F459700

General Info

Members Datasets Scaffolds Average Seq Length
528 235 1056 118

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_09162|Ga0400490_09162_12301_12729
Length 142
Sequence MLQQDAVWSRHGQDVTITTKTSEVHPTMSVEIYHNPRCSKSRQTLQLLQEQGVDPDIVEYLKTPPDKKTLEKILDMLGLEPRDLMRKKESEYKEHGLADPALTRKQLIEAMVEHPKLIERPIVIKNGKAAIGRPPEKVLEIL

Samples

Sample ID Description Type Environment
1 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
51 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
52 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
92 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
108 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
109 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
110 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
111 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
112 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
113 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
114 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
168 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
169 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
170 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
171 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
172 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
173 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
174 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
175 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
176 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
177 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
178 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
179 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
180 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
181 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
182 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
183 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
184 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
185 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
186 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
187 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
188 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
189 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
190 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
191 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
192 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
193 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
194 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
195 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
196 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
197 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
198 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
199 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
200 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
201 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
202 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
203 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
204 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
205 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
206 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
207 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
208 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
209 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
210 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
211 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
212 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
213 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
214 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
215 2775507074 Klebsiella sp. D5A Isolate Unclassified
216 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
217 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
218 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
219 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
220 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
221 2932406140 Serratia sp. 2723 Isolate Rhizosphere
222 2937539931 Pantoea sp. LS15 Isolate Unclassified
223 2937967321 Serratia sp. YC16 Isolate Unclassified
224 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
225 2939577877 Serratia sp. 509 Isolate Rhizosphere
226 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
227 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
228 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
229 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
230 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
231 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
232 8004592986 Serratia sp. S119 Isolate Unclassified
233 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
234 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
235 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.98
Metatranscriptomes 0.95
Isolates 13.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 2.27
Rhizoplane 9.47
Rhizosphere 50.57
Stem 0
Stem Tuber 0
Unclassified 4.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400490_09162 3300038726 Bacteria 23738
2 SwRhRL2b_contig_1288388 2162886007 Bacteria 2311
3 SwRhRL2b_contig_185417 2162886007 Bacteria 1524
