F459701
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 199 | 1056 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300038735|Ga0400485_08672|Ga0400485_08672_3333_3725 |
| Length | 130 |
| Sequence | VTRGQKLRDELKKKGLFVMEAKAVLKHVRISPQKVRKLVGAIKGNPLETALNTLKFMPQKSAAIVEKVVRSAASNAEENHNLDLDDLVIRNIIVDQGPTLKRFKARARGRGTRILKKTSHITVILAEESA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 11 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 12 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 13 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 15 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 16 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 17 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 18 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 19 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 20 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 28 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 29 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 30 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 31 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 32 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 33 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 34 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 35 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 36 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 37 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 38 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 39 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 40 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 41 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 44 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 45 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 46 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 47 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 48 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 49 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 50 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 51 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 52 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 53 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 54 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 55 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 56 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 57 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 58 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 59 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 60 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 61 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 62 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 63 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 64 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 65 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 80 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 81 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 82 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 83 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 84 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 85 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 86 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 87 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 88 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 89 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 90 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 91 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 92 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 105 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 136 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 137 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 138 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 139 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 141 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 142 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 143 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 144 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 145 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 146 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 147 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 148 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 149 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 150 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 151 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 152 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 153 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 154 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 155 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 156 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 157 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 158 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 159 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 160 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 161 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 162 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 163 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 164 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 165 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 166 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 167 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 168 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 169 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 170 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 171 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 172 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 173 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 174 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 175 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 176 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 177 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 178 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 179 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 180 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 181 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 182 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 183 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 184 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 185 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 186 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 187 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 188 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 189 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 190 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 191 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 192 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 193 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 194 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 195 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 196 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 197 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 198 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 199 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 35.61 |
| Metatranscriptomes | 53.03 |
| Isolates | 11.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.03 |
| Nodule | 0 |
| Rhizoplane | 4.55 |
| Rhizosphere | 80.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400485_08672 | 3300038735 | Bacteria | 18258 |
| 2 | JGI25151J46595_10000735 | 3300003187 | Bacteria | 26974 |
| 3 | JGI25151J46595_10012054 | 3300003187 | Bacteria | 3943 |
| 4 | JGI25151J46595_10036225 | 3300003187 | Bacteria | 1863 |
| 5 | JGI25151J46595_10060372 | 3300003187 | Bacteria | 1213 |
| 6 | Ga0006562J51391_1000677 | 3300003578 | Bacteria | 45519 |
| 7 | Ga0006562J51391_1002825 | 3300003578 | Bacteria | 13064 |
| 8 | Ga0055538_1000160 | 3300003751 | Bacteria | 44715 |
| 9 | Ga0055532_1000266 | 3300003758 | Bacteria | 34080 |
| 10 | Ga0055536_1003459 | 3300003781 | Bacteria | 8458 |
| 11 | Ga0058863_11363707 | 3300004799 | Bacteria | 986 |
| 12 | Ga0070711_100479857 | 3300005439 | Bacteria | 1022 |
| 13 | Ga0070712_101568234 | 3300006175 | Bacteria | 576 |
| 14 | Ga0105244_10012810 | 3300009036 | Bacteria | 4942 |
| 15 | Ga0105250_10187379 | 3300009092 | Bacteria | 870 |
| 16 | Ga0105250_10518546 | 3300009092 | Bacteria | 543 |
| 17 | Ga0114129_12053283 | 3300009147 | Bacteria | 690 |
| 18 | Ga0105248_11636698 | 3300009177 | Bacteria | 730 |
| 19 | Ga0206353_11437168 | 3300020082 | Bacteria | 1491 |
| 20 | Ga0209784_100044 | 3300025224 | Bacteria | 206858 |
| 21 | Ga0209147_100198 | 3300025229 | Bacteria | 67714 |
| 22 | Ga0209147_103236 | 3300025229 | Bacteria | 3305 |
| 23 | Ga0209130_1015250 | 3300025284 | Bacteria | 1900 |
| 24 | Ga0209676_1000745 | 3300025292 | Bacteria | 44098 |
| 25 | Ga0209676_1052171 | 3300025292 | Bacteria | 1068 |
| 26 | Ga0209025_1000639 | 3300025294 | Bacteria | 61845 |
| 27 | Ga0209025_1009107 | 3300025294 | Bacteria | 6991 |
| 28 | Ga0209025_1046751 | 3300025294 | Bacteria | 1776 |
| 29 | Ga0207663_10366822 | 3300025916 | Bacteria | 1094 |
| 30 | Ga0207644_10393324 | 3300025931 | Bacteria | 1132 |
| 31 | Ga0209969_1079114 | 3300027360 | Bacteria | 525 |
| 32 | Ga0209967_1033174 | 3300027364 | Bacteria | 776 |
