F459701

General Info

Members Datasets Scaffolds Average Seq Length
528 199 1056 112

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_08672|Ga0400485_08672_3333_3725
Length 130
Sequence VTRGQKLRDELKKKGLFVMEAKAVLKHVRISPQKVRKLVGAIKGNPLETALNTLKFMPQKSAAIVEKVVRSAASNAEENHNLDLDDLVIRNIIVDQGPTLKRFKARARGRGTRILKKTSHITVILAEESA

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
14 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
15 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
18 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
23 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
28 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
37 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
38 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
39 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
53 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
54 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
55 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
56 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
59 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
60 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
66 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
67 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
68 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
69 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
70 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
77 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
78 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
105 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
136 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
139 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
141 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
142 2554235283 Bacillus safensis VK Isolate Rhizosphere
143 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
144 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
145 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
146 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
147 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
148 2643221735 Bacillus sp. Root920 Isolate Unclassified
149 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
150 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
151 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
152 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
153 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
154 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
155 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
156 2738543017 Bacillus sp. OV186 Isolate Unclassified
157 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
158 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
159 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
160 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
161 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
162 2811994870 Bacillus sp. JB4 Isolate Unclassified
163 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
164 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
165 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
166 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
167 2857586860 Bacillus sp. R-71935 Isolate Unclassified
168 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
169 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
170 2860837431 Bacillus sp. WR11 Isolate Unclassified
171 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
172 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
173 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
174 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
175 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
176 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
177 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
178 2919726948 Bacillus pumilus 4489 Isolate Unclassified
179 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
180 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
181 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
182 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
183 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
184 2969141011 Bacillus velezensis MH25 Isolate Unclassified
185 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
186 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
187 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
188 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
189 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
190 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
191 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
192 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
193 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
194 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
195 8022653035 Bacillus sp. Rc4 Isolate Unclassified
196 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
197 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
198 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
199 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 35.61
Metatranscriptomes 53.03
Isolates 11.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 4.55
Rhizosphere 80.87