4 JGI24752J21851_1036108 3300001976 Bacteria 657
5 Ga0006562J51391_1058286 3300003578 Bacteria 545
6 Ga0058692_1001841 3300003856 Bacteria 7456
7 Ga0058692_1017590 3300003856 Bacteria 1566
8 Ga0058692_1018568 3300003856 Bacteria 1501
9 Ga0065703_1019005 3300005272 Bacteria 4459
10 Ga0065704_10013911 3300005289 Bacteria 2006
11 Ga0065704_10097885 3300005289 Bacteria 2363
12 Ga0065712_10622852 3300005290 Bacteria 580
13 Ga0065707_10116471 3300005295 Bacteria 2237
14 Ga0070677_10092838 3300005333 Bacteria 1316
15 Ga0070666_10035499 3300005335 Bacteria 3306
16 Ga0070661_100875673 3300005344 Bacteria 740
17 Ga0070671_101197954 3300005355 Bacteria 668
18 Ga0070667_100000002 3300005367 Bacteria 504831
19 Ga0070685_10000014 3300005466 Bacteria 120530
20 Ga0070679_101529861 3300005530 Bacteria 614
21 Ga0068853_100036782 3300005539 Bacteria 4163
22 Ga0070665_100000255 3300005548 Bacteria 88289
23 Ga0068857_100000141 3300005577 Bacteria 44528
24 Ga0068854_100035773 3300005578 Bacteria 3478
25 Ga0068852_100716067 3300005616 Bacteria 1012
26 Ga0068864_100000002 3300005618 Bacteria 658857
27 Ga0068851_10091661 3300005834 Bacteria 1600
28 Ga0068851_10906615 3300005834 Unclassified 552
29 Ga0068858_100890395 3300005842 Bacteria 870
30 Ga0068860_100022421 3300005843 Bacteria 6107
31 Ga0068860_100038562 3300005843 Bacteria 4571
32 Ga0068860_101052706 3300005843 Unclassified 832
33 Ga0075364_10017714 3300006051 Bacteria 4454
34 Ga0075362_10003948 3300006177 Bacteria 5269
35 Ga0079104_1000258 3300006946 Bacteria 70651
36 Ga0079104_1001243 3300006946 Bacteria 17810
37 Ga0079104_1004659 3300006946 Bacteria 5756
38 Ga0079104_1006381 3300006946 Bacteria 4474
39 Ga0079104_1013909 3300006946 Bacteria 2456
40 Ga0079104_1019535 3300006946 Bacteria 1890
41 Ga0105251_10000720 3300009011 Bacteria 30488
42 Ga0105251_10004595 3300009011 Bacteria 9322
43 Ga0105251_10006648 3300009011 Bacteria 7319
44 Ga0105251_10009602 3300009011 Bacteria 5696
45 Ga0105251_10013873 3300009011 Bacteria 4482
46 Ga0105251_10016456 3300009011 Bacteria 3995
47 Ga0105251_10018777 3300009011 Bacteria 3666
48 Ga0105251_10249843 3300009011 Unclassified 799
49 Ga0105244_10000771 3300009036 Bacteria 27343
50 Ga0105244_10002867 3300009036 Bacteria 12768
51 Ga0105244_10004142 3300009036 Bacteria 10095
52 Ga0105244_10037535 3300009036 Bacteria 2533
53 Ga0105250_10000105 3300009092 Bacteria 75608
54 Ga0105250_10000136 3300009092 Bacteria 63723
55 Ga0105250_10020062 3300009092 Bacteria 2703
56 Ga0105250_10173271 3300009092 Bacteria 904
57 Ga0105240_11236684 3300009093 Bacteria 790
58 Ga0105247_10000069 3300009101 Bacteria 116730
59 Ga0105247_11802086 3300009101 Bacteria 509
60 Ga0105243_10004468 3300009148 Bacteria 11061
61 Ga0105243_10019023 3300009148 Bacteria 5206
62 Ga0105248_10001969 3300009177 Bacteria 22824
63 Ga0105237_10000458 3300009545 Bacteria 57845
64 Ga0105237_11395008 3300009545 Bacteria 707
65 Ga0105238_11776865 3300009551 Unclassified 648
66 Ga0105249_10000763 3300009553 Bacteria 28922
67 Ga0105249_10089279 3300009553 Bacteria 2880
68 Ga0105239_10170736 3300010375 Bacteria 2432
69 Ga0105239_10730248 3300010375 Bacteria 1133
70 Ga0157373_10038317 3300013100 Bacteria 3436
71 Ga0157373_10080417 3300013100 Bacteria 2298
72 Ga0157371_10008546 3300013102 Bacteria 8148
73 Ga0157371_10110740 3300013102 Bacteria 1949
74 Ga0157371_10127853 3300013102 Bacteria 1807
75 Ga0157370_10004659 3300013104 Bacteria 15658
76 Ga0157370_10994162 3300013104 Bacteria 760
77 Ga0157372_10001253 3300013307 Bacteria 27455
78 Ga0163163_10007598 3300014325 Bacteria 9574
79 Ga0182008_10106028 3300014497 Bacteria 1391
80 Ga0157379_10298074 3300014968 Bacteria 1469
81 Ga0157376_10757858 3300014969 Bacteria 980
82 Ga0182006_1102082 3300015261 Bacteria 1017
83 Ga0182007_10261934 3300015262 Bacteria 623
84 Ga0183370_1001 3300015680 Bacteria 2743932
85 Ga0183369_1001 3300015685 Bacteria 2743932
86 Ga0183368_1001 3300015687 Bacteria 2743932
87 Ga0163161_10000005 3300017792 Bacteria 327860
88 Ga0213872_10002215 3300021361 Bacteria 11638
89 Ga0213876_10000065 3300021384 Bacteria 128435
90 Ga0207425_1014916 3300025245 Bacteria 1756
91 Ga0209129_1000104 3300025258 Bacteria 161264
92 Ga0207656_10581541 3300025321 Bacteria 571
93 Ga0207696_1000039 3300025711 Bacteria 324954
94 Ga0207696_1000131 3300025711 Bacteria 132958
95 Ga0207696_1000166 3300025711 Bacteria 104368
96 Ga0207696_1000666 3300025711 Bacteria 24201
97 Ga0207655_1000874 3300025728 Bacteria 31879
98 Ga0207655_1002558 3300025728 Bacteria 14554
99 Ga0207655_1004643 3300025728 Bacteria 9645
100 Ga0207655_1013006 3300025728 Bacteria 4809
101 Ga0207713_1000052 3300025735 Bacteria 222663
102 Ga0207713_1000069 3300025735 Bacteria 191229
103 Ga0207713_1000084 3300025735 Bacteria 160822
104 Ga0207713_1000095 3300025735 Bacteria 145778
105 Ga0207713_1000443 3300025735 Bacteria 43551
106 Ga0207713_1013065 3300025735 Bacteria 4401
107 Ga0207713_1020688 3300025735 Bacteria 3178
108 Ga0207713_1029777 3300025735 Bacteria 2439
109 Ga0207713_1038800 3300025735 Bacteria 2017
110 Ga0207710_10000026 3300025900 Bacteria 307644
111 Ga0207710_10068434 3300025900 Bacteria 1624
112 Ga0207680_10006596 3300025903 Bacteria 5626
113 Ga0207695_10287312 3300025913 Bacteria 1537
114 Ga0207649_10718321 3300025920 Bacteria 776