| 33 | Ga0210000_1001373 | 3300027462 | Bacteria | 3430 |
| 34 | Ga0209970_1000914 | 3300027614 | Bacteria | 5205 |
| 35 | Ga0209971_1022190 | 3300027682 | Bacteria | 1511 |
| 36 | Ga0307408_100125708 | 3300031548 | Bacteria | 1994 |
| 37 | Ga0316575_10014577 | 3300031665 | Bacteria | 2953 |
| 38 | Ga0316575_10086985 | 3300031665 | Bacteria | 1263 |
| 39 | Ga0316575_10138549 | 3300031665 | Bacteria | 1000 |
| 40 | Ga0316575_10190521 | 3300031665 | Bacteria | 853 |
| 41 | Ga0316579_10226842 | 3300031691 | Bacteria | 903 |
| 42 | Ga0316579_10341644 | 3300031691 | Bacteria | 724 |
| 43 | Ga0316579_10368239 | 3300031691 | Bacteria | 695 |
| 44 | Ga0316576_10002450 | 3300031727 | Bacteria | 10558 |
| 45 | Ga0316576_10003583 | 3300031727 | Bacteria | 9149 |
| 46 | Ga0316576_10008020 | 3300031727 | Bacteria | 6696 |
| 47 | Ga0316576_10041668 | 3300031727 | Bacteria | 3307 |
| 48 | Ga0316576_10122358 | 3300031727 | Bacteria | 1955 |
| 49 | Ga0316576_10309782 | 3300031727 | Bacteria | 1179 |
| 50 | Ga0316576_10515711 | 3300031727 | Bacteria | 878 |
| 51 | Ga0316576_10553966 | 3300031727 | Bacteria | 842 |
| 52 | Ga0316576_10559621 | 3300031727 | Bacteria | 837 |
| 53 | Ga0316578_10000551 | 3300031728 | Bacteria | 12895 |
| 54 | Ga0316578_10007960 | 3300031728 | Bacteria | 5356 |
| 55 | Ga0316578_10007997 | 3300031728 | Bacteria | 5347 |
| 56 | Ga0316578_10030344 | 3300031728 | Bacteria | 3072 |
| 57 | Ga0316578_10042373 | 3300031728 | Bacteria | 2639 |
| 58 | Ga0316578_10067761 | 3300031728 | Bacteria | 2110 |
| 59 | Ga0316578_10102922 | 3300031728 | Bacteria | 1712 |
| 60 | Ga0316578_10126520 | 3300031728 | Bacteria | 1537 |
| 61 | Ga0316578_10453227 | 3300031728 | Bacteria | 758 |
| 62 | Ga0316577_10002746 | 3300031733 | Bacteria | 8764 |
| 63 | Ga0316577_10023848 | 3300031733 | Bacteria | 3397 |
| 64 | Ga0316577_10054965 | 3300031733 | Bacteria | 2222 |
| 65 | Ga0316577_10119833 | 3300031733 | Bacteria | 1478 |
| 66 | Ga0316577_10127257 | 3300031733 | Bacteria | 1433 |
| 67 | Ga0316577_10400099 | 3300031733 | Unclassified | 780 |
| 68 | Ga0316577_10402591 | 3300031733 | Bacteria | 777 |
| 69 | Ga0307412_10192496 | 3300031911 | Bacteria | 1543 |
| 70 | Ga0307409_100007174 | 3300031995 | Bacteria | 6641 |
| 71 | Ga0307409_102846143 | 3300031995 | Bacteria | 511 |
| 72 | Ga0307416_100170833 | 3300032002 | Bacteria | 2023 |
| 73 | Ga0307416_100710482 | 3300032002 | Bacteria | 1095 |
| 74 | Ga0307416_100940777 | 3300032002 | Bacteria | 966 |
| 75 | Ga0307416_101860606 | 3300032002 | Bacteria | 705 |
| 76 | Ga0316583_10001747 | 3300032133 | Bacteria | 7377 |
| 77 | Ga0316583_10010218 | 3300032133 | Bacteria | 3382 |
| 78 | Ga0316583_10014899 | 3300032133 | Bacteria | 2799 |
| 79 | Ga0316583_10074729 | 3300032133 | Bacteria | 1185 |
| 80 | Ga0316585_10100676 | 3300032137 | Bacteria | 948 |
| 81 | Ga0316580_10005751 | 3300032139 | Bacteria | 3635 |
| 82 | Ga0316593_10000043 | 3300032168 | Bacteria | 13880 |
| 83 | Ga0316593_10000056 | 3300032168 | Bacteria | 12817 |
| 84 | Ga0316593_10001768 | 3300032168 | Bacteria | 4909 |
| 85 | Ga0316593_10002618 | 3300032168 | Bacteria | 4311 |
| 86 | Ga0316593_10004750 | 3300032168 | Bacteria | 3519 |
| 87 | Ga0316593_10005892 | 3300032168 | Bacteria | 3272 |
| 88 | Ga0316593_10009459 | 3300032168 | Bacteria | 2753 |
| 89 | Ga0316593_10012318 | 3300032168 | Bacteria | 2508 |
| 90 | Ga0316593_10018804 | 3300032168 | Bacteria | 2128 |
| 91 | Ga0316593_10019872 | 3300032168 | Bacteria | 2080 |
| 92 | Ga0316593_10029429 | 3300032168 | Bacteria | 1777 |
| 93 | Ga0316593_10043482 | 3300032168 | Unclassified | 1501 |
| 94 | Ga0316593_10054157 | 3300032168 | Bacteria | 1361 |
| 95 | Ga0316593_10071492 | 3300032168 | Bacteria | 1200 |
| 96 | Ga0316593_10097432 | 3300032168 | Bacteria | 1040 |
| 97 | Ga0316593_10107573 | 3300032168 | Bacteria | 994 |
| 98 | Ga0316593_10135569 | 3300032168 | Bacteria | 890 |
| 99 | Ga0316593_10179498 | 3300032168 | Bacteria | 778 |
| 100 | Ga0316593_10183681 | 3300032168 | Bacteria | 769 |
| 101 | Ga0316593_10197779 | 3300032168 | Bacteria | 742 |
| 102 | Ga0316593_10268410 | 3300032168 | Bacteria | 641 |
| 103 | Ga0316593_10271789 | 3300032168 | Bacteria | 637 |
| 104 | Ga0316593_10379936 | 3300032168 | Bacteria | 544 |
| 105 | Ga0316592_1000035 | 3300033524 | Bacteria | 10782 |
| 106 | Ga0316592_1006430 | 3300033524 | Bacteria | 2263 |
| 107 | Ga0316592_1009914 | 3300033524 | Bacteria | 1913 |
| 108 | Ga0316592_1012784 | 3300033524 | Bacteria | 1725 |
| 109 | Ga0316592_1013391 | 3300033524 | Bacteria | 1690 |
| 110 | Ga0316592_1022026 | 3300033524 | Bacteria | 1360 |
| 111 | Ga0316592_1025209 | 3300033524 | Bacteria | 1282 |
| 112 | Ga0316592_1036895 | 3300033524 | Bacteria | 1075 |
