 Bacteria 29041
390 Ga0495649_0000560 3300046694 Bacteria 31484
391 Ga0495589_0000366 3300046794 Bacteria 35102
392 Ga0495589_0000386 3300046794 Bacteria 33681
393 Ga0495660_0000282 3300046810 Bacteria 47267
394 Ga0495660_0000380 3300046810 Bacteria 38633
395 Ga0495683_0001725 3300047323 Bacteria 13846
396 Ga0495679_000001 3300047446 Bacteria 1607568
397 Ga0495673_0000010 3300047469 Bacteria 709599
398 Ga0495673_0000072 3300047469 Bacteria 213166
399 Ga0495673_0000607 3300047469 Bacteria 35637
400 Ga0495673_0001366 3300047469 Bacteria 19732
401 Ga0495673_0005169 3300047469 Bacteria 7947
402 Ga0495686_0000189 3300047472 Bacteria 115804
403 Ga0495686_0000410 3300047472 Bacteria 67863
404 Ga0495686_0003113 3300047472 Bacteria 14656
405 Ga0496100_0014363 3300048903 Bacteria 4596
406 Ga0496101_0000921 3300048904 Bacteria 17349
407 Ga0496113_0045697 3300048916 Bacteria 3249
408 Ga0496114_0000018 3300048917 Bacteria 251239
409 Ga0496115_0000106 3300048918 Bacteria 77334
410 Ga0496115_0004221 3300048918 Bacteria 10386
411 Ga0496115_0015414 3300048918 Bacteria 5796
412 Ga0496117_0014980 3300048920 Bacteria 6643
413 Ga0496117_0021647 3300048920 Bacteria 5192
414 Ga0496118_0000912 3300048921 Bacteria 46183
415 Ga0496118_0001491 3300048921 Bacteria 34941
416 Ga0496118_0001572 3300048921 Bacteria 33886
417 Ga0496118_0002037 3300048921 Bacteria 28574
418 Ga0496118_0027472 3300048921 Bacteria 4815
419 Ga0496119_0056476 3300048922 Bacteria 2379
420 Ga0496120_0007808 3300048923 Bacteria 7897
421 Ga0496120_0035162 3300048923 Bacteria 2995
422 Ga0496121_0000586 3300048924 Bacteria 68342
423 Ga0496121_0000856 3300048924 Bacteria 55071
424 Ga0496121_0001097 3300048924 Bacteria 47772
425 Ga0496121_0001877 3300048924 Bacteria 33743
426 Ga0496121_0002339 3300048924 Bacteria 29260
427 Ga0496121_0002419 3300048924 Bacteria 28592
428 Ga0496121_0002657 3300048924 Bacteria 26807
429 Ga0496121_0007692 3300048924 Bacteria 12940
430 Ga0496121_0019099 3300048924 Bacteria 6874
431 Ga0496121_0044461 3300048924 Bacteria 3830
432 Ga0496124_0001002 3300048927 Bacteria 44773
433 Ga0496124_0003461 3300048927 Bacteria 19290
434 Ga0496125_0000512 3300048928 Bacteria 67294
435 Ga0496126_0001964 3300048929 Bacteria 29127
436 Ga0496126_0004839 3300048929 Bacteria 15782
437 Ga0496126_0009085 3300048929 Bacteria 10624
438 Ga0496126_0013885 3300048929 Bacteria 8171
439 Ga0495678_000028 3300049459 Bacteria 220080
440 Ga0495682_0000265 3300049460 Bacteria 41386
441 Ga0495682_0000502 3300049460 Bacteria 27111
442 Ga0495682_0000692 3300049460 Bacteria 22114
443 Ga0495682_0015329 3300049460 Bacteria 2904
444 Ga0501031_0007706 3300049568 Bacteria 7009
445 Ga0501032_0000485 3300049569 Bacteria 32254
446 Ga0501033_0005645 3300049570 Bacteria 9884
447 Ga0501034_0001449 3300049571 Bacteria 31438
448 Ga0501034_0001602 3300049571 Bacteria 29423
449 Ga0501036_0067647 3300049572 Bacteria 3023
450 Ga0501036_0103663 3300049572 Bacteria 2406
451 Ga0501037_0001125 3300049573 Bacteria 19808
452 Ga0501037_0015371 3300049573 Bacteria 5632
453 Ga0501038_0000251 3300049574 Bacteria 45437