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_08672 3300038735 Bacteria 18258
2 JGI25151J46595_10000735 3300003187 Bacteria 26974
3 JGI25151J46595_10012054 3300003187 Bacteria 3943
4 JGI25151J46595_10036225 3300003187 Bacteria 1863
5 JGI25151J46595_10060372 3300003187 Bacteria 1213
6 Ga0006562J51391_1000677 3300003578 Bacteria 45519
7 Ga0006562J51391_1002825 3300003578 Bacteria 13064
8 Ga0055538_1000160 3300003751 Bacteria 44715
9 Ga0055532_1000266 3300003758 Bacteria 34080
10 Ga0055536_1003459 3300003781 Bacteria 8458
11 Ga0058863_11363707 3300004799 Bacteria 986
12 Ga0070711_100479857 3300005439 Bacteria 1022
13 Ga0070712_101568234 3300006175 Bacteria 576
14 Ga0105244_10012810 3300009036 Bacteria 4942
15 Ga0105250_10187379 3300009092 Bacteria 870
16 Ga0105250_10518546 3300009092 Bacteria 543
17 Ga0114129_12053283 3300009147 Bacteria 690
18 Ga0105248_11636698 3300009177 Bacteria 730
19 Ga0206353_11437168 3300020082 Bacteria 1491
20 Ga0209784_100044 3300025224 Bacteria 206858
21 Ga0209147_100198 3300025229 Bacteria 67714
22 Ga0209147_103236 3300025229 Bacteria 3305
23 Ga0209130_1015250 3300025284 Bacteria 1900
24 Ga0209676_1000745 3300025292 Bacteria 44098
25 Ga0209676_1052171 3300025292 Bacteria 1068
26 Ga0209025_1000639 3300025294 Bacteria 61845
27 Ga0209025_1009107 3300025294 Bacteria 6991
28 Ga0209025_1046751 3300025294 Bacteria 1776
29 Ga0207663_10366822 3300025916 Bacteria 1094
30 Ga0207644_10393324 3300025931 Bacteria 1132
31 Ga0209969_1079114 3300027360 Bacteria 525
32 Ga0209967_1033174 3300027364 Bacteria 776
33 Ga0210000_1001373 3300027462 Bacteria 3430
34 Ga0209970_1000914 3300027614 Bacteria 5205
35 Ga0209971_1022190 3300027682 Bacteria 1511
36 Ga0307408_100125708 3300031548 Bacteria 1994
37 Ga0316575_10014577 3300031665 Bacteria 2953
38 Ga0316575_10086985 3300031665 Bacteria 1263
39 Ga0316575_10138549 3300031665 Bacteria 1000
40 Ga0316575_10190521 3300031665 Bacteria 853
41 Ga0316579_10226842 3300031691 Bacteria 903
42 Ga0316579_10341644 3300031691 Bacteria 724
43 Ga0316579_10368239 3300031691 Bacteria 695
44 Ga0316576_10002450 3300031727 Bacteria 10558
45 Ga0316576_10003583 3300031727 Bacteria 9149
46 Ga0316576_10008020 3300031727 Bacteria 6696
47 Ga0316576_10041668 3300031727 Bacteria 3307
48 Ga0316576_10122358 3300031727 Bacteria 1955
49 Ga0316576_10309782 3300031727 Bacteria 1179
50 Ga0316576_10515711 3300031727 Bacteria 878
51 Ga0316576_10553966 3300031727 Bacteria 842
52 Ga0316576_10559621 3300031727 Bacteria 837
53 Ga0316578_10000551 3300031728 Bacteria 12895
54 Ga0316578_10007960 3300031728 Bacteria 5356
55 Ga0316578_10007997 3300031728 Bacteria 5347
56 Ga0316578_10030344 3300031728 Bacteria 3072
57 Ga0316578_10042373 3300031728 Bacteria 2639
58 Ga0316578_10067761 3300031728 Bacteria 2110
59 Ga0316578_10102922 3300031728 Bacteria 1712
60 Ga0316578_10126520 3300031728 Bacteria 1537
61 Ga0316578_10453227 3300031728 Bacteria 758
62 Ga0316577_10002746 3300031733 Bacteria 8764
63 Ga0316577_10023848 3300031733 Bacteria 3397
64 Ga0316577_10054965 3300031733 Bacteria 2222
65 Ga0316577_10119833 3300031733 Bacteria 1478
66 Ga0316577_10127257 3300031733 Bacteria 1433
67 Ga0316577_10400099 3300031733 Unclassified 780
68 Ga0316577_10402591 3300031733 Bacteria 777
69 Ga0307412_10192496 3300031911 Bacteria 1543
70 Ga0307409_100007174 3300031995 Bacteria 6641
71 Ga0307409_102846143 3300031995 Bacteria 511
72 Ga0307416_100170833 3300032002 Bacteria 2023
73 Ga0307416_100710482 3300032002 Bacteria 1095
74 Ga0307416_100940777 3300032002 Bacteria 966
75 Ga0307416_101860606 3300032002 Bacteria 705
76 Ga0316583_10001747 3300032133 Bacteria 7377
77 Ga0316583_10010218 3300032133 Bacteria 3382
78 Ga0316583_10014899 3300032133 Bacteria 2799
79 Ga0316583_10074729 3300032133 Bacteria 1185
80 Ga0316585_10100676 3300032137 Bacteria 948
81 Ga0316580_10005751 3300032139 Bacteria 3635
82 Ga0316593_10000043 3300032168 Bacteria 13880
83 Ga0316593_10000056 3300032168 Bacteria 12817
84 Ga0316593_10001768 3300032168 Bacteria 4909
85 Ga0316593_10002618 3300032168 Bacteria 4311
86 Ga0316593_10004750 3300032168 Bacteria 3519
87 Ga0316593_10005892 3300032168 Bacteria 3272
88 Ga0316593_10009459 3300032168 Bacteria 2753
89 Ga0316593_10012318 3300032168 Bacteria 2508
90 Ga0316593_10018804 3300032168 Bacteria 2128
91 Ga0316593_10019872 3300032168 Bacteria 2080
92 Ga0316593_10029429 3300032168 Bacteria 1777
93 Ga0316593_10043482 3300032168 Unclassified 1501
94 Ga0316593_10054157 3300032168 Bacteria 1361
95 Ga0316593_10071492 3300032168 Bacteria 1200
96 Ga0316593_10097432 3300032168 Bacteria 1040
97 Ga0316593_10107573 3300032168 Bacteria 994
98 Ga0316593_10135569 3300032168 Bacteria 890
99 Ga0316593_10179498 3300032168 Bacteria 778
100 Ga0316593_10183681 3300032168 Bacteria 769
101 Ga0316593_10197779 3300032168 Bacteria 742
102 Ga0316593_10268410 3300032168 Bacteria 641
103 Ga0316593_10271789 3300032168 Bacteria 637
104 Ga0316593_10379936 3300032168 Bacteria 544
105 Ga0316592_1000035 3300033524 Bacteria 10782
106 Ga0316592_1006430 3300033524 Bacteria 2263
107 Ga0316592_1009914 3300033524 Bacteria 1913
108 Ga0316592_1012784 3300033524 Bacteria 1725
109 Ga0316592_1013391 3300033524 Bacteria 1690
110 Ga0316592_1022026 3300033524 Bacteria 1360
111 Ga0316592_1025209 3300033524 Bacteria 1282
112 Ga0316592_1036895 3300033524 Bacteria 1075