| 113 | Ga0316592_1039859 | 3300033524 | Bacteria | 1038 |
| 114 | Ga0316592_1059180 | 3300033524 | Bacteria | 859 |
| 115 | Ga0316592_1062339 | 3300033524 | Bacteria | 838 |
| 116 | Ga0316592_1161986 | 3300033524 | Bacteria | 530 |
| 117 | Ga0316586_1032930 | 3300033527 | Bacteria | 893 |
| 118 | Ga0316586_1036605 | 3300033527 | Bacteria | 854 |
| 119 | Ga0316586_1123530 | 3300033527 | Unclassified | 506 |
| 120 | Ga0316588_1000152 | 3300033528 | Bacteria | 7568 |
| 121 | Ga0316588_1026017 | 3300033528 | Bacteria | 1354 |
| 122 | Ga0316588_1083812 | 3300033528 | Bacteria | 791 |
| 123 | Ga0316588_1097995 | 3300033528 | Bacteria | 733 |
| 124 | Ga0316587_1006788 | 3300033529 | Bacteria | 1761 |
| 125 | Ga0316587_1019590 | 3300033529 | Bacteria | 1145 |
| 126 | Ga0316596_1000039 | 3300033541 | Bacteria | 13805 |
| 127 | Ga0316596_1000061 | 3300033541 | Bacteria | 12225 |
| 128 | Ga0316596_1000254 | 3300033541 | Bacteria | 8213 |
| 129 | Ga0316596_1000437 | 3300033541 | Bacteria | 6945 |
| 130 | Ga0316596_1000458 | 3300033541 | Bacteria | 6838 |
| 131 | Ga0316596_1001363 | 3300033541 | Bacteria | 4886 |
| 132 | Ga0316596_1001478 | 3300033541 | Bacteria | 4757 |
| 133 | Ga0316596_1002150 | 3300033541 | Bacteria | 4167 |
| 134 | Ga0316596_1002948 | 3300033541 | Bacteria | 3690 |
| 135 | Ga0316596_1004397 | 3300033541 | Bacteria | 3157 |
| 136 | Ga0316596_1008803 | 3300033541 | Bacteria | 2413 |
| 137 | Ga0316596_1010272 | 3300033541 | Bacteria | 2262 |
| 138 | Ga0316596_1012101 | 3300033541 | Bacteria | 2118 |
| 139 | Ga0316596_1021887 | 3300033541 | Bacteria | 1631 |
| 140 | Ga0316596_1022381 | 3300033541 | Bacteria | 1615 |
| 141 | Ga0316596_1026563 | 3300033541 | Bacteria | 1492 |
| 142 | Ga0316596_1032765 | 3300033541 | Bacteria | 1353 |
| 143 | Ga0316596_1059854 | 3300033541 | Bacteria | 1015 |
| 144 | Ga0316596_1065010 | 3300033541 | Bacteria | 975 |
| 145 | Ga0316596_1076356 | 3300033541 | Bacteria | 899 |
| 146 | Ga0316596_1095623 | 3300033541 | Bacteria | 802 |
| 147 | Ga0316596_1101116 | 3300033541 | Bacteria | 780 |
| 148 | Ga0316596_1103976 | 3300033541 | Bacteria | 769 |
| 149 | Ga0316596_1107318 | 3300033541 | Bacteria | 757 |
| 150 | Ga0316596_1119501 | 3300033541 | Bacteria | 717 |
| 151 | Ga0316596_1134913 | 3300033541 | Bacteria | 675 |
| 152 | Ga0316596_1162341 | 3300033541 | Bacteria | 615 |
| 153 | Ga0316596_1217391 | 3300033541 | Bacteria | 534 |
| 154 | Ga0316596_1249077 | 3300033541 | Bacteria | 501 |
| 155 | Ga0316574_0001182 | 3300035398 | Bacteria | 12095 |
| 156 | Ga0316574_0012412 | 3300035398 | Bacteria | 4874 |
| 157 | Ga0316574_0013553 | 3300035398 | Bacteria | 4690 |
| 158 | Ga0316574_0080967 | 3300035398 | Bacteria | 2062 |
| 159 | Ga0316574_0281561 | 3300035398 | Bacteria | 1059 |
| 160 | Ga0316574_0352888 | 3300035398 | Bacteria | 930 |
| 161 | Ga0316582_0000535 | 3300036647 | Bacteria | 14503 |
| 162 | Ga0316582_0003224 | 3300036647 | Bacteria | 7940 |
| 163 | Ga0316582_0011702 | 3300036647 | Bacteria | 4863 |
| 164 | Ga0316582_0300986 | 3300036647 | Bacteria | 1102 |
| 165 | Ga0316582_0674490 | 3300036647 | Bacteria | 710 |
| 166 | Ga0316584_0004587 | 3300036712 | Bacteria | 9157 |
| 167 | Ga0316584_0009686 | 3300036712 | Bacteria | 6700 |
| 168 | Ga0316584_0009934 | 3300036712 | Bacteria | 6629 |
| 169 | Ga0316584_0026734 | 3300036712 | Bacteria | 4244 |
| 170 | Ga0316584_0091701 | 3300036712 | Bacteria | 2275 |
| 171 | Ga0316584_0092561 | 3300036712 | Bacteria | 2263 |
| 172 | Ga0316584_0111354 | 3300036712 | Bacteria | 2048 |
| 173 | Ga0316584_0230198 | 3300036712 | Bacteria | 1359 |
| 174 | Ga0316584_0272749 | 3300036712 | Bacteria | 1231 |
| 175 | Ga0316584_0273989 | 3300036712 | Bacteria | 1228 |
| 176 | Ga0316584_0338004 | 3300036712 | Bacteria | 1083 |
| 177 | Ga0316584_0374800 | 3300036712 | Bacteria | 1018 |
| 178 | Ga0316584_0886525 | 3300036712 | Bacteria | 601 |
| 179 | Ga0395900_0168524 | 3300037418 | Bacteria | 2231 |
| 180 | Ga0395900_1436329 | 3300037418 | Bacteria | 603 |
| 181 | Ga0395898_0428885 | 3300037466 | Bacteria | 1260 |
| 182 | Ga0395898_1319504 | 3300037466 | Bacteria | 651 |
| 183 | Ga0316581_0007723 | 3300037588 | Bacteria | 2899 |
| 184 | Ga0316581_0160042 | 3300037588 | Bacteria | 694 |
| 185 | Ga0316581_0237357 | 3300037588 | Bacteria | 560 |
| 186 | Ga0395901_1895418 | 3300038443 | Bacteria | 544 |
| 187 | Ga0400484_20003 | 3300038725 | Bacteria | 3915 |
| 188 | Ga0400484_27667 | 3300038725 | Bacteria | 4271 |
| 189 | Ga0400484_37672 | 3300038725 | Bacteria | 9379 |
| 190 | Ga0400490_03324 | 3300038726 | Bacteria | 2467 |
| 191 | Ga0400490_05180 | 3300038726 | Bacteria | 2956 |
| 192 | Ga0400490_26141 | 3300038726 | Bacteria | 1000 |
| 193 | Ga0400491_13944 | 3300038727 | Bacteria | 2738 |