454 Ga0501038_0032620 3300049574 Bacteria 4594
455 Ga0501043_0019797 3300049579 Bacteria 5284
456 Ga0501046_0000615 3300049580 Bacteria 35008
457 Ga0501047_0000250 3300049581 Bacteria 63699
458 Ga0501047_0020468 3300049581 Bacteria 6352
459 Ga0501047_0040202 3300049581 Bacteria 4523
460 Ga0501047_0150329 3300049581 Bacteria 2205
461 Ga0501048_0010360 3300049582 Bacteria 6960
462 Ga0501067_0000560 3300049583 Bacteria 20112
463 Ga0501068_0013441 3300049584 Bacteria 4658
464 Ga0501069_0001219 3300049585 Bacteria 12557
465 Ga0501069_0010638 3300049585 Bacteria 4875
466 Ga0501070_0003399 3300049586 Bacteria 13818
467 Ga0501070_0008579 3300049586 Bacteria 8641
468 Ga0501070_0009245 3300049586 Bacteria 8335
469 Ga0501070_0043325 3300049586 Bacteria 3746
470 Ga0501073_0001096 3300049589 Bacteria 19612
471 Ga0501073_0006845 3300049589 Bacteria 8476
472 Ga0501073_0046905 3300049589 Bacteria 3038
473 Ga0501074_0004888 3300049590 Bacteria 9608
474 Ga0501075_0013260 3300049591 Bacteria 5880
475 Ga0501077_0000058 3300049593 Bacteria 56760
476 Ga0501077_0002276 3300049593 Bacteria 11573
477 Ga0501079_0083291 3300049741 Bacteria 2474
478 Ga0501080_0000306 3300049742 Bacteria 37439
479 Ga0501080_0015705 3300049742 Bacteria 6982
480 Ga0501080_0043737 3300049742 Bacteria 4170
481 Ga0501080_0128213 3300049742 Bacteria 2349
482 Ga0501035_0001260 3300049822 Bacteria 26305
483 Ga0501035_0003439 3300049822 Bacteria 15151
484 Ga0501035_0011259 3300049822 Bacteria 8287
485 Ga0501035_0013453 3300049822 Bacteria 7554
486 Ga0501035_0021033 3300049822 Bacteria 5997
487 Ga0501035_0028153 3300049822 Bacteria 5131
488 Ga0501035_0097590 3300049822 Bacteria 2580
489 Ga0501044_0004534 3300049823 Bacteria 15534
490 Ga0501044_0009057 3300049823 Bacteria 10878
491 Ga0501044_0026039 3300049823 Bacteria 6194
492 Ga0501044_0042829 3300049823 Bacteria 4707
493 Ga0501044_0074677 3300049823 Bacteria 3443
494 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
495 nmdc:mga08x19_130_c1 3300050514 Bacteria 66630
496 nmdc:mga08x19_1565_c1 3300050514 Bacteria 14197
497 Ga0500643_000053 3300053087 Bacteria 142202
498 Ga0500651_0000120 3300053093 Bacteria 48678
499 Ga0500651_0001316 3300053093 Bacteria 12401
500 Ga0500555_001826 3300053103 Bacteria 6348
501 Ga0500568_0001313 3300053139 Bacteria 16297
502 Ga0500645_000190 3300053730 Bacteria 47832
503 Ga0501082_0000335 3300060353 Bacteria 41613
504 Ga0501082_0000394 3300060353 Bacteria 38764
505 2538834837 2537561836 Bacteria 3910579
506 2595448238 2593339238 Bacteria 4182970
507 2595451514 2593339239 Bacteria 4124669
508 2643829473 2643221562 Bacteria 4048635
509 2643894005 2643221577 Bacteria 3710843
510 2644476226 2643221685 Bacteria 3673288
511 2687584217 2687453130 Bacteria 4227172
512 2721028428 2718218334 Bacteria 4765486
513 2735835985 2734482264 Unclassified 5014763
514 2739229117 2738543009 Bacteria 4944499
515 2739730050 2739367700 Bacteria 4747630
516 2819563338 2818991440 Bacteria 4774720
517 2842915169 2842914999 Bacteria 4419378
518 2842921531 2842918807 Bacteria 4289178