113 Ga0316592_1039859 3300033524 Bacteria 1038
114 Ga0316592_1059180 3300033524 Bacteria 859
115 Ga0316592_1062339 3300033524 Bacteria 838
116 Ga0316592_1161986 3300033524 Bacteria 530
117 Ga0316586_1032930 3300033527 Bacteria 893
118 Ga0316586_1036605 3300033527 Bacteria 854
119 Ga0316586_1123530 3300033527 Unclassified 506
120 Ga0316588_1000152 3300033528 Bacteria 7568
121 Ga0316588_1026017 3300033528 Bacteria 1354
122 Ga0316588_1083812 3300033528 Bacteria 791
123 Ga0316588_1097995 3300033528 Bacteria 733
124 Ga0316587_1006788 3300033529 Bacteria 1761
125 Ga0316587_1019590 3300033529 Bacteria 1145
126 Ga0316596_1000039 3300033541 Bacteria 13805
127 Ga0316596_1000061 3300033541 Bacteria 12225
128 Ga0316596_1000254 3300033541 Bacteria 8213
129 Ga0316596_1000437 3300033541 Bacteria 6945
130 Ga0316596_1000458 3300033541 Bacteria 6838
131 Ga0316596_1001363 3300033541 Bacteria 4886
132 Ga0316596_1001478 3300033541 Bacteria 4757
133 Ga0316596_1002150 3300033541 Bacteria 4167
134 Ga0316596_1002948 3300033541 Bacteria 3690
135 Ga0316596_1004397 3300033541 Bacteria 3157
136 Ga0316596_1008803 3300033541 Bacteria 2413
137 Ga0316596_1010272 3300033541 Bacteria 2262
138 Ga0316596_1012101 3300033541 Bacteria 2118
139 Ga0316596_1021887 3300033541 Bacteria 1631
140 Ga0316596_1022381 3300033541 Bacteria 1615
141 Ga0316596_1026563 3300033541 Bacteria 1492
142 Ga0316596_1032765 3300033541 Bacteria 1353
143 Ga0316596_1059854 3300033541 Bacteria 1015
144 Ga0316596_1065010 3300033541 Bacteria 975
145 Ga0316596_1076356 3300033541 Bacteria 899
146 Ga0316596_1095623 3300033541 Bacteria 802
147 Ga0316596_1101116 3300033541 Bacteria 780
148 Ga0316596_1103976 3300033541 Bacteria 769
149 Ga0316596_1107318 3300033541 Bacteria 757
150 Ga0316596_1119501 3300033541 Bacteria 717
151 Ga0316596_1134913 3300033541 Bacteria 675
152 Ga0316596_1162341 3300033541 Bacteria 615
153 Ga0316596_1217391 3300033541 Bacteria 534
154 Ga0316596_1249077 3300033541 Bacteria 501
155 Ga0316574_0001182 3300035398 Bacteria 12095
156 Ga0316574_0012412 3300035398 Bacteria 4874
157 Ga0316574_0013553 3300035398 Bacteria 4690
158 Ga0316574_0080967 3300035398 Bacteria 2062
159 Ga0316574_0281561 3300035398 Bacteria 1059
160 Ga0316574_0352888 3300035398 Bacteria 930
161 Ga0316582_0000535 3300036647 Bacteria 14503
162 Ga0316582_0003224 3300036647 Bacteria 7940
163 Ga0316582_0011702 3300036647 Bacteria 4863
164 Ga0316582_0300986 3300036647 Bacteria 1102
165 Ga0316582_0674490 3300036647 Bacteria 710
166 Ga0316584_0004587 3300036712 Bacteria 9157
167 Ga0316584_0009686 3300036712 Bacteria 6700
168 Ga0316584_0009934 3300036712 Bacteria 6629
169 Ga0316584_0026734 3300036712 Bacteria 4244
170 Ga0316584_0091701 3300036712 Bacteria 2275
171 Ga0316584_0092561 3300036712 Bacteria 2263
172 Ga0316584_0111354 3300036712 Bacteria 2048
173 Ga0316584_0230198 3300036712 Bacteria 1359
174 Ga0316584_0272749 3300036712 Bacteria 1231
175 Ga0316584_0273989 3300036712 Bacteria 1228
176 Ga0316584_0338004 3300036712 Bacteria 1083
177 Ga0316584_0374800 3300036712 Bacteria 1018
178 Ga0316584_0886525 3300036712 Bacteria 601
179 Ga0395900_0168524 3300037418 Bacteria 2231
180 Ga0395900_1436329 3300037418 Bacteria 603
181 Ga0395898_0428885 3300037466 Bacteria 1260
182 Ga0395898_1319504 3300037466 Bacteria 651
183 Ga0316581_0007723 3300037588 Bacteria 2899
184 Ga0316581_0160042 3300037588 Bacteria 694
185 Ga0316581_0237357 3300037588 Bacteria 560
186 Ga0395901_1895418 3300038443 Bacteria 544
187 Ga0400484_20003 3300038725 Bacteria 3915
188 Ga0400484_27667 3300038725 Bacteria 4271
189 Ga0400484_37672 3300038725 Bacteria 9379
190 Ga0400490_03324 3300038726 Bacteria 2467
191 Ga0400490_05180 3300038726 Bacteria 2956
192 Ga0400490_26141 3300038726 Bacteria 1000
193 Ga0400491_13944 3300038727 Bacteria 2738
194 Ga0400485_08047 3300038735 Bacteria 20055
195 Ga0400485_10318 3300038735 Bacteria 2434
196 Ga0400488_00038 3300038741 Bacteria 1719
197 Ga0400488_03335 3300038741 Bacteria 7283
198 Ga0400488_57235 3300038741 Bacteria 4135
199 Ga0400486_17114 3300038742 Bacteria 18189
200 Ga0400486_17728 3300038742 Bacteria 12468
201 Ga0400486_21368 3300038742 Bacteria 5998
202 Ga0400486_33075 3300038742 Bacteria 8482
203 Ga0400483_001312 3300039062 Bacteria 1379
204 Ga0400483_012769 3300039062 Bacteria 1147
205 Ga0400483_120099 3300039062 Bacteria 48943
206 Ga0400483_221082 3300039062 Bacteria 3310
207 Ga0400483_228134 3300039062 Bacteria 119181
208 Ga0400483_251558 3300039062 Bacteria 1588
209 Ga0400483_265905 3300039062 Bacteria 3120
210 Ga0400489_23715 3300039093 Bacteria 15377
211 Ga0400489_59643 3300039093 Bacteria 25982
212 Ga0400489_66216 3300039093 Bacteria 19270
213 Ga0400489_74615 3300039093 Bacteria 23866
214 Ga0400489_76217 3300039093 Bacteria 1176
215 Ga0400489_86209 3300039093 Bacteria 8537
216 Ga0400487_33846 3300039110 Bacteria 3869
217 Ga0400487_55496 3300039110 Bacteria 6673
218 Ga0451789_0260892 3300041443 Bacteria 838
219 Ga0451577_0244654 3300042876 Bacteria 1623
220 Ga0453684_0408481 3300044712 Bacteria 1519
221 Ga0466957_0269967 3300044842 Bacteria 1136
222 Ga0451576_0004083 3300045051 Bacteria 19291
223 Ga0495590_0042229 3300046457 Bacteria 1590
224 Ga0495605_0075252 3300046474 Bacteria 1588
225 Ga0495584_0703913 3300046491 Bacteria 515
226 Ga0495654_0251932 3300046530 Bacteria 735