| 194 | Ga0400485_08047 | 3300038735 | Bacteria | 20055 |
| 195 | Ga0400485_10318 | 3300038735 | Bacteria | 2434 |
| 196 | Ga0400488_00038 | 3300038741 | Bacteria | 1719 |
| 197 | Ga0400488_03335 | 3300038741 | Bacteria | 7283 |
| 198 | Ga0400488_57235 | 3300038741 | Bacteria | 4135 |
| 199 | Ga0400486_17114 | 3300038742 | Bacteria | 18189 |
| 200 | Ga0400486_17728 | 3300038742 | Bacteria | 12468 |
| 201 | Ga0400486_21368 | 3300038742 | Bacteria | 5998 |
| 202 | Ga0400486_33075 | 3300038742 | Bacteria | 8482 |
| 203 | Ga0400483_001312 | 3300039062 | Bacteria | 1379 |
| 204 | Ga0400483_012769 | 3300039062 | Bacteria | 1147 |
| 205 | Ga0400483_120099 | 3300039062 | Bacteria | 48943 |
| 206 | Ga0400483_221082 | 3300039062 | Bacteria | 3310 |
| 207 | Ga0400483_228134 | 3300039062 | Bacteria | 119181 |
| 208 | Ga0400483_251558 | 3300039062 | Bacteria | 1588 |
| 209 | Ga0400483_265905 | 3300039062 | Bacteria | 3120 |
| 210 | Ga0400489_23715 | 3300039093 | Bacteria | 15377 |
| 211 | Ga0400489_59643 | 3300039093 | Bacteria | 25982 |
| 212 | Ga0400489_66216 | 3300039093 | Bacteria | 19270 |
| 213 | Ga0400489_74615 | 3300039093 | Bacteria | 23866 |
| 214 | Ga0400489_76217 | 3300039093 | Bacteria | 1176 |
| 215 | Ga0400489_86209 | 3300039093 | Bacteria | 8537 |
| 216 | Ga0400487_33846 | 3300039110 | Bacteria | 3869 |
| 217 | Ga0400487_55496 | 3300039110 | Bacteria | 6673 |
| 218 | Ga0451789_0260892 | 3300041443 | Bacteria | 838 |
| 219 | Ga0451577_0244654 | 3300042876 | Bacteria | 1623 |
| 220 | Ga0453684_0408481 | 3300044712 | Bacteria | 1519 |
| 221 | Ga0466957_0269967 | 3300044842 | Bacteria | 1136 |
| 222 | Ga0451576_0004083 | 3300045051 | Bacteria | 19291 |
| 223 | Ga0495590_0042229 | 3300046457 | Bacteria | 1590 |
| 224 | Ga0495605_0075252 | 3300046474 | Bacteria | 1588 |
| 225 | Ga0495584_0703913 | 3300046491 | Bacteria | 515 |
| 226 | Ga0495654_0251932 | 3300046530 | Bacteria | 735 |
| 227 | Ga0495597_0372709 | 3300046542 | Bacteria | 545 |
| 228 | Ga0495633_0065769 | 3300046558 | Bacteria | 1694 |
| 229 | Ga0495661_0085148 | 3300046665 | Bacteria | 1812 |
| 230 | Ga0495661_0247133 | 3300046665 | Bacteria | 912 |
| 231 | Ga0495657_0667183 | 3300046675 | Bacteria | 599 |
| 232 | Ga0495670_0045580 | 3300046691 | Bacteria | 2189 |
| 233 | Ga0495670_0306785 | 3300046691 | Bacteria | 851 |
| 234 | Ga0495660_0004825 | 3300046810 | Bacteria | 8134 |
| 235 | Ga0495672_0407259 | 3300047320 | Bacteria | 621 |
| 236 | Ga0495676_0133814 | 3300047321 | Bacteria | 1786 |
| 237 | Ga0495680_0347683 | 3300047322 | Bacteria | 1033 |
| 238 | Ga0495684_0700380 | 3300047471 | Bacteria | 672 |
| 239 | Ga0496100_0679634 | 3300048903 | Bacteria | 803 |
| 240 | Ga0496101_0038405 | 3300048904 | Bacteria | 3401 |
| 241 | Ga0496102_0011196 | 3300048905 | Bacteria | 7725 |
| 242 | Ga0496102_0099351 | 3300048905 | Bacteria | 2701 |
| 243 | Ga0496102_0629539 | 3300048905 | Bacteria | 996 |
| 244 | Ga0496103_0047911 | 3300048906 | Bacteria | 2641 |
| 245 | Ga0496103_0276565 | 3300048906 | Bacteria | 1080 |
| 246 | Ga0496103_0478435 | 3300048906 | Bacteria | 798 |
| 247 | Ga0496104_0348085 | 3300048907 | Bacteria | 1395 |
| 248 | Ga0496104_0353513 | 3300048907 | Bacteria | 1382 |
| 249 | Ga0496108_1201168 | 3300048911 | Bacteria | 641 |
| 250 | Ga0496109_0087437 | 3300048912 | Bacteria | 2879 |
| 251 | Ga0496110_0003743 | 3300048913 | Bacteria | 11715 |
| 252 | Ga0496110_0311758 | 3300048913 | Bacteria | 1433 |
| 253 | Ga0496110_1272718 | 3300048913 | Bacteria | 645 |
| 254 | Ga0496111_0005358 | 3300048914 | Bacteria | 8202 |
| 255 | Ga0496111_1138120 | 3300048914 | Bacteria | 555 |
| 256 | Ga0496112_0264091 | 3300048915 | Bacteria | 1670 |
| 257 | Ga0496112_1425031 | 3300048915 | Bacteria | 607 |
| 258 | Ga0496113_0413632 | 3300048916 | Bacteria | 1083 |
| 259 | Ga0496122_0199829 | 3300048925 | Bacteria | 1170 |
| 260 | Ga0496126_0078001 | 3300048929 | Bacteria | 2936 |
| 261 | Ga0501306_000030 | 3300049127 | Bacteria | 8097 |
| 262 | Ga0501306_000138 | 3300049127 | Bacteria | 4465 |
| 263 | Ga0501306_000285 | 3300049127 | Bacteria | 3614 |
| 264 | Ga0501306_003694 | 3300049127 | Bacteria | 1665 |
| 265 | Ga0501306_004132 | 3300049127 | Bacteria | 1609 |
| 266 | Ga0501308_000106 | 3300049128 | Bacteria | 3961 |
| 267 | Ga0501308_000127 | 3300049128 | Bacteria | 3778 |
| 268 | Ga0501308_003239 | 3300049128 | Bacteria | 1495 |
| 269 | Ga0501309_003421 | 3300049129 | Bacteria | 1795 |
| 270 | Ga0501309_020491 | 3300049129 | Bacteria | 926 |
| 271 | Ga0501309_053604 | 3300049129 | Bacteria | 637 |
| 272 | Ga0501310_000940 | 3300049130 | Bacteria | 2590 |
| 273 | Ga0501310_009955 | 3300049130 | Bacteria | 1054 |
| 274 | Ga0501341_00024 | 3300049131 | Bacteria | 4362 |
| 275 | Ga0501341_00074 | 3300049131 | Bacteria | 2990 |