519 2884339770 2884338543 Bacteria 4610696
520 2884414246 2884411467 Bacteria 5246714
521 2895397168 2895395659 Bacteria 3983269
522 2904464353 2904463128 Bacteria 4775606
523 2919088817 2919085039 Bacteria 4532964
524 2919404589 2919404418 Bacteria 4232372
525 2928965753 2928963466 Bacteria 5165703
526 2939612797 2939611941 Bacteria 3892017
527 2941472527 2941471342 Bacteria 5018624
528 2953997521 2953994433 Bacteria 4303959
529 Ga0395901_0000643
530 JGI24736J21556_1004463
531 JGI24737J22298_10005337
532 JGI24735J21928_10006577
533 JGI24738J21930_10000093
534 JGI25156J39149_1001654
535 JGI25156J39149_1004709
536 JGI25156J39149_1005330
537 JGI25162J39368_1000128
538 JGI25162J39368_1000279
539 JGI25162J39368_1000512
540 JGI25162J39368_1000539
541 JGI25162J39368_1000550
542 JGI25157J39369_1000211
543 JGI25157J39369_1000276
544 JGI25157J39369_1001430
545 JGI25163J39215_1000200
546 JGI25164J39214_1000030
547 JGI25164J39214_1000067
548 JGI25164J39214_1000269
549 JGI25164J39214_1000339
550 JGI25165J46597_1000057
551 JGI25165J46597_1000167
552 JGI25165J46597_1000535
553 rootH2_10019989
554 Ga0006562J51391_1000438
555 Ga0055539_1000436
556 Ga0055533_1000293
557 Ga0055533_1000490
558 Ga0055533_1001002
559 Ga0055533_1001449
560 Ga0055525_1000093
561 Ga0055527_1000045
562 Ga0055527_1000168
563 Ga0055535_1000074
564 Ga0055535_1000355
565 Ga0055535_1000811
566 Ga0055535_1001899
567 Ga0055542_1000157
568 Ga0055542_1000206
569 Ga0055542_1000234
570 Ga0055542_1000303
571 Ga0055542_1000360
572 Ga0055542_1000382
573 Ga0055529_1000024
574 Ga0055529_1000121
575 Ga0055529_1000344
576 Ga0055529_1000413
577 Ga0055529_1001783
578 Ga0065165_1000114
579 Ga0065165_1006689
580 Ga0070683_100000808
581 Ga0070666_10000010
582 Ga0070680_100002042
583 Ga0070680_100008798
584 Ga0070680_100079416
585 Ga0070682_100002766
586 Ga0070689_100005375
587 Ga0070661_100006853
588 Ga0070661_100040520
589 Ga0070661_100081804
590 Ga0070659_100012278
591 Ga0070714_100000020
592 Ga0070714_100000542
593 Ga0070663_100013996
594 Ga0070662_100033762
595 Ga0070681_10000170
596 Ga0070681_10003694
597 Ga0070681_10009467
598 Ga0070681_10018570
599 Ga0070681_10030031
600 Ga0070681_10109699
601 Ga0070685_10001697
602 Ga0070685_10018319
603 Ga0070679_100000161
604 Ga0070679_100003260
605 Ga0070679_100021771
606 Ga0070684_100010336
607 Ga0070684_100052728
608 Ga0068853_100045438
609 Ga0068853_100050708
610 Ga0070696_100000339
611 Ga0070696_100000539
612 Ga0070665_100001241
613 Ga0070665_100013521
614 Ga0068855_100002334
615 Ga0068855_100002841
616 Ga0068855_100022395
617 Ga0068857_100000762
618 Ga0068857_100016825
619 Ga0068854_100000513
620 Ga0068854_100000518
621 Ga0068854_100048472
622 Ga0068856_100000496
623 Ga0068852_100033316
624 Ga0068863_100044655
625 Ga0068858_100009466
626 Ga0068871_100047314
627 Ga0068871_100115383
628 Ga0068865_100028244
629 Ga0075436_100000055
630 Ga0105240_10000343
631 Ga0105240_10000359
632 Ga0105240_10001368
633 Ga0105240_10001602
634 Ga0105240_10003284
635 Ga0105240_10005345
636 Ga0105240_10009559
637 Ga0105240_10017999
638 Ga0111539_10000003
639 Ga0105248_10033309