227 Ga0495597_0372709 3300046542 Bacteria 545
228 Ga0495633_0065769 3300046558 Bacteria 1694
229 Ga0495661_0085148 3300046665 Bacteria 1812
230 Ga0495661_0247133 3300046665 Bacteria 912
231 Ga0495657_0667183 3300046675 Bacteria 599
232 Ga0495670_0045580 3300046691 Bacteria 2189
233 Ga0495670_0306785 3300046691 Bacteria 851
234 Ga0495660_0004825 3300046810 Bacteria 8134
235 Ga0495672_0407259 3300047320 Bacteria 621
236 Ga0495676_0133814 3300047321 Bacteria 1786
237 Ga0495680_0347683 3300047322 Bacteria 1033
238 Ga0495684_0700380 3300047471 Bacteria 672
239 Ga0496100_0679634 3300048903 Bacteria 803
240 Ga0496101_0038405 3300048904 Bacteria 3401
241 Ga0496102_0011196 3300048905 Bacteria 7725
242 Ga0496102_0099351 3300048905 Bacteria 2701
243 Ga0496102_0629539 3300048905 Bacteria 996
244 Ga0496103_0047911 3300048906 Bacteria 2641
245 Ga0496103_0276565 3300048906 Bacteria 1080
246 Ga0496103_0478435 3300048906 Bacteria 798
247 Ga0496104_0348085 3300048907 Bacteria 1395
248 Ga0496104_0353513 3300048907 Bacteria 1382
249 Ga0496108_1201168 3300048911 Bacteria 641
250 Ga0496109_0087437 3300048912 Bacteria 2879
251 Ga0496110_0003743 3300048913 Bacteria 11715
252 Ga0496110_0311758 3300048913 Bacteria 1433
253 Ga0496110_1272718 3300048913 Bacteria 645
254 Ga0496111_0005358 3300048914 Bacteria 8202
255 Ga0496111_1138120 3300048914 Bacteria 555
256 Ga0496112_0264091 3300048915 Bacteria 1670
257 Ga0496112_1425031 3300048915 Bacteria 607
258 Ga0496113_0413632 3300048916 Bacteria 1083
259 Ga0496122_0199829 3300048925 Bacteria 1170
260 Ga0496126_0078001 3300048929 Bacteria 2936
261 Ga0501306_000030 3300049127 Bacteria 8097
262 Ga0501306_000138 3300049127 Bacteria 4465
263 Ga0501306_000285 3300049127 Bacteria 3614
264 Ga0501306_003694 3300049127 Bacteria 1665
265 Ga0501306_004132 3300049127 Bacteria 1609
266 Ga0501308_000106 3300049128 Bacteria 3961
267 Ga0501308_000127 3300049128 Bacteria 3778
268 Ga0501308_003239 3300049128 Bacteria 1495
269 Ga0501309_003421 3300049129 Bacteria 1795
270 Ga0501309_020491 3300049129 Bacteria 926
271 Ga0501309_053604 3300049129 Bacteria 637
272 Ga0501310_000940 3300049130 Bacteria 2590
273 Ga0501310_009955 3300049130 Bacteria 1054
274 Ga0501341_00024 3300049131 Bacteria 4362
275 Ga0501341_00074 3300049131 Bacteria 2990
276 Ga0501341_00193 3300049131 Bacteria 2190
277 Ga0501341_00222 3300049131 Bacteria 2112
278 Ga0501341_02017 3300049131 Bacteria 1068
279 Ga0501341_02439 3300049131 Bacteria 1005
280 Ga0501341_03220 3300049131 Bacteria 915
281 Ga0501341_14051 3300049131 Bacteria 554
282 Ga0501343_000392 3300049132 Bacteria 2500
283 Ga0501343_001442 3300049132 Bacteria 1615
284 Ga0501343_002494 3300049132 Bacteria 1312
285 Ga0501343_002627 3300049132 Bacteria 1289
286 Ga0501343_003186 3300049132 Bacteria 1197
287 Ga0501343_008110 3300049132 Bacteria 836
288 Ga0501343_008265 3300049132 Bacteria 830
289 Ga0501344_00011 3300049133 Bacteria 4536
290 Ga0501344_00060 3300049133 Bacteria 3139
291 Ga0501344_00166 3300049133 Bacteria 2343
292 Ga0501344_11047 3300049133 Bacteria 557
293 Ga0501344_11091 3300049133 Bacteria 556
294 Ga0501345_00004 3300049134 Bacteria 5201
295 Ga0501345_00405 3300049134 Bacteria 1424
296 Ga0501304_000046 3300049160 Bacteria 4246
297 Ga0501304_002674 3300049160 Bacteria 1256
298 Ga0501304_006007 3300049160 Bacteria 968
299 Ga0501304_006207 3300049160 Bacteria 958
300 Ga0501305_000007 3300049161 Bacteria 11997
301 Ga0501305_000048 3300049161 Bacteria 6708
302 Ga0501305_002503 3300049161 Bacteria 1992
303 Ga0501305_002856 3300049161 Bacteria 1906
304 Ga0501305_003944 3300049161 Bacteria 1714
305 Ga0501305_008928 3300049161 Bacteria 1307
306 Ga0501305_009687 3300049161 Bacteria 1272
307 Ga0501305_055142 3300049161 Bacteria 674
308 Ga0501307_000011 3300049162 Bacteria 6472
309 Ga0501307_000155 3300049162 Bacteria 3645
310 Ga0501307_008353 3300049162 Bacteria 1161
311 Ga0501307_014662 3300049162 Bacteria 961
312 Ga0501307_051525 3300049162 Bacteria 620
313 Ga0501342_00056 3300049163 Bacteria 2311
314 Ga0501342_00181 3300049163 Bacteria 1522
315 Ga0501342_01190 3300049163 Bacteria 800
316 Ga0501290_096348 3300049513 Bacteria 521
317 Ga0501311_000009 3300049527 Bacteria 8275
318 Ga0501311_000124 3300049527 Bacteria 3927
319 Ga0501311_000152 3300049527 Bacteria 3775
320 Ga0501311_005953 3300049527 Bacteria 1357
321 Ga0501311_008221 3300049527 Bacteria 1218
322 Ga0501311_020732 3300049527 Bacteria 891
323 Ga0501312_000002 3300049528 Bacteria 17365
324 Ga0501312_000051 3300049528 Bacteria 7173
325 Ga0501312_000171 3300049528 Bacteria 4337
326 Ga0501312_000739 3300049528 Bacteria 2829
327 Ga0501312_007190 3300049528 Bacteria 1412
328 Ga0501312_028693 3300049528 Bacteria 864
329 Ga0501313_000003 3300049529 Bacteria 10446
330 Ga0501313_000081 3300049529 Bacteria 4439
331 Ga0501313_000360 3300049529 Bacteria 2976
332 Ga0501313_000781 3300049529 Bacteria 2416
333 Ga0501313_002469 3300049529 Bacteria 1755
334 Ga0501313_034153 3300049529 Bacteria 668
335 Ga0501313_054732 3300049529 Bacteria 557
336 Ga0501314_000773 3300049530 Bacteria 2110
337 Ga0501314_000797 3300049530 Bacteria 2088
338 Ga0501314_002612 3300049530 Bacteria 1405
339 Ga0501314_005241 3300049530 Bacteria 1099
340 Ga0501315_000006 3300049531 Bacteria 10500
341 Ga0501315_000072 3300049531 Bacteria 4669