115 Ga0207681_10024860 3300025923 Bacteria 3847
116 Ga0207650_10000002 3300025925 Bacteria 1439222
117 Ga0207709_10225486 3300025935 Bacteria 1354
118 Ga0207669_10661661 3300025937 Bacteria 855
119 Ga0207689_10828523 3300025942 Bacteria 781
120 Ga0207640_10535523 3300025981 Unclassified 981
121 Ga0207658_10000001 3300025986 Bacteria 1439333
122 Ga0207658_11627457 3300025986 Bacteria 590
123 Ga0207677_10172547 3300026023 Bacteria 1692
124 Ga0207641_10143537 3300026088 Bacteria 2156
125 Ga0207641_11087287 3300026088 Unclassified 798
126 Ga0207676_10000001 3300026095 Bacteria 1439222
127 Ga0207674_10002299 3300026116 Bacteria 24209
128 Ga0209281_1000014 3300027111 Bacteria 643021
129 Ga0209281_1000142 3300027111 Bacteria 174280
130 Ga0209281_1000684 3300027111 Bacteria 35143
131 Ga0209281_1001597 3300027111 Bacteria 12251
132 Ga0209281_1001922 3300027111 Bacteria 9813
133 Ga0209281_1006446 3300027111 Bacteria 3062
134 Ga0209371_1000015 3300027312 Bacteria 659640
135 Ga0209371_1000221 3300027312 Bacteria 75566
136 Ga0209371_1002416 3300027312 Bacteria 10482
137 Ga0209371_1024139 3300027312 Bacteria 1420
138 Ga0209371_1079920 3300027312 Bacteria 566
139 Ga0268266_10000933 3300028379 Bacteria 37300
140 Ga0268264_10000004 3300028381 Bacteria 1116842
141 Ga0268264_10015564 3300028381 Bacteria 6234
142 Ga0265319_1128999 3300028563 Bacteria 786
143 Ga0268256_1000018 3300030500 Bacteria 594572
144 Ga0268256_1000183 3300030500 Bacteria 74143
145 Ga0268256_1002149 3300030500 Bacteria 10482
146 Ga0268256_1013321 3300030500 Bacteria 2498
147 Ga0268256_1024955 3300030500 Bacteria 1526
148 Ga0268256_1051695 3300030500 Bacteria 862
149 Ga0268256_1088707 3300030500 Bacteria 566
150 Ga0265327_10000420 3300031251 Bacteria 77601
151 Ga0307408_100000316 3300031548 Bacteria 46302
152 Ga0316575_10001563 3300031665 Bacteria 7433
153 Ga0316575_10017566 3300031665 Bacteria 2717
154 Ga0316579_10002096 3300031691 Bacteria 7469
155 Ga0316579_10028589 3300031691 Bacteria 2539
156 Ga0316579_10039380 3300031691 Bacteria 2189
157 Ga0316579_10517377 3300031691 Unclassified 577
158 Ga0316576_10066161 3300031727 Bacteria 2657
159 Ga0316576_10070059 3300031727 Bacteria 2586
160 Ga0316576_10603134 3300031727 Bacteria 801
161 Ga0316578_10006046 3300031728 Bacteria 5932
162 Ga0316578_10009137 3300031728 Bacteria 5085
163 Ga0316578_10053581 3300031728 Unclassified 2364
164 Ga0316578_10620445 3300031728 Unclassified 633
165 Ga0316578_10720129 3300031728 Bacteria 580
166 Ga0316577_10000063 3300031733 Bacteria 26076
167 Ga0316577_10055816 3300031733 Bacteria 2204
168 Ga0316577_10061576 3300031733 Bacteria 2095
169 Ga0316577_10124144 3300031733 Unclassified 1451
170 Ga0316577_10454119 3300031733 Bacteria 728
171 Ga0316583_10000433 3300032133 Bacteria 12275
172 Ga0316583_10006565 3300032133 Bacteria 4180
173 Ga0316583_10024562 3300032133 Unclassified 2152
174 Ga0316585_10000126 3300032137 Bacteria 14545
175 Ga0316585_10017260 3300032137 Bacteria 2181
176 Ga0316585_10123715 3300032137 Bacteria 852
177 Ga0316585_10296382 3300032137 Bacteria 537
178 Ga0316580_10009864 3300032139 Bacteria 2875
179 Ga0316580_10013142 3300032139 Bacteria 2523
180 Ga0316580_10035153 3300032139 Bacteria 1551
181 Ga0316593_10012574 3300032168 Bacteria 2487
182 Ga0316593_10013596 3300032168 Unclassified 2413
183 Ga0316593_10223891 3300032168 Bacteria 699
184 Ga0316596_1018290 3300033541 Bacteria 1770
185 Ga0373952_0246877 3300035092 Unclassified 539
186 Ga0316574_0010320 3300035398 Bacteria 5273
187 Ga0316574_0017186 3300035398 Bacteria 4228
188 Ga0316574_0035893 3300035398 Bacteria 3032
189 Ga0316574_0044527 3300035398 Bacteria 2745
190 Ga0316574_0050526 3300035398 Bacteria 2588
191 Ga0316574_0064567 3300035398 Bacteria 2304
192 Ga0316574_0083643 3300035398 Bacteria 2029
193 Ga0316574_0087737 3300035398 Bacteria 1981
194 Ga0316574_0099632 3300035398 Bacteria 1859
195 Ga0316574_0111295 3300035398 Unclassified 1755
196 Ga0316574_0147043 3300035398 Bacteria 1519
197 Ga0316574_0148996 3300035398 Bacteria 1508
198 Ga0316574_0247475 3300035398 Bacteria 1139
199 Ga0316574_0456008 3300035398 Bacteria 800
200 Ga0316574_0608238 3300035398 Unclassified 675
201 Ga0316574_0714298 3300035398 Unclassified 614
202 Ga0373931_0189710 3300035691 Bacteria 1222
203 Ga0373937_0442259 3300036401 Bacteria 1234
204 Ga0316582_0000031 3300036647 Bacteria 32888
205 Ga0316582_0000694 3300036647 Bacteria 13303
206 Ga0316582_0001242 3300036647 Bacteria 10993
207 Ga0316582_0021149 3300036647 Bacteria 3838
208 Ga0316582_0043354 3300036647 Bacteria 2822
209 Ga0316582_0062654 3300036647 Bacteria 2388
210 Ga0316582_0072478 3300036647 Bacteria 2233
211 Ga0316582_0135325 3300036647 Bacteria 1658
212 Ga0316582_0169858 3300036647 Bacteria 1480
213 Ga0316582_0274296 3300036647 Bacteria 1157
214 Ga0316582_0365984 3300036647 Bacteria 992
215 Ga0316582_0528121 3300036647 Bacteria 813
216 Ga0316582_1037008 3300036647 Bacteria 560
217 Ga0316582_1046981 3300036647 Unclassified 557
218 Ga0316582_1052620 3300036647 Bacteria 555
219 Ga0316584_0000691 3300036712 Bacteria 18615
220 Ga0316584_0008012 3300036712 Bacteria 7254
221 Ga0316584_0018008 3300036712 Bacteria 5090
222 Ga0316584_0024955 3300036712 Bacteria 4380
223 Ga0316584_0095196 3300036712 Bacteria 2229
224 Ga0316584_0133158 3300036712 Bacteria 1856