| 276 | Ga0501341_00193 | 3300049131 | Bacteria | 2190 |
| 277 | Ga0501341_00222 | 3300049131 | Bacteria | 2112 |
| 278 | Ga0501341_02017 | 3300049131 | Bacteria | 1068 |
| 279 | Ga0501341_02439 | 3300049131 | Bacteria | 1005 |
| 280 | Ga0501341_03220 | 3300049131 | Bacteria | 915 |
| 281 | Ga0501341_14051 | 3300049131 | Bacteria | 554 |
| 282 | Ga0501343_000392 | 3300049132 | Bacteria | 2500 |
| 283 | Ga0501343_001442 | 3300049132 | Bacteria | 1615 |
| 284 | Ga0501343_002494 | 3300049132 | Bacteria | 1312 |
| 285 | Ga0501343_002627 | 3300049132 | Bacteria | 1289 |
| 286 | Ga0501343_003186 | 3300049132 | Bacteria | 1197 |
| 287 | Ga0501343_008110 | 3300049132 | Bacteria | 836 |
| 288 | Ga0501343_008265 | 3300049132 | Bacteria | 830 |
| 289 | Ga0501344_00011 | 3300049133 | Bacteria | 4536 |
| 290 | Ga0501344_00060 | 3300049133 | Bacteria | 3139 |
| 291 | Ga0501344_00166 | 3300049133 | Bacteria | 2343 |
| 292 | Ga0501344_11047 | 3300049133 | Bacteria | 557 |
| 293 | Ga0501344_11091 | 3300049133 | Bacteria | 556 |
| 294 | Ga0501345_00004 | 3300049134 | Bacteria | 5201 |
| 295 | Ga0501345_00405 | 3300049134 | Bacteria | 1424 |
| 296 | Ga0501304_000046 | 3300049160 | Bacteria | 4246 |
| 297 | Ga0501304_002674 | 3300049160 | Bacteria | 1256 |
| 298 | Ga0501304_006007 | 3300049160 | Bacteria | 968 |
| 299 | Ga0501304_006207 | 3300049160 | Bacteria | 958 |
| 300 | Ga0501305_000007 | 3300049161 | Bacteria | 11997 |
| 301 | Ga0501305_000048 | 3300049161 | Bacteria | 6708 |
| 302 | Ga0501305_002503 | 3300049161 | Bacteria | 1992 |
| 303 | Ga0501305_002856 | 3300049161 | Bacteria | 1906 |
| 304 | Ga0501305_003944 | 3300049161 | Bacteria | 1714 |
| 305 | Ga0501305_008928 | 3300049161 | Bacteria | 1307 |
| 306 | Ga0501305_009687 | 3300049161 | Bacteria | 1272 |
| 307 | Ga0501305_055142 | 3300049161 | Bacteria | 674 |
| 308 | Ga0501307_000011 | 3300049162 | Bacteria | 6472 |
| 309 | Ga0501307_000155 | 3300049162 | Bacteria | 3645 |
| 310 | Ga0501307_008353 | 3300049162 | Bacteria | 1161 |
| 311 | Ga0501307_014662 | 3300049162 | Bacteria | 961 |
| 312 | Ga0501307_051525 | 3300049162 | Bacteria | 620 |
| 313 | Ga0501342_00056 | 3300049163 | Bacteria | 2311 |
| 314 | Ga0501342_00181 | 3300049163 | Bacteria | 1522 |
| 315 | Ga0501342_01190 | 3300049163 | Bacteria | 800 |
| 316 | Ga0501290_096348 | 3300049513 | Bacteria | 521 |
| 317 | Ga0501311_000009 | 3300049527 | Bacteria | 8275 |
| 318 | Ga0501311_000124 | 3300049527 | Bacteria | 3927 |
| 319 | Ga0501311_000152 | 3300049527 | Bacteria | 3775 |
| 320 | Ga0501311_005953 | 3300049527 | Bacteria | 1357 |
| 321 | Ga0501311_008221 | 3300049527 | Bacteria | 1218 |
| 322 | Ga0501311_020732 | 3300049527 | Bacteria | 891 |
| 323 | Ga0501312_000002 | 3300049528 | Bacteria | 17365 |
| 324 | Ga0501312_000051 | 3300049528 | Bacteria | 7173 |
| 325 | Ga0501312_000171 | 3300049528 | Bacteria | 4337 |
| 326 | Ga0501312_000739 | 3300049528 | Bacteria | 2829 |
| 327 | Ga0501312_007190 | 3300049528 | Bacteria | 1412 |
| 328 | Ga0501312_028693 | 3300049528 | Bacteria | 864 |
| 329 | Ga0501313_000003 | 3300049529 | Bacteria | 10446 |
| 330 | Ga0501313_000081 | 3300049529 | Bacteria | 4439 |
| 331 | Ga0501313_000360 | 3300049529 | Bacteria | 2976 |
| 332 | Ga0501313_000781 | 3300049529 | Bacteria | 2416 |
| 333 | Ga0501313_002469 | 3300049529 | Bacteria | 1755 |
| 334 | Ga0501313_034153 | 3300049529 | Bacteria | 668 |
| 335 | Ga0501313_054732 | 3300049529 | Bacteria | 557 |
| 336 | Ga0501314_000773 | 3300049530 | Bacteria | 2110 |
| 337 | Ga0501314_000797 | 3300049530 | Bacteria | 2088 |
| 338 | Ga0501314_002612 | 3300049530 | Bacteria | 1405 |
| 339 | Ga0501314_005241 | 3300049530 | Bacteria | 1099 |
| 340 | Ga0501315_000006 | 3300049531 | Bacteria | 10500 |
| 341 | Ga0501315_000072 | 3300049531 | Bacteria | 4669 |
| 342 | Ga0501315_000123 | 3300049531 | Bacteria | 4189 |
| 343 | Ga0501315_001506 | 3300049531 | Bacteria | 2018 |
| 344 | Ga0501315_010592 | 3300049531 | Bacteria | 1111 |
| 345 | Ga0501315_013630 | 3300049531 | Bacteria | 1020 |
| 346 | Ga0501315_063675 | 3300049531 | Bacteria | 600 |
| 347 | Ga0501315_104606 | 3300049531 | Bacteria | 503 |
| 348 | Ga0501316_000137 | 3300049532 | Bacteria | 3921 |
| 349 | Ga0501316_000153 | 3300049532 | Bacteria | 3769 |
| 350 | Ga0501316_000268 | 3300049532 | Bacteria | 3268 |
| 351 | Ga0501316_002234 | 3300049532 | Bacteria | 1771 |
| 352 | Ga0501316_002272 | 3300049532 | Bacteria | 1762 |
| 353 | Ga0501316_008645 | 3300049532 | Bacteria | 1128 |
| 354 | Ga0501317_000414 | 3300049533 | Bacteria | 2936 |
| 355 | Ga0501317_000563 | 3300049533 | Bacteria | 2711 |
| 356 | Ga0501317_001025 | 3300049533 | Bacteria | 2270 |
| 357 | Ga0501317_006422 | 3300049533 | Bacteria | 1293 |