342 Ga0501315_000123 3300049531 Bacteria 4189
343 Ga0501315_001506 3300049531 Bacteria 2018
344 Ga0501315_010592 3300049531 Bacteria 1111
345 Ga0501315_013630 3300049531 Bacteria 1020
346 Ga0501315_063675 3300049531 Bacteria 600
347 Ga0501315_104606 3300049531 Bacteria 503
348 Ga0501316_000137 3300049532 Bacteria 3921
349 Ga0501316_000153 3300049532 Bacteria 3769
350 Ga0501316_000268 3300049532 Bacteria 3268
351 Ga0501316_002234 3300049532 Bacteria 1771
352 Ga0501316_002272 3300049532 Bacteria 1762
353 Ga0501316_008645 3300049532 Bacteria 1128
354 Ga0501317_000414 3300049533 Bacteria 2936
355 Ga0501317_000563 3300049533 Bacteria 2711
356 Ga0501317_001025 3300049533 Bacteria 2270
357 Ga0501317_006422 3300049533 Bacteria 1293
358 Ga0501317_010097 3300049533 Bacteria 1122
359 Ga0501317_031788 3300049533 Bacteria 770
360 Ga0501318_000003 3300049534 Bacteria 10033
361 Ga0501318_006139 3300049534 Bacteria 1218
362 Ga0501318_008046 3300049534 Bacteria 1117
363 Ga0501318_008247 3300049534 Bacteria 1109
364 Ga0501318_010585 3300049534 Bacteria 1026
365 Ga0501318_017200 3300049534 Bacteria 881
366 Ga0501318_039571 3300049534 Bacteria 670
367 Ga0501319_000003 3300049535 Bacteria 10442
368 Ga0501319_000047 3300049535 Bacteria 3949
369 Ga0501319_000238 3300049535 Bacteria 2328
370 Ga0501320_000070 3300049536 Bacteria 4546
371 Ga0501320_000079 3300049536 Bacteria 4310
372 Ga0501320_005312 3300049536 Bacteria 1169
373 Ga0501320_013920 3300049536 Bacteria 864
374 Ga0501320_022962 3300049536 Bacteria 735
375 Ga0501320_028615 3300049536 Bacteria 683
376 Ga0501321_000002 3300049537 Bacteria 13305
377 Ga0501321_000088 3300049537 Bacteria 4285
378 Ga0501321_000089 3300049537 Bacteria 4280
379 Ga0501321_009872 3300049537 Bacteria 1038
380 Ga0501321_018443 3300049537 Bacteria 847
381 Ga0501321_025183 3300049537 Bacteria 766
382 Ga0501321_083253 3300049537 Bacteria 513
383 Ga0501322_000335 3300049538 Bacteria 2117
384 Ga0501322_000404 3300049538 Bacteria 1996
385 Ga0501322_004788 3300049538 Bacteria 921
386 Ga0501322_008588 3300049538 Bacteria 761
387 Ga0501323_000116 3300049539 Bacteria 4416
388 Ga0501323_000308 3300049539 Bacteria 3416
389 Ga0501323_002710 3300049539 Bacteria 1745
390 Ga0501323_007909 3300049539 Bacteria 1224
391 Ga0501323_051645 3300049539 Bacteria 625
392 Ga0501324_000153 3300049540 Bacteria 3001
393 Ga0501324_002993 3300049540 Bacteria 1268
394 Ga0501324_003211 3300049540 Bacteria 1241
395 Ga0501324_003902 3300049540 Bacteria 1165
396 Ga0501324_004891 3300049540 Bacteria 1084
397 Ga0501325_000006 3300049541 Bacteria 7014
398 Ga0501325_012344 3300049541 Bacteria 803
399 Ga0501325_056130 3300049541 Bacteria 511
400 Ga0501326_00045 3300049542 Bacteria 3869
401 Ga0501326_00113 3300049542 Bacteria 2596
402 Ga0501326_00177 3300049542 Bacteria 2247
403 Ga0501326_02651 3300049542 Bacteria 889
404 Ga0501326_13868 3300049542 Bacteria 505
405 Ga0501327_00035 3300049543 Bacteria 4032
406 Ga0501327_00389 3300049543 Bacteria 1710
407 Ga0501327_01957 3300049543 Bacteria 1036
408 Ga0501327_03203 3300049543 Bacteria 888
409 Ga0501328_00014 3300049544 Bacteria 4034
410 Ga0501328_00064 3300049544 Bacteria 2493
411 Ga0501328_00270 3300049544 Bacteria 1610
412 Ga0501328_00940 3300049544 Bacteria 1085
413 Ga0501328_08228 3300049544 Bacteria 564
414 Ga0501329_00157 3300049545 Bacteria 1886
415 Ga0501329_00304 3300049545 Bacteria 1600
416 Ga0501329_00684 3300049545 Bacteria 1287
417 Ga0501330_000139 3300049546 Bacteria 2405
418 Ga0501330_003198 3300049546 Bacteria 964
419 Ga0501331_00073 3300049547 Bacteria 2981
420 Ga0501331_00179 3300049547 Bacteria 2269
421 Ga0501331_01395 3300049547 Bacteria 1169
422 Ga0501331_01778 3300049547 Bacteria 1083
423 Ga0501332_00490 3300049548 Bacteria 1741
424 Ga0501332_00546 3300049548 Bacteria 1688
425 Ga0501332_02078 3300049548 Bacteria 1099
426 Ga0501332_02832 3300049548 Bacteria 985
427 Ga0501332_14030 3300049548 Bacteria 562
428 Ga0501333_001637 3300049549 Bacteria 1237
429 Ga0501333_001872 3300049549 Bacteria 1185
430 Ga0501333_002894 3300049549 Bacteria 1028
431 Ga0501333_003008 3300049549 Bacteria 1013
432 Ga0501333_016748 3300049549 Bacteria 563
433 Ga0501334_00014 3300049550 Bacteria 5746
434 Ga0501334_00634 3300049550 Bacteria 1695
435 Ga0501334_01174 3300049550 Bacteria 1404
436 Ga0501334_02083 3300049550 Bacteria 1164
437 Ga0501334_03876 3300049550 Bacteria 941
438 Ga0501334_09586 3300049550 Bacteria 691
439 Ga0501335_000116 3300049551 Bacteria 3814
440 Ga0501335_001159 3300049551 Bacteria 1968
441 Ga0501335_001571 3300049551 Bacteria 1766
442 Ga0501335_005235 3300049551 Bacteria 1154
443 Ga0501335_008105 3300049551 Bacteria 982
444 Ga0501336_000332 3300049552 Bacteria 2220
445 Ga0501336_000875 3300049552 Bacteria 1664
446 Ga0501336_001822 3300049552 Bacteria 1318
447 Ga0501336_005798 3300049552 Bacteria 903
448 Ga0501336_009033 3300049552 Bacteria 780
449 Ga0501337_000050 3300049553 Bacteria 4082
450 Ga0501337_000210 3300049553 Bacteria 2561
451 Ga0501337_000952 3300049553 Bacteria 1571
452 Ga0501337_004275 3300049553 Bacteria 929
453 Ga0501338_00355 3300049554 Bacteria 1984
454 Ga0501338_00393 3300049554 Bacteria 1919
455 Ga0501338_01217 3300049554 Bacteria 1343
456 Ga0501338_01413 3300049554 Bacteria 1280
457 Ga0501338_02524 3300049554 Bacteria 1046