225 Ga0316584_0136910 3300036712 Bacteria 1828
226 Ga0316584_0191888 3300036712 Bacteria 1510
227 Ga0316584_0203936 3300036712 Bacteria 1458
228 Ga0316584_0227831 3300036712 Bacteria 1367
229 Ga0316584_0359245 3300036712 Bacteria 1044
230 Ga0316584_0591603 3300036712 Bacteria 770
231 Ga0316584_0976544 3300036712 Unclassified 567
232 Ga0395899_0002162 3300037312 Bacteria 16144
233 Ga0395900_0084188 3300037418 Bacteria 3267
234 Ga0395900_0092680 3300037418 Bacteria 3104
235 Ga0395898_0380805 3300037466 Bacteria 1345
236 Ga0316581_0006609 3300037588 Bacteria 3077
237 Ga0316581_0013730 3300037588 Bacteria 2300
238 Ga0436364_1148437 3300037853 Bacteria 514
239 Ga0395901_0050606 3300038443 Bacteria 4315
240 Ga0395901_0145782 3300038443 Bacteria 2488
241 Ga0400484_06326 3300038725 Bacteria 14203
242 Ga0400484_10079 3300038725 Bacteria 9691
243 Ga0400484_16994 3300038725 Bacteria 6791
244 Ga0400484_21374 3300038725 Bacteria 5336
245 Ga0400484_25927 3300038725 Bacteria 36509
246 Ga0400490_05410 3300038726 Bacteria 2497
247 Ga0400490_11094 3300038726 Bacteria 62810
248 Ga0400490_15472 3300038726 Bacteria 8971
249 Ga0400490_16453 3300038726 Bacteria 6272
250 Ga0400490_16670 3300038726 Bacteria 68492
251 Ga0400490_25807 3300038726 Bacteria 2148
252 Ga0400490_37802 3300038726 Bacteria 4106
253 Ga0400490_38540 3300038726 Bacteria 6013
254 Ga0400491_03314 3300038727 Bacteria 1141
255 Ga0400491_17150 3300038727 Bacteria 6000
256 Ga0400491_21904 3300038727 Bacteria 3911
257 Ga0400491_24241 3300038727 Bacteria 1060
258 Ga0400485_06870 3300038735 Bacteria 1176
259 Ga0400485_09230 3300038735 Bacteria 1665
260 Ga0400485_17611 3300038735 Bacteria 1648
261 Ga0400488_16022 3300038741 Bacteria 5895
262 Ga0400488_19897 3300038741 Bacteria 11723
263 Ga0400488_22332 3300038741 Bacteria 6536
264 Ga0400488_24368 3300038741 Bacteria 2935
265 Ga0400488_30986 3300038741 Bacteria 1454
266 Ga0400488_35936 3300038741 Bacteria 2951
267 Ga0400488_41109 3300038741 Bacteria 3311
268 Ga0400488_44091 3300038741 Bacteria 2051
269 Ga0400488_49217 3300038741 Bacteria 9992
270 Ga0400488_52966 3300038741 Bacteria 4644
271 Ga0400488_56444 3300038741 Bacteria 1399
272 Ga0400488_57477 3300038741 Bacteria 3058
273 Ga0400488_57843 3300038741 Bacteria 1511
274 Ga0400486_06658 3300038742 Bacteria 7678
275 Ga0400486_13933 3300038742 Bacteria 1271
276 Ga0400486_16629 3300038742 Unclassified 3834
277 Ga0400486_23625 3300038742 Bacteria 1866
278 Ga0400486_26183 3300038742 Bacteria 1878
279 Ga0400486_27174 3300038742 Bacteria 1607
280 Ga0400483_008339 3300039062 Bacteria 10730
281 Ga0400483_009911 3300039062 Bacteria 21418
282 Ga0400483_014518 3300039062 Bacteria 1175
283 Ga0400483_101566 3300039062 Bacteria 2645
284 Ga0400483_106552 3300039062 Bacteria 33444
285 Ga0400483_126315 3300039062 Bacteria 6637
286 Ga0400483_141685 3300039062 Bacteria 9168
287 Ga0400483_163464 3300039062 Bacteria 22945
288 Ga0400483_192734 3300039062 Unclassified 2984
289 Ga0400483_215441 3300039062 Bacteria 10271
290 Ga0400483_222970 3300039062 Bacteria 4390
291 Ga0400483_225271 3300039062 Bacteria 16164
292 Ga0400483_260976 3300039062 Bacteria 29649
293 Ga0400483_263199 3300039062 Bacteria 2121
294 Ga0400483_290988 3300039062 Bacteria 3067
295 Ga0400489_04647 3300039093 Bacteria 3565
296 Ga0400489_28931 3300039093 Bacteria 1067
297 Ga0400487_27162 3300039110 Bacteria 1701
298 Ga0400487_27800 3300039110 Bacteria 73851
299 Ga0400487_33244 3300039110 Bacteria 1876
300 Ga0400487_34381 3300039110 Bacteria 1655
301 Ga0400487_48707 3300039110 Bacteria 2257
302 Ga0400487_54850 3300039110 Bacteria 1205
303 Ga0400487_57965 3300039110 Bacteria 2370
304 Ga0400487_64428 3300039110 Bacteria 30547
305 Ga0436365_1613017 3300039437 Bacteria 128504
306 Ga0436361_0554014 3300039447 Bacteria 63849
307 Ga0451853_4094998 3300041512 Bacteria 3741
308 Ga0439432_026723 3300042006 Bacteria 1888
309 Ga0439452_000036 3300042010 Bacteria 158675
310 Ga0439452_000089 3300042010 Bacteria 79368
311 Ga0439464_0036360 3300042439 Bacteria 1393
312 Ga0466966_0001730 3300044684 Bacteria 14108
313 Ga0466961_0884614 3300044693 Bacteria 532
314 Ga0451576_0027871 3300045051 Bacteria 6060
315 Ga0495627_000086 3300046453 Bacteria 111555
316 Ga0495650_0000282 3300046471 Bacteria 96956
317 Ga0495650_0055303 3300046471 Bacteria 1615
318 Ga0495589_0000032 3300046794 Bacteria 167736
319 Ga0496103_0228327 3300048906 Bacteria 1197
320 Ga0496104_0000476 3300048907 Bacteria 34492
321 Ga0496104_0123090 3300048907 Bacteria 2490
322 Ga0496104_1040844 3300048907 Bacteria 722
323 Ga0496105_0045146 3300048908 Bacteria 3635
324 Ga0496112_0249160 3300048915 Bacteria 1728
325 Ga0496113_0387405 3300048916 Bacteria 1122
326 Ga0496116_0000007 3300048919 Bacteria 795464
327 Ga0496116_0000656 3300048919 Bacteria 45209
328 Ga0496116_0056509 3300048919 Bacteria 2571
329 Ga0496116_0144258 3300048919 Bacteria 1333
330 Ga0496116_0146895 3300048919 Bacteria 1316
331 Ga0496116_0237316 3300048919 Bacteria 919
332 Ga0496117_0000569 3300048920 Bacteria 60550
333 Ga0496117_0003722 3300048920 Bacteria 17498
334 Ga0496117_0008645 3300048920 Bacteria 9637
335 Ga0496117_0060411 3300048920 Bacteria 2612
336 Ga0496117_0076228 3300048920 Bacteria 2224
337 Ga0496117_0079116 3300048920 Bacteria 2167
338 Ga0496117_0083175 3300048920 Bacteria 2093
339 Ga0496117_0095632 3300048920 Bacteria 1897