640 Ga0105237_10000007
641 Ga0105237_10000055
642 Ga0105237_10039325
643 Ga0105238_10000377
644 Ga0105238_10000630
645 Ga0105238_10039330
646 Ga0105249_10003855
647 Ga0105239_10000020
648 Ga0105239_10000023
649 Ga0105239_10011439
650 Ga0105239_10044574
651 Ga0157314_1000409
652 Ga0157373_10062852
653 Ga0157370_10001015
654 Ga0157370_10001812
655 Ga0157370_10003247
656 Ga0157370_10007781
657 Ga0157370_10015685
658 Ga0157370_10077496
659 Ga0157369_10001904
660 Ga0157369_10136621
661 Ga0163162_10008505
662 Ga0163162_10132316
663 Ga0157372_10007324
664 Ga0157372_10027397
665 Ga0157372_10028738
666 Ga0157375_10017756
667 Ga0157375_10067287
668 Ga0157376_10076786
669 Ga0182006_1000265
670 Ga0182006_1002263
671 Ga0182005_1000035
672 Ga0182005_1006927
673 Ga0183369_1013
674 Ga0163161_10001049
675 Ga0213873_10000001
676 Ga0213876_10000002
677 Ga0209760_100141
678 Ga0209784_100011
679 Ga0209566_102433
680 Ga0209674_100012
681 Ga0209674_100107
682 Ga0209674_100329
683 Ga0209674_100352
684 Ga0209674_100354
685 Ga0209672_100005
686 Ga0209672_100055
687 Ga0209672_100124
688 Ga0209672_100261
689 Ga0209672_100734
690 Ga0209563_100045
691 Ga0207427_100026
692 Ga0207427_100053
693 Ga0207427_100157
694 Ga0207427_100235
695 Ga0207427_100879
696 Ga0209437_100108
697 Ga0209437_100202
698 Ga0209437_100217
699 Ga0209437_100223
700 Ga0209437_100254
701 Ga0209258_100006
702 Ga0209258_100012
703 Ga0209258_100027
704 Ga0209258_100055
705 Ga0209258_100158
706 Ga0209258_100818
707 Ga0209258_101585
708 Ga0209646_1000336
709 Ga0209646_1001412
710 Ga0209646_1002676
711 Ga0209026_1000018
712 Ga0209026_1000139
713 Ga0209026_1000172
714 Ga0209026_1000242
715 Ga0209026_1000879
716 Ga0209677_100379
717 Ga0209677_100574
718 Ga0209148_1000001
719 Ga0209148_1000005
720 Ga0209148_1000012
721 Ga0209148_1000014
722 Ga0209148_1000058
723 Ga0209148_1000092
724 Ga0209759_1000066
725 Ga0209759_1000211
726 Ga0209759_1000479
727 Ga0209759_1000794
728 Ga0209759_1002806
729 Ga0209129_1000374
730 Ga0209129_1000770
731 Ga0209233_1000002
732 Ga0209233_1000125
733 Ga0209233_1000252
734 Ga0209233_1000272
735 Ga0209455_1000008
736 Ga0209455_1000014
737 Ga0209455_1000018
738 Ga0209455_1000019
739 Ga0209455_1000095
740 Ga0209758_1000448
741 Ga0209758_1014802
742 Ga0209256_1015981
743 Ga0209051_1003822
744 Ga0207680_10000002
745 Ga0207647_10000428
746 Ga0207647_10001174
747 Ga0207647_10008903
748 Ga0207647_10049021
749 Ga0207705_10070442
750 Ga0207707_10000249
751 Ga0207707_10000334
752 Ga0207707_10013371
753 Ga0207707_10020383
754 Ga0207695_10000014
755 Ga0207695_10000709
756 Ga0207695_10000777
757 Ga0207695_10001092
758 Ga0207695_10001389
759 Ga0207695_10006001
760 Ga0207695_10007946
761 Ga0207695_10008727
762 Ga0207695_10011789
763 Ga0207695_10024228
764 Ga0207695_10032328
765 Ga0207671_10000038
766 Ga0207671_10000347
767 Ga0207671_10020468
768 Ga0207660_10000655
769 Ga0207660_10010320
770 Ga0207660_10038164
771 Ga0207649_10004305
772 Ga0207652_10000134
773 Ga0207652_10000449
774 Ga0207652_10006441
775 Ga0207652_10053983
776 Ga0207652_10067468
777 Ga0207694_10000394