458 Ga0501338_03097 3300049554 Bacteria 971
459 Ga0501339_00013 3300049555 Bacteria 2208
460 Ga0501339_00086 3300049555 Bacteria 1322
461 Ga0501340_000004 3300049556 Bacteria 7126
462 Ga0501340_000079 3300049556 Bacteria 2964
463 Ga0501340_001704 3300049556 Bacteria 1216
464 Ga0501202_090762 3300049652 Bacteria 731
465 Ga0501217_012762 3300049661 Bacteria 1876
466 Ga0501225_0121924 3300049705 Bacteria 775
467 Ga0501212_064783 3300049851 Bacteria 638
468 Ga0587067_189236 3300059640 Bacteria 541
469 2511698004 2511231119 Bacteria 4019861
470 2545559757 2545555800 Bacteria 4222588
471 2555470885 2554235283 Bacteria 3683090
472 2578930714 2576861599 Bacteria 4217202
473 2595092272 2593339131 Bacteria 5116855
474 2600199447 2599185353 Bacteria 2219443
475 2600401649 2600254943 Bacteria 2613887
476 2631982460 2630968484 Bacteria 3876276
477 2644741863 2643221735 Bacteria 3676263
478 2651530325 2648501850 Bacteria 3975476
479 2674421120 2671180844 Bacteria 4164150
480 2686995327 2684623153 Bacteria 3878815
481 2687496576 2687453109 Bacteria 3860091
482 2695629924 2695420354 Bacteria 3922431
483 2717918177 2716884898 Bacteria 3928789
484 2738839005 2738541299 Bacteria 4020721
485 2739271693 2738543017 Bacteria 4271950
486 2740990509 2740891818 Bacteria 6711283
487 2757568907 2757320391 Bacteria 4746095
488 2777764208 2775507177 Bacteria 4384303
489 2777837283 2775507192 Bacteria 4622234
490 2809057183 2808606399 Bacteria 4021018
491 2812314466 2811994870 Bacteria 3776934
492 2817478192 2816332295 Bacteria 4352468
493 2819726065 2818991468 Bacteria 3723169
494 2823526419 2823526263 Bacteria 3765752
495 2857358451 2857357740 Bacteria 9937880
496 2857590955 2857586860 Bacteria 4354574
497 2857608868 2857604169 Bacteria 5111450
498 2857613421 2857609550 Bacteria 3753890
499 2860837583 2860837431 Bacteria 4202080
500 2877768802 2877768649 Bacteria 3957164
501 2880169744 2880169592 Bacteria 3900066
502 2897109771 2897109615 Bacteria 4009619
503 2904564593 2904560550 Bacteria 4029838
504 2908669316 2908665501 Bacteria 3678115
505 2919097074 2919093281 Bacteria 3660974
506 2919419356 2919414237 Bacteria 5429133
507 2919730769 2919726948 Bacteria 3696050
508 2928513045 2928510474 Bacteria 4815308
509 2936343060 2936340661 Bacteria 5139038
510 2954776077 2954773129 Bacteria 3741715
511 2962290794 2962290636 Bacteria 4072939
512 2969137001 2969136845 Bacteria 3923176
513 2969141170 2969141011 Bacteria 4118468
514 2969766250 2969765954 Bacteria 4216713
515 2969774918 2969770375 Bacteria 4271280
516 2971893531 2971893375 Bacteria 3929648
517 2977254692 2977254563 Bacteria 4828420
518 2980492745 2980492589 Bacteria 4072961
519 2990275695 2990275345 Bacteria 4887158
520 3006858520 3006858327 Bacteria 4317835
521 3006883632 3006879489 Bacteria 4064221
522 3006980025 3006978542 Bacteria 5328100
523 8022631637 8022630665 Bacteria 3886130
524 8022655881 8022653035 Bacteria 4035078
525 8051956514 8051952484 Bacteria 3926774
526 8052174990 8052174270 Bacteria 3881265
527 8054282866 8054280661 Bacteria 4232245
528 8057632289 8057632132 Bacteria 4726859
529 Ga0400485_08672
530 JGI25151J46595_10000735
531 JGI25151J46595_10012054
532 JGI25151J46595_10036225
533 JGI25151J46595_10060372
534 Ga0006562J51391_1000677
535 Ga0006562J51391_1002825
536 Ga0055538_1000160
537 Ga0055532_1000266
538 Ga0055536_1003459
539 Ga0058863_11363707
540 Ga0070711_100479857
541 Ga0070712_101568234
542 Ga0105244_10012810
543 Ga0105250_10187379
544 Ga0105250_10518546
545 Ga0114129_12053283
546 Ga0105248_11636698
547 Ga0206353_11437168
548 Ga0209784_100044
549 Ga0209147_100198
550 Ga0209147_103236
551 Ga0209130_1015250
552 Ga0209676_1000745
553 Ga0209676_1052171
554 Ga0209025_1000639
555 Ga0209025_1009107
556 Ga0209025_1046751
557 Ga0207663_10366822
558 Ga0207644_10393324
559 Ga0209969_1079114
560 Ga0209967_1033174
561 Ga0210000_1001373
562 Ga0209970_1000914
563 Ga0209971_1022190
564 Ga0307408_100125708
565 Ga0316575_10014577
566 Ga0316575_10086985
567 Ga0316575_10138549
568 Ga0316575_10190521
569 Ga0316579_10226842
570 Ga0316579_10341644
571 Ga0316579_10368239
572 Ga0316576_10002450
573 Ga0316576_10003583
574 Ga0316576_10008020
575 Ga0316576_10041668
576 Ga0316576_10122358
577 Ga0316576_10309782
578 Ga0316576_10515711
579 Ga0316576_10553966
580 Ga0316576_10559621
581 Ga0316578_10000551
582 Ga0316578_10007960
583 Ga0316578_10007997
584 Ga0316578_10030344
585 Ga0316578_10042373
586 Ga0316578_10067761
587 Ga0316578_10102922
588 Ga0316578_10126520
589 Ga0316578_10453227
590 Ga0316577_10002746
591 Ga0316577_10023848
592 Ga0316577_10054965
593 Ga0316577_10119833
594 Ga0316577_10127257
595 Ga0316577_10400099
596 Ga0316577_10402591
597 Ga0307412_10192496
598 Ga0307409_100007174
599 Ga0307409_102846143
600 Ga0307416_100170833
601 Ga0307416_100710482
602 Ga0307416_100940777
603 Ga0307416_101860606
604 Ga0316583_10001747
605 Ga0316583_10010218
606 Ga0316583_10014899
607 Ga0316583_10074729
608 Ga0316585_10100676
609 Ga0316580_10005751
610 Ga0316593_10000043
611 Ga0316593_10000056
612 Ga0316593_10001768
613 Ga0316593_10002618
614 Ga0316593_10004750
615 Ga0316593_10005892
616 Ga0316593_10009459
617 Ga0316593_10012318
618 Ga0316593_10018804
619 Ga0316593_10019872
620 Ga0316593_10029429
621 Ga0316593_10043482
622 Ga0316593_10054157
623 Ga0316593_10071492