340 Ga0496117_0099432 3300048920 Bacteria 1845
341 Ga0496117_0111255 3300048920 Bacteria 1705
342 Ga0496117_0277946 3300048920 Bacteria 898
343 Ga0496118_0000542 3300048921 Bacteria 62176
344 Ga0496118_0001921 3300048921 Bacteria 29501
345 Ga0496118_0046391 3300048921 Bacteria 3381
346 Ga0496118_0110633 3300048921 Bacteria 1824
347 Ga0496118_0116324 3300048921 Bacteria 1757
348 Ga0496118_0127856 3300048921 Bacteria 1638
349 Ga0496118_0196607 3300048921 Bacteria 1199
350 Ga0496118_0300522 3300048921 Bacteria 881
351 Ga0496118_0399303 3300048921 Unclassified 715
352 Ga0496119_0000013 3300048922 Bacteria 323820
353 Ga0496119_0003618 3300048922 Bacteria 15900
354 Ga0496119_0003678 3300048922 Bacteria 15728
355 Ga0496119_0006146 3300048922 Bacteria 11240
356 Ga0496119_0013927 3300048922 Bacteria 6344
357 Ga0496119_0040305 3300048922 Bacteria 2989
358 Ga0496119_0058225 3300048922 Bacteria 2329
359 Ga0496119_0192770 3300048922 Unclassified 1061
360 Ga0496120_0001048 3300048923 Bacteria 36748
361 Ga0496120_0001051 3300048923 Bacteria 36572
362 Ga0496120_0005556 3300048923 Bacteria 10019
363 Ga0496120_0014858 3300048923 Bacteria 5163
364 Ga0496120_0016945 3300048923 Bacteria 4742
365 Ga0496120_0020741 3300048923 Bacteria 4168
366 Ga0496120_0114012 3300048923 Bacteria 1407
367 Ga0496120_0501869 3300048923 Bacteria 521
368 Ga0496120_0505350 3300048923 Bacteria 518
369 Ga0496121_0005927 3300048924 Bacteria 15461
370 Ga0496121_0021821 3300048924 Bacteria 6252
371 Ga0496121_0025086 3300048924 Bacteria 5674
372 Ga0496121_0043641 3300048924 Bacteria 3879
373 Ga0496121_0110066 3300048924 Bacteria 2103
374 Ga0496121_0141308 3300048924 Bacteria 1785
375 Ga0496121_0162011 3300048924 Bacteria 1634
376 Ga0496121_0267239 3300048924 Bacteria 1177
377 Ga0496122_0001432 3300048925 Bacteria 38649
378 Ga0496122_0001799 3300048925 Bacteria 32848
379 Ga0496122_0020958 3300048925 Bacteria 5873
380 Ga0496122_0060238 3300048925 Bacteria 2797
381 Ga0496122_0068698 3300048925 Bacteria 2542
382 Ga0496122_0070390 3300048925 Bacteria 2499
383 Ga0496122_0072851 3300048925 Bacteria 2439
384 Ga0496122_0086643 3300048925 Bacteria 2154
385 Ga0496122_0131883 3300048925 Bacteria 1585
386 Ga0496122_0135784 3300048925 Bacteria 1550
387 Ga0496122_0136693 3300048925 Bacteria 1543
388 Ga0496122_0345667 3300048925 Bacteria 779
389 Ga0496123_0001280 3300048926 Bacteria 35902
390 Ga0496123_0002241 3300048926 Bacteria 24499
391 Ga0496123_0003877 3300048926 Bacteria 16271
392 Ga0496123_0015086 3300048926 Bacteria 6360
393 Ga0496123_0023796 3300048926 Bacteria 4678
394 Ga0496123_0025106 3300048926 Bacteria 4502
395 Ga0496123_0040297 3300048926 Bacteria 3255
396 Ga0496123_0058489 3300048926 Bacteria 2499
397 Ga0496123_0073551 3300048926 Bacteria 2120
398 Ga0496123_0105933 3300048926 Bacteria 1621
399 Ga0496123_0110508 3300048926 Bacteria 1572
400 Ga0496123_0274447 3300048926 Bacteria 818
401 Ga0496123_0408733 3300048926 Bacteria 615
402 Ga0496124_0000049 3300048927 Bacteria 269753
403 Ga0496124_0000060 3300048927 Bacteria 239933
404 Ga0496124_0002023 3300048927 Bacteria 27562
405 Ga0496124_0006619 3300048927 Bacteria 12580
406 Ga0496124_0007056 3300048927 Bacteria 12036
407 Ga0496124_0024135 3300048927 Bacteria 5534
408 Ga0496124_0026040 3300048927 Bacteria 5282
409 Ga0496124_0035634 3300048927 Bacteria 4351
410 Ga0496124_0225657 3300048927 Bacteria 1405
411 Ga0496124_0373966 3300048927 Bacteria 999
412 Ga0496124_0398306 3300048927 Bacteria 956
413 Ga0496124_0401779 3300048927 Bacteria 951
414 Ga0496124_0432213 3300048927 Bacteria 903
415 Ga0496125_0000580 3300048928 Bacteria 62643
416 Ga0496125_0010872 3300048928 Bacteria 9158
417 Ga0496125_0048459 3300048928 Bacteria 3542
418 Ga0496125_0048954 3300048928 Bacteria 3517
419 Ga0496125_0049546 3300048928 Bacteria 3489
420 Ga0496125_0061170 3300048928 Bacteria 3021
421 Ga0496125_0118041 3300048928 Bacteria 1901
422 Ga0496125_0413959 3300048928 Bacteria 783
423 Ga0496126_0001227 3300048929 Bacteria 41659
424 Ga0496126_0011853 3300048929 Bacteria 8968
425 Ga0496126_0052717 3300048929 Bacteria 3695
426 Ga0496126_0067756 3300048929 Bacteria 3188
427 Ga0496126_0132215 3300048929 Bacteria 2155
428 Ga0496126_0138640 3300048929 Bacteria 2095
429 Ga0496126_0210198 3300048929 Bacteria 1638
430 Ga0496126_0315860 3300048929 Bacteria 1285
431 Ga0496126_0973050 3300048929 Bacteria 638
432 Ga0496126_1221787 3300048929 Bacteria 551
433 Ga0501036_0786210 3300049572 Bacteria 784
434 Ga0501037_0026107 3300049573 Bacteria 4317
435 Ga0501039_0518170 3300049575 Bacteria 936
436 Ga0501042_0227231 3300049578 Bacteria 1346
437 Ga0501042_0341438 3300049578 Bacteria 1083
438 Ga0501046_0004145 3300049580 Bacteria 13206
439 Ga0501048_0253323 3300049582 Bacteria 1250
440 Ga0501069_0032251 3300049585 Bacteria 2883
441 Ga0501069_0556399 3300049585 Bacteria 687
442 Ga0501070_0014192 3300049586 Bacteria 6704
443 Ga0501071_0283723 3300049587 Bacteria 1253
444 Ga0501074_0647809 3300049590 Bacteria 746
445 Ga0501075_0263573 3300049591 Bacteria 1313
446 Ga0501076_0053729 3300049592 Bacteria 3193
447 Ga0501076_0497803 3300049592 Bacteria 1004
448 Ga0501224_067936 3300049664 Bacteria 561
449 Ga0501225_0039309 3300049705 Bacteria 1303
450 Ga0501080_0219930 3300049742 Bacteria 1738
451 Ga0501204_015462 3300049850 Bacteria 948