778 Ga0207694_10001084
779 Ga0207694_10044748
780 Ga0207694_10048826
781 Ga0207664_10000023
782 Ga0207690_10000207
783 Ga0207690_10002365
784 Ga0207690_10002413
785 Ga0207690_10017225
786 Ga0207706_10000915
787 Ga0207706_10015931
788 Ga0207670_10002693
789 Ga0207711_10021925
790 Ga0207661_10002376
791 Ga0207667_10000917
792 Ga0207667_10001266
793 Ga0207667_10010447
794 Ga0207667_10015491
795 Ga0207667_10055933
796 Ga0207712_10001541
797 Ga0207640_10000196
798 Ga0207640_10000694
799 Ga0207640_10002016
800 Ga0207703_10002034
801 Ga0207639_10003185
802 Ga0207639_10004997
803 Ga0207639_10011502
804 Ga0207639_10023620
805 Ga0207678_10010093
806 Ga0207678_10013888
807 Ga0207678_10060334
808 Ga0207702_10000138
809 Ga0207702_10000154
810 Ga0207641_10016607
811 Ga0207674_10000342
812 Ga0207674_10062917
813 Ga0207683_10024372
814 Ga0207698_10010800
815 Ga0207698_10022163
816 Ga0207428_10000001
817 Ga0268266_10000004
818 Ga0268266_10000013
819 Ga0268266_10001074
820 Ga0265334_10028225
821 Ga0265338_10009475
822 Ga0265760_10000717
823 Ga0265313_10024032
824 Ga0316575_10002160
825 Ga0307516_10089312
826 Ga0307412_10001722
827 Ga0307510_10000083
828 Ga0373929_0000001
829 Ga0395899_0000477
830 Ga0395900_0000024
831 Ga0395900_0000060
832 Ga0395900_0000514
833 Ga0395898_0000520
834 Ga0395898_0000961
835 Ga0395898_0001948
836 Ga0395898_0017534
837 Ga0395898_0027797
838 Ga0395901_0000863
839 Ga0395901_0001108
840 Ga0395901_0002883
841 Ga0395901_0006149
842 Ga0395901_0022074
843 Ga0395901_0031002
844 Ga0436365_0146694
845 Ga0436362_0887974
846 Ga0439436_0000017
847 Ga0439465_0000857
848 Ga0439459_0001415
849 Ga0466969_0000125
850 Ga0466969_0001904
851 Ga0466982_0000066
852 Ga0466966_0000369
853 Ga0466966_0000407
854 Ga0466966_0000996
855 Ga0466961_0000335
856 Ga0466961_0001205
857 Ga0466961_0005052
858 Ga0466961_0005671
859 Ga0453684_0000136
860 Ga0453684_0050523
861 Ga0466968_0007990
862 Ga0466970_0000484
863 Ga0466970_0000541
864 Ga0466957_0000868
865 Ga0466959_0000375
866 Ga0466959_0007374
867 Ga0466959_0021818
868 Ga0451576_0000025
869 Ga0495617_000555
870 Ga0495617_001260
871 Ga0495617_003093
872 Ga0495638_0000059
873 Ga0495638_0000100
874 Ga0495638_0000497
875 Ga0495638_0000608
876 Ga0495650_0000203
877 Ga0495650_0000561
878 Ga0495650_0000945
879 Ga0495585_0000131
880 Ga0495585_0010494
881 Ga0495607_0000012
882 Ga0495607_0000121
883 Ga0495607_0007518
884 Ga0495583_0001693
885 Ga0495606_0000016
886 Ga0495606_0000490
887 Ga0495606_0001564
888 Ga0495606_0001685
889 Ga0495606_0015112
890 Ga0495606_0090339
891 Ga0495610_0000533
892 Ga0495610_0001365
893 Ga0495616_0000027
894 Ga0495616_0000377
895 Ga0495616_0000439
896 Ga0495616_0013258
897 Ga0495620_0000294
898 Ga0495620_0002353
899 Ga0495631_0000522
900 Ga0495631_0001362
901 Ga0495632_0000019
902 Ga0495632_0000787
903 Ga0495648_0000563
904 Ga0495648_0002219
905 Ga0495609_0003581
906 Ga0495668_0005797
907 Ga0495611_0000001
908 Ga0495611_0000027
909 Ga0495625_0000037
910 Ga0495625_0004279
911 Ga0495625_0011633
912 Ga0495625_0056909
913 Ga0495661_0000593
914 Ga0495670_0013196