624 Ga0316593_10097432
625 Ga0316593_10107573
626 Ga0316593_10135569
627 Ga0316593_10179498
628 Ga0316593_10183681
629 Ga0316593_10197779
630 Ga0316593_10268410
631 Ga0316593_10271789
632 Ga0316593_10379936
633 Ga0316592_1000035
634 Ga0316592_1006430
635 Ga0316592_1009914
636 Ga0316592_1012784
637 Ga0316592_1013391
638 Ga0316592_1022026
639 Ga0316592_1025209
640 Ga0316592_1036895
641 Ga0316592_1039859
642 Ga0316592_1059180
643 Ga0316592_1062339
644 Ga0316592_1161986
645 Ga0316586_1032930
646 Ga0316586_1036605
647 Ga0316586_1123530
648 Ga0316588_1000152
649 Ga0316588_1026017
650 Ga0316588_1083812
651 Ga0316588_1097995
652 Ga0316587_1006788
653 Ga0316587_1019590
654 Ga0316596_1000039
655 Ga0316596_1000061
656 Ga0316596_1000254
657 Ga0316596_1000437
658 Ga0316596_1000458
659 Ga0316596_1001363
660 Ga0316596_1001478
661 Ga0316596_1002150
662 Ga0316596_1002948
663 Ga0316596_1004397
664 Ga0316596_1008803
665 Ga0316596_1010272
666 Ga0316596_1012101
667 Ga0316596_1021887
668 Ga0316596_1022381
669 Ga0316596_1026563
670 Ga0316596_1032765
671 Ga0316596_1059854
672 Ga0316596_1065010
673 Ga0316596_1076356
674 Ga0316596_1095623
675 Ga0316596_1101116
676 Ga0316596_1103976
677 Ga0316596_1107318
678 Ga0316596_1119501
679 Ga0316596_1134913
680 Ga0316596_1162341
681 Ga0316596_1217391
682 Ga0316596_1249077
683 Ga0316574_0001182
684 Ga0316574_0012412
685 Ga0316574_0013553
686 Ga0316574_0080967
687 Ga0316574_0281561
688 Ga0316574_0352888
689 Ga0316582_0000535
690 Ga0316582_0003224
691 Ga0316582_0011702
692 Ga0316582_0300986
693 Ga0316582_0674490
694 Ga0316584_0004587
695 Ga0316584_0009686
696 Ga0316584_0009934
697 Ga0316584_0026734
698 Ga0316584_0091701
699 Ga0316584_0092561
700 Ga0316584_0111354
701 Ga0316584_0230198
702 Ga0316584_0272749
703 Ga0316584_0273989
704 Ga0316584_0338004
705 Ga0316584_0374800
706 Ga0316584_0886525
707 Ga0395900_0168524
708 Ga0395900_1436329
709 Ga0395898_0428885
710 Ga0395898_1319504
711 Ga0316581_0007723
712 Ga0316581_0160042
713 Ga0316581_0237357
714 Ga0395901_1895418
715 Ga0400484_20003
716 Ga0400484_27667
717 Ga0400484_37672
718 Ga0400490_03324
719 Ga0400490_05180
720 Ga0400490_26141
721 Ga0400491_13944
722 Ga0400485_08047
723 Ga0400485_10318
724 Ga0400488_00038
725 Ga0400488_03335
726 Ga0400488_57235
727 Ga0400486_17114
728 Ga0400486_17728
729 Ga0400486_21368
730 Ga0400486_33075
731 Ga0400483_001312
732 Ga0400483_012769
733 Ga0400483_120099
734 Ga0400483_221082
735 Ga0400483_228134
736 Ga0400483_251558
737 Ga0400483_265905
738 Ga0400489_23715
739 Ga0400489_59643
740 Ga0400489_66216
741 Ga0400489_74615
742 Ga0400489_76217
743 Ga0400489_86209
744 Ga0400487_33846
745 Ga0400487_55496
746 Ga0451789_0260892
747 Ga0451577_0244654
748 Ga0453684_0408481
749 Ga0466957_0269967
750 Ga0451576_0004083
751 Ga0495590_0042229
752 Ga0495605_0075252
753 Ga0495584_0703913
754 Ga0495654_0251932
755 Ga0495597_0372709
756 Ga0495633_0065769
757 Ga0495661_0085148
758 Ga0495661_0247133
759 Ga0495657_0667183
760 Ga0495670_0045580
761 Ga0495670_0306785
762 Ga0495660_0004825
763 Ga0495672_0407259
764 Ga0495676_0133814
765 Ga0495680_0347683
766 Ga0495684_0700380
767 Ga0496100_0679634
768 Ga0496101_0038405
769 Ga0496102_0011196
770 Ga0496102_0099351
771 Ga0496102_0629539
772 Ga0496103_0047911
773 Ga0496103_0276565
774 Ga0496103_0478435
775 Ga0496104_0348085
776 Ga0496104_0353513
777 Ga0496108_1201168
778 Ga0496109_0087437
779 Ga0496110_0003743
780 Ga0496110_0311758
781 Ga0496110_1272718
782 Ga0496111_0005358
783 Ga0496111_1138120
784 Ga0496112_0264091
785 Ga0496112_1425031
786 Ga0496113_0413632
787 Ga0496122_0199829
788 Ga0496126_0078001
789 Ga0501306_000030
790 Ga0501306_000138
791 Ga0501306_000285
792 Ga0501306_003694
793 Ga0501306_004132
794 Ga0501308_000106
795 Ga0501308_000127
796 Ga0501308_003239
797 Ga0501309_003421
798 Ga0501309_020491
799 Ga0501309_053604
800 Ga0501310_000940
801 Ga0501310_009955
802 Ga0501341_00024
803 Ga0501341_00074
804 Ga0501341_00193
805 Ga0501341_00222
806 Ga0501341_02017
807 Ga0501341_02439
808 Ga0501341_03220
809 Ga0501341_14051
810 Ga0501343_000392
811 Ga0501343_001442
812 Ga0501343_002494
813 Ga0501343_002627
814 Ga0501343_003186
815 Ga0501343_008110
816 Ga0501343_008265
817 Ga0501344_00011
818 Ga0501344_00060
819 Ga0501344_00166
820 Ga0501344_11047
821 Ga0501344_11091
822 Ga0501345_00004
823 Ga0501345_00405
824 Ga0501304_000046
825 Ga0501304_002674
826 Ga0501304_006007
827 Ga0501304_006207
828 Ga0501305_000007
829 Ga0501305_000048
830 Ga0501305_002503
831 Ga0501305_002856
832 Ga0501305_003944
833 Ga0501305_008928
834 Ga0501305_009687
835 Ga0501305_055142
836 Ga0501307_000011
837 Ga0501307_000155
838 Ga0501307_008353
839 Ga0501307_014662
840 Ga0501307_051525
841 Ga0501342_00056
842 Ga0501342_00181
843 Ga0501342_01190
844 Ga0501290_096348
845 Ga0501311_000009
846 Ga0501311_000124
847 Ga0501311_000152
848 Ga0501311_005953
849 Ga0501311_008221
850 Ga0501311_020732
851 Ga0501312_000002
852 Ga0501312_000051
853 Ga0501312_000171
854 Ga0501312_000739
855 Ga0501312_007190
856 Ga0501312_028693
857 Ga0501313_000003
858 Ga0501313_000081
859 Ga0501313_000360
860 Ga0501313_000781
861 Ga0501313_002469
862 Ga0501313_034153
863 Ga0501313_054732
864 Ga0501314_000773
865 Ga0501314_000797
866 Ga0501314_002612
867 Ga0501314_005241
868 Ga0501315_000006
869 Ga0501315_000072
870 Ga0501315_000123