452 nmdc:mga03683_94054_c1 3300050489 Bacteria 1310
453 nmdc:mga0yw44_161157_c1 3300050492 Bacteria 1468
454 nmdc:mga0rr50_1518666_c1 3300050513 Unclassified 566
455 Ga0500554_075167 3300053102 Bacteria 1106
456 Ga0500556_0000518 3300053104 Bacteria 26343
457 Ga0500616_0034805 3300053153 Bacteria 2742
458 Ga0500661_006086 3300055283 Bacteria 2251
459 Ga0501082_1494300 3300060353 Bacteria 590
460 2555260005 2554235234 Bacteria 5762085
461 2599412614 2599185169 Bacteria 5441380
462 2601524130 2600255254 Bacteria 5281859
463 2601529284 2600255255 Bacteria 5282785
464 2601535313 2600255256 Bacteria 5597742
465 2601539870 2600255257 Bacteria 5597196
466 2601616118 2600255280 Bacteria 5292309
467 2601620843 2600255281 Bacteria 5288753
468 2601644185 2600255287 Bacteria 5210468
469 2601649240 2600255288 Bacteria 5282738
470 2601654167 2600255289 Bacteria 5281907
471 2601659589 2600255290 Bacteria 5282218
472 2601664010 2600255291 Bacteria 5217298
473 2601696967 2600255298 Bacteria 5215185
474 2601702016 2600255299 Bacteria 5218662
475 2601706911 2600255300 Bacteria 5287774
476 2601712138 2600255301 Bacteria 5280532
477 2601717428 2600255302 Bacteria 5288235
478 2601722304 2600255303 Bacteria 5219315
479 2601727356 2600255304 Bacteria 5283973
480 2601732579 2600255305 Bacteria 5282329
481 2601736906 2600255306 Bacteria 5281613
482 2601743141 2600255307 Bacteria 5439064
483 2601753935 2600255309 Bacteria 5431045
484 2601758494 2600255310 Bacteria 5600903
485 2601764605 2600255311 Bacteria 5598766
486 2602021029 2600255392 Bacteria 5437392
487 2603662168 2602042052 Bacteria 5215873
488 2603667067 2602042053 Bacteria 5214361
489 2603839780 2602042103 Bacteria 5284714
490 2603844854 2602042104 Bacteria 5281639
491 2603850139 2602042105 Bacteria 5282303
492 2603854997 2602042106 Bacteria 5282744
493 2603867745 2602042109 Bacteria 5152801
494 2603872573 2602042110 Bacteria 5283285
495 2603877879 2602042111 Bacteria 5212080
496 2606049967 2603880178 Bacteria 5283018
497 2606071628 2603880184 Bacteria 5217896
498 2606147441 2603880202 Bacteria 5284684
499 2606177858 2603880211 Bacteria 5284226
500 2609909458 2609459761 Bacteria 5513740
501 2656275476 2654587920 Bacteria 5475511
502 2671105507 2667528172 Bacteria 5170840
503 2676405357 2675903046 Bacteria 5451247
504 2682006570 2681812869 Bacteria 5014465
505 2689446338 2687453601 Bacteria 5546041
506 2765590149 2765235842 Bacteria 4799256
507 2772440239 2772190666 Bacteria 5117644
508 2777023245 2775507074 Bacteria 5532402
509 2813727665 2811995292 Bacteria 5303342
510 2814695213 2814123068 Bacteria 5687681
511 2823375802 2823373977 Bacteria 4779415
512 2904517822 2904513164 Bacteria 5476410
513 2919111122 2919108558 Bacteria 5897419
514 2932409287 2932406140 Bacteria 5134491
515 2937542297 2937539931 Bacteria 4639830
516 2937972025 2937967321 Bacteria 5094075
517 2939575537 2939573065 Bacteria 4926053
518 2939580767 2939577877 Bacteria 5132791
519 2939618700 2939617950 Bacteria 4820956
520 2945876594 2945874760 Bacteria 5527237
521 2969080942 2969079654 Bacteria 5439582
522 2971822345 2971820967 Bacteria 5823634
523 2974310962 2974310843 Bacteria 4947816
524 3000378211 3000376612 Bacteria 4705565
525 8004594530 8004592986 Bacteria 5122074
526 8015395764 8015394850 Bacteria 5064660
527 8018409112 8018405270 Bacteria 4978981
528 8019504962 8019504834 Bacteria 4819156
529 Ga0400490_09162
530 SwRhRL2b_contig_1288388
531 SwRhRL2b_contig_185417
532 JGI24752J21851_1036108
533 Ga0006562J51391_1058286
534 Ga0058692_1001841
535 Ga0058692_1017590
536 Ga0058692_1018568
537 Ga0065703_1019005
538 Ga0065704_10013911
539 Ga0065704_10097885
540 Ga0065712_10622852
541 Ga0065707_10116471
542 Ga0070677_10092838
543 Ga0070666_10035499
544 Ga0070661_100875673
545 Ga0070671_101197954
546 Ga0070667_100000002
547 Ga0070685_10000014
548 Ga0070679_101529861
549 Ga0068853_100036782
550 Ga0070665_100000255
551 Ga0068857_100000141
552 Ga0068854_100035773
553 Ga0068852_100716067
554 Ga0068864_100000002
555 Ga0068851_10091661
556 Ga0068851_10906615
557 Ga0068858_100890395
558 Ga0068860_100022421
559 Ga0068860_100038562
560 Ga0068860_101052706
561 Ga0075364_10017714
562 Ga0075362_10003948
563 Ga0079104_1000258
564 Ga0079104_1001243
565 Ga0079104_1004659
566 Ga0079104_1006381
567 Ga0079104_1013909
568 Ga0079104_1019535
569 Ga0105251_10000720
570 Ga0105251_10004595
571 Ga0105251_10006648
572 Ga0105251_10009602
573 Ga0105251_10013873
574 Ga0105251_10016456
575 Ga0105251_10018777
576 Ga0105251_10249843
577 Ga0105244_10000771
578 Ga0105244_10002867
579 Ga0105244_10004142
580 Ga0105244_10037535
581 Ga0105250_10000105
582 Ga0105250_10000136
583 Ga0105250_10020062
584 Ga0105250_10173271
585 Ga0105240_11236684
586 Ga0105247_10000069
587 Ga0105247_11802086
588 Ga0105243_10004468
589 Ga0105243_10019023
590 Ga0105248_10001969
591 Ga0105237_10000458
592 Ga0105237_11395008
593 Ga0105238_11776865
594 Ga0105249_10000763
595 Ga0105249_10089279
596 Ga0105239_10170736
597 Ga0105239_10730248
598 Ga0157373_10038317
599 Ga0157373_10080417
600 Ga0157371_10008546
601 Ga0157371_10110740
602 Ga0157371_10127853
603 Ga0157370_10004659
604 Ga0157370_10994162
605 Ga0157372_10001253
606 Ga0163163_10007598
607 Ga0182008_10106028
608 Ga0157379_10298074
609 Ga0157376_10757858
610 Ga0182006_1102082
611 Ga0182007_10261934