915 Ga0495670_0020441
916 Ga0495670_0024315
917 Ga0495671_0000527
918 Ga0495649_0000560
919 Ga0495589_0000366
920 Ga0495589_0000386
921 Ga0495660_0000282
922 Ga0495660_0000380
923 Ga0495683_0001725
924 Ga0495679_000001
925 Ga0495673_0000010
926 Ga0495673_0000072
927 Ga0495673_0000607
928 Ga0495673_0001366
929 Ga0495673_0005169
930 Ga0495686_0000189
931 Ga0495686_0000410
932 Ga0495686_0003113
933 Ga0496100_0014363
934 Ga0496101_0000921
935 Ga0496113_0045697
936 Ga0496114_0000018
937 Ga0496115_0000106
938 Ga0496115_0004221
939 Ga0496115_0015414
940 Ga0496117_0014980
941 Ga0496117_0021647
942 Ga0496118_0000912
943 Ga0496118_0001491
944 Ga0496118_0001572
945 Ga0496118_0002037
946 Ga0496118_0027472
947 Ga0496119_0056476
948 Ga0496120_0007808
949 Ga0496120_0035162
950 Ga0496121_0000586
951 Ga0496121_0000856
952 Ga0496121_0001097
953 Ga0496121_0001877
954 Ga0496121_0002339
955 Ga0496121_0002419
956 Ga0496121_0002657
957 Ga0496121_0007692
958 Ga0496121_0019099
959 Ga0496121_0044461
960 Ga0496124_0001002
961 Ga0496124_0003461
962 Ga0496125_0000512
963 Ga0496126_0001964
964 Ga0496126_0004839
965 Ga0496126_0009085
966 Ga0496126_0013885
967 Ga0495678_000028
968 Ga0495682_0000265
969 Ga0495682_0000502
970 Ga0495682_0000692
971 Ga0495682_0015329
972 Ga0501031_0007706
973 Ga0501032_0000485
974 Ga0501033_0005645
975 Ga0501034_0001449
976 Ga0501034_0001602
977 Ga0501036_0067647
978 Ga0501036_0103663
979 Ga0501037_0001125
980 Ga0501037_0015371
981 Ga0501038_0000251
982 Ga0501038_0032620
983 Ga0501043_0019797
984 Ga0501046_0000615
985 Ga0501047_0000250
986 Ga0501047_0020468
987 Ga0501047_0040202
988 Ga0501047_0150329
989 Ga0501048_0010360
990 Ga0501067_0000560
991 Ga0501068_0013441
992 Ga0501069_0001219
993 Ga0501069_0010638
994 Ga0501070_0003399
995 Ga0501070_0008579
996 Ga0501070_0009245
997 Ga0501070_0043325
998 Ga0501073_0001096
999 Ga0501073_0006845
1000 Ga0501073_0046905
1001 Ga0501074_0004888
1002 Ga0501075_0013260
1003 Ga0501077_0000058
1004 Ga0501077_0002276
1005 Ga0501079_0083291
1006 Ga0501080_0000306
1007 Ga0501080_0015705
1008 Ga0501080_0043737
1009 Ga0501080_0128213
1010 Ga0501035_0001260
1011 Ga0501035_0003439
1012 Ga0501035_0011259
1013 Ga0501035_0013453
1014 Ga0501035_0021033
1015 Ga0501035_0028153
1016 Ga0501035_0097590
1017 Ga0501044_0004534
1018 Ga0501044_0009057
1019 Ga0501044_0026039
1020 Ga0501044_0042829
1021 Ga0501044_0074677
1022 nmdc:mga08y16_1_c1
1023 nmdc:mga08x19_130_c1
1024 nmdc:mga08x19_1565_c1
1025 Ga0500643_000053
1026 Ga0500651_0000120
1027 Ga0500651_0001316
1028 Ga0500555_001826
1029 Ga0500568_0001313
1030 Ga0500645_000190
1031 Ga0501082_0000335
1032 Ga0501082_0000394
1033 2538834837
1034 2595448238
1035 2595451514
1036 2643829473
1037 2643894005
1038 2644476226
1039 2687584217
1040 2721028428
1041 2735835985
1042 2739229117
1043 2739730050
1044 2819563338
1045 2842915169
1046 2842921531
1047 2884339770
1048 2884414246
1049 2895397168
1050 2904464353
1051 2919088817
1052 2919404589
1053 2928965753
1054 2939612797
1055 2941472527
1056 2953997521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