871 Ga0501315_001506
872 Ga0501315_010592
873 Ga0501315_013630
874 Ga0501315_063675
875 Ga0501315_104606
876 Ga0501316_000137
877 Ga0501316_000153
878 Ga0501316_000268
879 Ga0501316_002234
880 Ga0501316_002272
881 Ga0501316_008645
882 Ga0501317_000414
883 Ga0501317_000563
884 Ga0501317_001025
885 Ga0501317_006422
886 Ga0501317_010097
887 Ga0501317_031788
888 Ga0501318_000003
889 Ga0501318_006139
890 Ga0501318_008046
891 Ga0501318_008247
892 Ga0501318_010585
893 Ga0501318_017200
894 Ga0501318_039571
895 Ga0501319_000003
896 Ga0501319_000047
897 Ga0501319_000238
898 Ga0501320_000070
899 Ga0501320_000079
900 Ga0501320_005312
901 Ga0501320_013920
902 Ga0501320_022962
903 Ga0501320_028615
904 Ga0501321_000002
905 Ga0501321_000088
906 Ga0501321_000089
907 Ga0501321_009872
908 Ga0501321_018443
909 Ga0501321_025183
910 Ga0501321_083253
911 Ga0501322_000335
912 Ga0501322_000404
913 Ga0501322_004788
914 Ga0501322_008588
915 Ga0501323_000116
916 Ga0501323_000308
917 Ga0501323_002710
918 Ga0501323_007909
919 Ga0501323_051645
920 Ga0501324_000153
921 Ga0501324_002993
922 Ga0501324_003211
923 Ga0501324_003902
924 Ga0501324_004891
925 Ga0501325_000006
926 Ga0501325_012344
927 Ga0501325_056130
928 Ga0501326_00045
929 Ga0501326_00113
930 Ga0501326_00177
931 Ga0501326_02651
932 Ga0501326_13868
933 Ga0501327_00035
934 Ga0501327_00389
935 Ga0501327_01957
936 Ga0501327_03203
937 Ga0501328_00014
938 Ga0501328_00064
939 Ga0501328_00270
940 Ga0501328_00940
941 Ga0501328_08228
942 Ga0501329_00157
943 Ga0501329_00304
944 Ga0501329_00684
945 Ga0501330_000139
946 Ga0501330_003198
947 Ga0501331_00073
948 Ga0501331_00179
949 Ga0501331_01395
950 Ga0501331_01778
951 Ga0501332_00490
952 Ga0501332_00546
953 Ga0501332_02078
954 Ga0501332_02832
955 Ga0501332_14030
956 Ga0501333_001637
957 Ga0501333_001872
958 Ga0501333_002894
959 Ga0501333_003008
960 Ga0501333_016748
961 Ga0501334_00014
962 Ga0501334_00634
963 Ga0501334_01174
964 Ga0501334_02083
965 Ga0501334_03876
966 Ga0501334_09586
967 Ga0501335_000116
968 Ga0501335_001159
969 Ga0501335_001571
970 Ga0501335_005235
971 Ga0501335_008105
972 Ga0501336_000332
973 Ga0501336_000875
974 Ga0501336_001822
975 Ga0501336_005798
976 Ga0501336_009033
977 Ga0501337_000050
978 Ga0501337_000210
979 Ga0501337_000952
980 Ga0501337_004275
981 Ga0501338_00355
982 Ga0501338_00393
983 Ga0501338_01217
984 Ga0501338_01413
985 Ga0501338_02524
986 Ga0501338_03097
987 Ga0501339_00013
988 Ga0501339_00086
989 Ga0501340_000004
990 Ga0501340_000079
991 Ga0501340_001704
992 Ga0501202_090762
993 Ga0501217_012762
994 Ga0501225_0121924
995 Ga0501212_064783
996 Ga0587067_189236
997 2511698004
998 2545559757
999 2555470885
1000 2578930714
1001 2595092272
1002 2600199447
1003 2600401649
1004 2631982460
1005 2644741863
1006 2651530325
1007 2674421120
1008 2686995327
1009 2687496576
1010 2695629924
1011 2717918177
1012 2738839005
1013 2739271693
1014 2740990509
1015 2757568907
1016 2777764208
1017 2777837283
1018 2809057183
1019 2812314466
1020 2817478192
1021 2819726065
1022 2823526419
1023 2857358451
1024 2857590955
1025 2857608868
1026 2857613421
1027 2860837583
1028 2877768802
1029 2880169744
1030 2897109771
1031 2904564593
1032 2908669316
1033 2919097074
1034 2919419356
1035 2919730769
1036 2928513045
1037 2936343060
1038 2954776077
1039 2962290794
1040 2969137001
1041 2969141170
1042 2969766250
1043 2969774918
1044 2971893531
1045 2977254692
1046 2980492745
1047 2990275695
1048 3006858520
1049 3006883632
1050 3006980025
1051 8022631637
1052 8022655881
1053 8051956514
1054 8052174990
1055 8054282866
1056 8057632289

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00237

Ribosomal_L22

Ribosomal protein L22p/L17e

23

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9847 1 110
6pvk-assembly1.cif.gz_S bacterial 45srbga ribosomal particle class a 0.9805 3 110
7nhn-assembly1.cif.gz_V vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9799 1 110
7nhk-assembly1.cif.gz_V lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis 0.9782 2 110
8c8z-assembly1.cif.gz_S cryo-em captures early ribosome assembly in action 0.9754 1 110
ID Description Score Start End Superfamily
af_P56795_7_145_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9839 2 109 3.90.470.10
4g5uS00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.971 1 113 3.90.470.10
5mmiT00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.965 2 110 3.90.470.10
af_P9WHC1_2_148_3.90.470.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.9642 2 112 3.90.470.10
5jvgP00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 0.962 4 113 3.90.470.10
ID Description Score Start End GO Terms
AF-Q6ME58-F1-model_v4 Large ribosomal subunit protein uL22 (50S ribosomal protein L22) 0.9927 1 110 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1Q5XPU4-F1-model_v4 Large ribosomal subunit protein uL22 0.9885 1 110 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A810E2E7-F1-model_v4 Large ribosomal subunit protein uL22 0.9883 1 110 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A1I0KXI5-F1-model_v4 Large ribosomal subunit protein uL22 0.9881 1 110 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-Q1WS95-F1-model_v4 Large ribosomal subunit protein uL22 (50S ribosomal protein L22) 0.9854 2 110 GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map