612 Ga0183370_1001
613 Ga0183369_1001
614 Ga0183368_1001
615 Ga0163161_10000005
616 Ga0213872_10002215
617 Ga0213876_10000065
618 Ga0207425_1014916
619 Ga0209129_1000104
620 Ga0207656_10581541
621 Ga0207696_1000039
622 Ga0207696_1000131
623 Ga0207696_1000166
624 Ga0207696_1000666
625 Ga0207655_1000874
626 Ga0207655_1002558
627 Ga0207655_1004643
628 Ga0207655_1013006
629 Ga0207713_1000052
630 Ga0207713_1000069
631 Ga0207713_1000084
632 Ga0207713_1000095
633 Ga0207713_1000443
634 Ga0207713_1013065
635 Ga0207713_1020688
636 Ga0207713_1029777
637 Ga0207713_1038800
638 Ga0207710_10000026
639 Ga0207710_10068434
640 Ga0207680_10006596
641 Ga0207695_10287312
642 Ga0207649_10718321
643 Ga0207681_10024860
644 Ga0207650_10000002
645 Ga0207709_10225486
646 Ga0207669_10661661
647 Ga0207689_10828523
648 Ga0207640_10535523
649 Ga0207658_10000001
650 Ga0207658_11627457
651 Ga0207677_10172547
652 Ga0207641_10143537
653 Ga0207641_11087287
654 Ga0207676_10000001
655 Ga0207674_10002299
656 Ga0209281_1000014
657 Ga0209281_1000142
658 Ga0209281_1000684
659 Ga0209281_1001597
660 Ga0209281_1001922
661 Ga0209281_1006446
662 Ga0209371_1000015
663 Ga0209371_1000221
664 Ga0209371_1002416
665 Ga0209371_1024139
666 Ga0209371_1079920
667 Ga0268266_10000933
668 Ga0268264_10000004
669 Ga0268264_10015564
670 Ga0265319_1128999
671 Ga0268256_1000018
672 Ga0268256_1000183
673 Ga0268256_1002149
674 Ga0268256_1013321
675 Ga0268256_1024955
676 Ga0268256_1051695
677 Ga0268256_1088707
678 Ga0265327_10000420
679 Ga0307408_100000316
680 Ga0316575_10001563
681 Ga0316575_10017566
682 Ga0316579_10002096
683 Ga0316579_10028589
684 Ga0316579_10039380
685 Ga0316579_10517377
686 Ga0316576_10066161
687 Ga0316576_10070059
688 Ga0316576_10603134
689 Ga0316578_10006046
690 Ga0316578_10009137
691 Ga0316578_10053581
692 Ga0316578_10620445
693 Ga0316578_10720129
694 Ga0316577_10000063
695 Ga0316577_10055816
696 Ga0316577_10061576
697 Ga0316577_10124144
698 Ga0316577_10454119
699 Ga0316583_10000433
700 Ga0316583_10006565
701 Ga0316583_10024562
702 Ga0316585_10000126
703 Ga0316585_10017260
704 Ga0316585_10123715
705 Ga0316585_10296382
706 Ga0316580_10009864
707 Ga0316580_10013142
708 Ga0316580_10035153
709 Ga0316593_10012574
710 Ga0316593_10013596
711 Ga0316593_10223891
712 Ga0316596_1018290
713 Ga0373952_0246877
714 Ga0316574_0010320
715 Ga0316574_0017186
716 Ga0316574_0035893
717 Ga0316574_0044527
718 Ga0316574_0050526
719 Ga0316574_0064567
720 Ga0316574_0083643
721 Ga0316574_0087737
722 Ga0316574_0099632
723 Ga0316574_0111295
724 Ga0316574_0147043
725 Ga0316574_0148996
726 Ga0316574_0247475
727 Ga0316574_0456008
728 Ga0316574_0608238
729 Ga0316574_0714298
730 Ga0373931_0189710
731 Ga0373937_0442259
732 Ga0316582_0000031
733 Ga0316582_0000694
734 Ga0316582_0001242
735 Ga0316582_0021149
736 Ga0316582_0043354
737 Ga0316582_0062654
738 Ga0316582_0072478
739 Ga0316582_0135325
740 Ga0316582_0169858
741 Ga0316582_0274296
742 Ga0316582_0365984
743 Ga0316582_0528121
744 Ga0316582_1037008
745 Ga0316582_1046981
746 Ga0316582_1052620
747 Ga0316584_0000691
748 Ga0316584_0008012
749 Ga0316584_0018008
750 Ga0316584_0024955
751 Ga0316584_0095196
752 Ga0316584_0133158
753 Ga0316584_0136910
754 Ga0316584_0191888
755 Ga0316584_0203936
756 Ga0316584_0227831
757 Ga0316584_0359245
758 Ga0316584_0591603
759 Ga0316584_0976544
760 Ga0395899_0002162
761 Ga0395900_0084188
762 Ga0395900_0092680
763 Ga0395898_0380805
764 Ga0316581_0006609
765 Ga0316581_0013730
766 Ga0436364_1148437
767 Ga0395901_0050606
768 Ga0395901_0145782
769 Ga0400484_06326
770 Ga0400484_10079
771 Ga0400484_16994
772 Ga0400484_21374
773 Ga0400484_25927
774 Ga0400490_05410
775 Ga0400490_11094
776 Ga0400490_15472
777 Ga0400490_16453
778 Ga0400490_16670
779 Ga0400490_25807
780 Ga0400490_37802
781 Ga0400490_38540
782 Ga0400491_03314
783 Ga0400491_17150
784 Ga0400491_21904
785 Ga0400491_24241
786 Ga0400485_06870
787 Ga0400485_09230
788 Ga0400485_17611
789 Ga0400488_16022
790 Ga0400488_19897
791 Ga0400488_22332
792 Ga0400488_24368
793 Ga0400488_30986
794 Ga0400488_35936
795 Ga0400488_41109
796 Ga0400488_44091
797 Ga0400488_49217
798 Ga0400488_52966
799 Ga0400488_56444
800 Ga0400488_57477
801 Ga0400488_57843
802 Ga0400486_06658
803 Ga0400486_13933
804 Ga0400486_16629
805 Ga0400486_23625
806 Ga0400486_26183
807 Ga0400486_27174
808 Ga0400483_008339
809 Ga0400483_009911
810 Ga0400483_014518
811 Ga0400483_101566
812 Ga0400483_106552
813 Ga0400483_126315
814 Ga0400483_141685
815 Ga0400483_163464
816 Ga0400483_192734
817 Ga0400483_215441
818 Ga0400483_222970
819 Ga0400483_225271
820 Ga0400483_260976
821 Ga0400483_263199
822 Ga0400483_290988
823 Ga0400489_04647
824 Ga0400489_28931
825 Ga0400487_27162
826 Ga0400487_27800
827 Ga0400487_33244
828 Ga0400487_34381
829 Ga0400487_48707
830 Ga0400487_54850
831 Ga0400487_57965
832 Ga0400487_64428
833 Ga0436365_1613017
834 Ga0436361_0554014
835 Ga0451853_4094998
836 Ga0439432_026723
837 Ga0439452_000036
838 Ga0439452_000089
839 Ga0439464_0036360
840 Ga0466966_0001730
841 Ga0466961_0884614
842 Ga0451576_0027871
843 Ga0495627_000086
844 Ga0495650_0000282
845 Ga0495650_0055303
846 Ga0495589_0000032
847 Ga0496103_0228327
848 Ga0496104_0000476
849 Ga0496104_0123090
850 Ga0496104_1040844
851 Ga0496105_0045146
852 Ga0496112_0249160
853 Ga0496113_0387405
854 Ga0496116_0000007