517

719

0.96

PF07676

PD40

WD40-like Beta Propeller Repeat

318

347

0.85

PF07676

PD40

WD40-like Beta Propeller Repeat

265

305

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hxf-assembly1.cif.gz_B acylaminoacyl peptidase in complex with z-gly-gly-phe-chloromethyl ketone 0.9101 30 688
4hxg-assembly2.cif.gz_H pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.9079 29 691
4hxe-assembly1.cif.gz_B pyrococcus horikoshii acylaminoacyl peptidase (uncomplexed) 0.9036 30 691
4hxg-assembly2.cif.gz_K pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.9017 29 690
4hxg-assembly2.cif.gz_G pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.8981 29 690
ID Description Score Start End Superfamily
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9817 436 693 3.40.50.1820
4hxgB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9294 437 688 3.40.50.1820
af_P13798_472_732_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9228 449 693 3.40.50.1820
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9217 436 693 3.40.50.1820
af_Q19086_360_640_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8975 427 692 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A522L1C0-F1-model_v4 deleted 0.9846 473 691
AF-A0A4Q3TLR1-F1-model_v4 S9 family peptidase 0.9837 550 693 GO:0004252
GO:0006508
AF-A0A137NUK3-F1-model_v4 Dipeptidyl-peptidase V 0.9764 504 693 GO:0004252
GO:0006508
AF-A0A2A2K465-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9761 308 693 GO:0004252
GO:0006508
AF-A0A522L1C0-F1-model_v4 deleted 0.9758 473 691

Map