| 358 | Ga0501317_010097 | 3300049533 | Bacteria | 1122 |
| 359 | Ga0501317_031788 | 3300049533 | Bacteria | 770 |
| 360 | Ga0501318_000003 | 3300049534 | Bacteria | 10033 |
| 361 | Ga0501318_006139 | 3300049534 | Bacteria | 1218 |
| 362 | Ga0501318_008046 | 3300049534 | Bacteria | 1117 |
| 363 | Ga0501318_008247 | 3300049534 | Bacteria | 1109 |
| 364 | Ga0501318_010585 | 3300049534 | Bacteria | 1026 |
| 365 | Ga0501318_017200 | 3300049534 | Bacteria | 881 |
| 366 | Ga0501318_039571 | 3300049534 | Bacteria | 670 |
| 367 | Ga0501319_000003 | 3300049535 | Bacteria | 10442 |
| 368 | Ga0501319_000047 | 3300049535 | Bacteria | 3949 |
| 369 | Ga0501319_000238 | 3300049535 | Bacteria | 2328 |
| 370 | Ga0501320_000070 | 3300049536 | Bacteria | 4546 |
| 371 | Ga0501320_000079 | 3300049536 | Bacteria | 4310 |
| 372 | Ga0501320_005312 | 3300049536 | Bacteria | 1169 |
| 373 | Ga0501320_013920 | 3300049536 | Bacteria | 864 |
| 374 | Ga0501320_022962 | 3300049536 | Bacteria | 735 |
| 375 | Ga0501320_028615 | 3300049536 | Bacteria | 683 |
| 376 | Ga0501321_000002 | 3300049537 | Bacteria | 13305 |
| 377 | Ga0501321_000088 | 3300049537 | Bacteria | 4285 |
| 378 | Ga0501321_000089 | 3300049537 | Bacteria | 4280 |
| 379 | Ga0501321_009872 | 3300049537 | Bacteria | 1038 |
| 380 | Ga0501321_018443 | 3300049537 | Bacteria | 847 |
| 381 | Ga0501321_025183 | 3300049537 | Bacteria | 766 |
| 382 | Ga0501321_083253 | 3300049537 | Bacteria | 513 |
| 383 | Ga0501322_000335 | 3300049538 | Bacteria | 2117 |
| 384 | Ga0501322_000404 | 3300049538 | Bacteria | 1996 |
| 385 | Ga0501322_004788 | 3300049538 | Bacteria | 921 |
| 386 | Ga0501322_008588 | 3300049538 | Bacteria | 761 |
| 387 | Ga0501323_000116 | 3300049539 | Bacteria | 4416 |
| 388 | Ga0501323_000308 | 3300049539 | Bacteria | 3416 |
| 389 | Ga0501323_002710 | 3300049539 | Bacteria | 1745 |
| 390 | Ga0501323_007909 | 3300049539 | Bacteria | 1224 |
| 391 | Ga0501323_051645 | 3300049539 | Bacteria | 625 |
| 392 | Ga0501324_000153 | 3300049540 | Bacteria | 3001 |
| 393 | Ga0501324_002993 | 3300049540 | Bacteria | 1268 |
| 394 | Ga0501324_003211 | 3300049540 | Bacteria | 1241 |
| 395 | Ga0501324_003902 | 3300049540 | Bacteria | 1165 |
| 396 | Ga0501324_004891 | 3300049540 | Bacteria | 1084 |
| 397 | Ga0501325_000006 | 3300049541 | Bacteria | 7014 |
| 398 | Ga0501325_012344 | 3300049541 | Bacteria | 803 |
| 399 | Ga0501325_056130 | 3300049541 | Bacteria | 511 |
| 400 | Ga0501326_00045 | 3300049542 | Bacteria | 3869 |
| 401 | Ga0501326_00113 | 3300049542 | Bacteria | 2596 |
| 402 | Ga0501326_00177 | 3300049542 | Bacteria | 2247 |
| 403 | Ga0501326_02651 | 3300049542 | Bacteria | 889 |
| 404 | Ga0501326_13868 | 3300049542 | Bacteria | 505 |
| 405 | Ga0501327_00035 | 3300049543 | Bacteria | 4032 |
| 406 | Ga0501327_00389 | 3300049543 | Bacteria | 1710 |
| 407 | Ga0501327_01957 | 3300049543 | Bacteria | 1036 |
| 408 | Ga0501327_03203 | 3300049543 | Bacteria | 888 |
| 409 | Ga0501328_00014 | 3300049544 | Bacteria | 4034 |
| 410 | Ga0501328_00064 | 3300049544 | Bacteria | 2493 |
| 411 | Ga0501328_00270 | 3300049544 | Bacteria | 1610 |
| 412 | Ga0501328_00940 | 3300049544 | Bacteria | 1085 |
| 413 | Ga0501328_08228 | 3300049544 | Bacteria | 564 |
| 414 | Ga0501329_00157 | 3300049545 | Bacteria | 1886 |
| 415 | Ga0501329_00304 | 3300049545 | Bacteria | 1600 |
| 416 | Ga0501329_00684 | 3300049545 | Bacteria | 1287 |
| 417 | Ga0501330_000139 | 3300049546 | Bacteria | 2405 |
| 418 | Ga0501330_003198 | 3300049546 | Bacteria | 964 |
| 419 | Ga0501331_00073 | 3300049547 | Bacteria | 2981 |
| 420 | Ga0501331_00179 | 3300049547 | Bacteria | 2269 |
| 421 | Ga0501331_01395 | 3300049547 | Bacteria | 1169 |
| 422 | Ga0501331_01778 | 3300049547 | Bacteria | 1083 |
| 423 | Ga0501332_00490 | 3300049548 | Bacteria | 1741 |
| 424 | Ga0501332_00546 | 3300049548 | Bacteria | 1688 |
| 425 | Ga0501332_02078 | 3300049548 | Bacteria | 1099 |
| 426 | Ga0501332_02832 | 3300049548 | Bacteria | 985 |
| 427 | Ga0501332_14030 | 3300049548 | Bacteria | 562 |
| 428 | Ga0501333_001637 | 3300049549 | Bacteria | 1237 |
| 429 | Ga0501333_001872 | 3300049549 | Bacteria | 1185 |
| 430 | Ga0501333_002894 | 3300049549 | Bacteria | 1028 |
| 431 | Ga0501333_003008 | 3300049549 | Bacteria | 1013 |
| 432 | Ga0501333_016748 | 3300049549 | Bacteria | 563 |
| 433 | Ga0501334_00014 | 3300049550 | Bacteria | 5746 |
| 434 | Ga0501334_00634 | 3300049550 | Bacteria | 1695 |
| 435 | Ga0501334_01174 | 3300049550 | Bacteria | 1404 |
| 436 | Ga0501334_02083 | 3300049550 | Bacteria | 1164 |
| 437 | Ga0501334_03876 | 3300049550 | Bacteria | 941 |
| 438 | Ga0501334_09586 | 3300049550 | Bacteria | 691 |
| 439 | Ga0501335_000116 | 3300049551 | Bacteria | 3814 |
| 440 | Ga0501335_001159 | 3300049551 | Bacteria | 1968 |