855 Ga0496116_0000656
856 Ga0496116_0056509
857 Ga0496116_0144258
858 Ga0496116_0146895
859 Ga0496116_0237316
860 Ga0496117_0000569
861 Ga0496117_0003722
862 Ga0496117_0008645
863 Ga0496117_0060411
864 Ga0496117_0076228
865 Ga0496117_0079116
866 Ga0496117_0083175
867 Ga0496117_0095632
868 Ga0496117_0099432
869 Ga0496117_0111255
870 Ga0496117_0277946
871 Ga0496118_0000542
872 Ga0496118_0001921
873 Ga0496118_0046391
874 Ga0496118_0110633
875 Ga0496118_0116324
876 Ga0496118_0127856
877 Ga0496118_0196607
878 Ga0496118_0300522
879 Ga0496118_0399303
880 Ga0496119_0000013
881 Ga0496119_0003618
882 Ga0496119_0003678
883 Ga0496119_0006146
884 Ga0496119_0013927
885 Ga0496119_0040305
886 Ga0496119_0058225
887 Ga0496119_0192770
888 Ga0496120_0001048
889 Ga0496120_0001051
890 Ga0496120_0005556
891 Ga0496120_0014858
892 Ga0496120_0016945
893 Ga0496120_0020741
894 Ga0496120_0114012
895 Ga0496120_0501869
896 Ga0496120_0505350
897 Ga0496121_0005927
898 Ga0496121_0021821
899 Ga0496121_0025086
900 Ga0496121_0043641
901 Ga0496121_0110066
902 Ga0496121_0141308
903 Ga0496121_0162011
904 Ga0496121_0267239
905 Ga0496122_0001432
906 Ga0496122_0001799
907 Ga0496122_0020958
908 Ga0496122_0060238
909 Ga0496122_0068698
910 Ga0496122_0070390
911 Ga0496122_0072851
912 Ga0496122_0086643
913 Ga0496122_0131883
914 Ga0496122_0135784
915 Ga0496122_0136693
916 Ga0496122_0345667
917 Ga0496123_0001280
918 Ga0496123_0002241
919 Ga0496123_0003877
920 Ga0496123_0015086
921 Ga0496123_0023796
922 Ga0496123_0025106
923 Ga0496123_0040297
924 Ga0496123_0058489
925 Ga0496123_0073551
926 Ga0496123_0105933
927 Ga0496123_0110508
928 Ga0496123_0274447
929 Ga0496123_0408733
930 Ga0496124_0000049
931 Ga0496124_0000060
932 Ga0496124_0002023
933 Ga0496124_0006619
934 Ga0496124_0007056
935 Ga0496124_0024135
936 Ga0496124_0026040
937 Ga0496124_0035634
938 Ga0496124_0225657
939 Ga0496124_0373966
940 Ga0496124_0398306
941 Ga0496124_0401779
942 Ga0496124_0432213
943 Ga0496125_0000580
944 Ga0496125_0010872
945 Ga0496125_0048459
946 Ga0496125_0048954
947 Ga0496125_0049546
948 Ga0496125_0061170
949 Ga0496125_0118041
950 Ga0496125_0413959
951 Ga0496126_0001227
952 Ga0496126_0011853
953 Ga0496126_0052717
954 Ga0496126_0067756
955 Ga0496126_0132215
956 Ga0496126_0138640
957 Ga0496126_0210198
958 Ga0496126_0315860
959 Ga0496126_0973050
960 Ga0496126_1221787
961 Ga0501036_0786210
962 Ga0501037_0026107
963 Ga0501039_0518170
964 Ga0501042_0227231
965 Ga0501042_0341438
966 Ga0501046_0004145
967 Ga0501048_0253323
968 Ga0501069_0032251
969 Ga0501069_0556399
970 Ga0501070_0014192
971 Ga0501071_0283723
972 Ga0501074_0647809
973 Ga0501075_0263573
974 Ga0501076_0053729
975 Ga0501076_0497803
976 Ga0501224_067936
977 Ga0501225_0039309
978 Ga0501080_0219930
979 Ga0501204_015462
980 nmdc:mga03683_94054_c1
981 nmdc:mga0yw44_161157_c1
982 nmdc:mga0rr50_1518666_c1
983 Ga0500554_075167
984 Ga0500556_0000518
985 Ga0500616_0034805
986 Ga0500661_006086
987 Ga0501082_1494300
988 2555260005
989 2599412614
990 2601524130
991 2601529284
992 2601535313
993 2601539870
994 2601616118
995 2601620843
996 2601644185
997 2601649240
998 2601654167
999 2601659589
1000 2601664010
1001 2601696967
1002 2601702016
1003 2601706911
1004 2601712138
1005 2601717428
1006 2601722304
1007 2601727356
1008 2601732579
1009 2601736906
1010 2601743141
1011 2601753935
1012 2601758494
1013 2601764605
1014 2602021029
1015 2603662168
1016 2603667067
1017 2603839780
1018 2603844854
1019 2603850139
1020 2603854997
1021 2603867745
1022 2603872573
1023 2603877879
1024 2606049967
1025 2606071628
1026 2606147441
1027 2606177858
1028 2609909458
1029 2656275476
1030 2671105507
1031 2676405357
1032 2682006570
1033 2689446338
1034 2765590149
1035 2772440239
1036 2777023245
1037 2813727665
1038 2814695213
1039 2823375802
1040 2904517822
1041 2919111122
1042 2932409287
1043 2937542297
1044 2937972025
1045 2939575537
1046 2939580767
1047 2939618700
1048 2945876594
1049 2969080942
1050 2971822345
1051 2974310962
1052 3000378211
1053 8004594530
1054 8015395764
1055 8018409112
1056 8019504962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

33

141

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.9924 5 117
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.9752 5 117
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9693 1 118
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9276 5 118
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9259 5 118
ID Description Score Start End Superfamily
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9924 5 117 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9752 5 117 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9251 5 118 3.40.30.10
af_A0A1D6IL16_82_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8929 3 33 3.40.30.10
af_Q9VSL6_6_114_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8821 4 33 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0A2W532-F1-model_v4 TPR repeat-containing protein yfgC 1.002 15 118 GO:0004222
GO:0008794
GO:0016020
GO:0042597
GO:0046872
GO:0051603
GO:0061077
AF-A0A0H3I8S3-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 4 118 GO:0008794
AF-A0A1W9F1F8-F1-model_v4 deleted 1.001 5 118
AF-A0A7U9G0G7-F1-model_v4 deleted 1 1 118
AF-Q8D0Y4-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9985 4 117 GO:0008794

Map