| 441 | Ga0501335_001571 | 3300049551 | Bacteria | 1766 |
| 442 | Ga0501335_005235 | 3300049551 | Bacteria | 1154 |
| 443 | Ga0501335_008105 | 3300049551 | Bacteria | 982 |
| 444 | Ga0501336_000332 | 3300049552 | Bacteria | 2220 |
| 445 | Ga0501336_000875 | 3300049552 | Bacteria | 1664 |
| 446 | Ga0501336_001822 | 3300049552 | Bacteria | 1318 |
| 447 | Ga0501336_005798 | 3300049552 | Bacteria | 903 |
| 448 | Ga0501336_009033 | 3300049552 | Bacteria | 780 |
| 449 | Ga0501337_000050 | 3300049553 | Bacteria | 4082 |
| 450 | Ga0501337_000210 | 3300049553 | Bacteria | 2561 |
| 451 | Ga0501337_000952 | 3300049553 | Bacteria | 1571 |
| 452 | Ga0501337_004275 | 3300049553 | Bacteria | 929 |
| 453 | Ga0501338_00355 | 3300049554 | Bacteria | 1984 |
| 454 | Ga0501338_00393 | 3300049554 | Bacteria | 1919 |
| 455 | Ga0501338_01217 | 3300049554 | Bacteria | 1343 |
| 456 | Ga0501338_01413 | 3300049554 | Bacteria | 1280 |
| 457 | Ga0501338_02524 | 3300049554 | Bacteria | 1046 |
| 458 | Ga0501338_03097 | 3300049554 | Bacteria | 971 |
| 459 | Ga0501339_00013 | 3300049555 | Bacteria | 2208 |
| 460 | Ga0501339_00086 | 3300049555 | Bacteria | 1322 |
| 461 | Ga0501340_000004 | 3300049556 | Bacteria | 7126 |
| 462 | Ga0501340_000079 | 3300049556 | Bacteria | 2964 |
| 463 | Ga0501340_001704 | 3300049556 | Bacteria | 1216 |
| 464 | Ga0501202_090762 | 3300049652 | Bacteria | 731 |
| 465 | Ga0501217_012762 | 3300049661 | Bacteria | 1876 |
| 466 | Ga0501225_0121924 | 3300049705 | Bacteria | 775 |
| 467 | Ga0501212_064783 | 3300049851 | Bacteria | 638 |
| 468 | Ga0587067_189236 | 3300059640 | Bacteria | 541 |
| 469 | 2511698004 | 2511231119 | Bacteria | 4019861 |
| 470 | 2545559757 | 2545555800 | Bacteria | 4222588 |
| 471 | 2555470885 | 2554235283 | Bacteria | 3683090 |
| 472 | 2578930714 | 2576861599 | Bacteria | 4217202 |
| 473 | 2595092272 | 2593339131 | Bacteria | 5116855 |
| 474 | 2600199447 | 2599185353 | Bacteria | 2219443 |
| 475 | 2600401649 | 2600254943 | Bacteria | 2613887 |
| 476 | 2631982460 | 2630968484 | Bacteria | 3876276 |
| 477 | 2644741863 | 2643221735 | Bacteria | 3676263 |
| 478 | 2651530325 | 2648501850 | Bacteria | 3975476 |
| 479 | 2674421120 | 2671180844 | Bacteria | 4164150 |
| 480 | 2686995327 | 2684623153 | Bacteria | 3878815 |
| 481 | 2687496576 | 2687453109 | Bacteria | 3860091 |
| 482 | 2695629924 | 2695420354 | Bacteria | 3922431 |
| 483 | 2717918177 | 2716884898 | Bacteria | 3928789 |
| 484 | 2738839005 | 2738541299 | Bacteria | 4020721 |
| 485 | 2739271693 | 2738543017 | Bacteria | 4271950 |
| 486 | 2740990509 | 2740891818 | Bacteria | 6711283 |
| 487 | 2757568907 | 2757320391 | Bacteria | 4746095 |
| 488 | 2777764208 | 2775507177 | Bacteria | 4384303 |
| 489 | 2777837283 | 2775507192 | Bacteria | 4622234 |
| 490 | 2809057183 | 2808606399 | Bacteria | 4021018 |
| 491 | 2812314466 | 2811994870 | Bacteria | 3776934 |
| 492 | 2817478192 | 2816332295 | Bacteria | 4352468 |
| 493 | 2819726065 | 2818991468 | Bacteria | 3723169 |
| 494 | 2823526419 | 2823526263 | Bacteria | 3765752 |
| 495 | 2857358451 | 2857357740 | Bacteria | 9937880 |
| 496 | 2857590955 | 2857586860 | Bacteria | 4354574 |
| 497 | 2857608868 | 2857604169 | Bacteria | 5111450 |
| 498 | 2857613421 | 2857609550 | Bacteria | 3753890 |
| 499 | 2860837583 | 2860837431 | Bacteria | 4202080 |
| 500 | 2877768802 | 2877768649 | Bacteria | 3957164 |
| 501 | 2880169744 | 2880169592 | Bacteria | 3900066 |
| 502 | 2897109771 | 2897109615 | Bacteria | 4009619 |
| 503 | 2904564593 | 2904560550 | Bacteria | 4029838 |
| 504 | 2908669316 | 2908665501 | Bacteria | 3678115 |
| 505 | 2919097074 | 2919093281 | Bacteria | 3660974 |
| 506 | 2919419356 | 2919414237 | Bacteria | 5429133 |
| 507 | 2919730769 | 2919726948 | Bacteria | 3696050 |
| 508 | 2928513045 | 2928510474 | Bacteria | 4815308 |
| 509 | 2936343060 | 2936340661 | Bacteria | 5139038 |
| 510 | 2954776077 | 2954773129 | Bacteria | 3741715 |
| 511 | 2962290794 | 2962290636 | Bacteria | 4072939 |
| 512 | 2969137001 | 2969136845 | Bacteria | 3923176 |
| 513 | 2969141170 | 2969141011 | Bacteria | 4118468 |
| 514 | 2969766250 | 2969765954 | Bacteria | 4216713 |
| 515 | 2969774918 | 2969770375 | Bacteria | 4271280 |
| 516 | 2971893531 | 2971893375 | Bacteria | 3929648 |
| 517 | 2977254692 | 2977254563 | Bacteria | 4828420 |
| 518 | 2980492745 | 2980492589 | Bacteria | 4072961 |
| 519 | 2990275695 | 2990275345 | Bacteria | 4887158 |
| 520 | 3006858520 | 3006858327 | Bacteria | 4317835 |
| 521 | 3006883632 | 3006879489 | Bacteria | 4064221 |
| 522 | 3006980025 | 3006978542 | Bacteria | 5328100 |
| 523 | 8022631637 | 8022630665 | Bacteria | 3886130 |
| 524 | 8022655881 | 8022653035 | Bacteria | 4035078 |
| 525 | 8051956514 | 8051952484 | Bacteria | 3926774 |
| 526 | 8052174990 | 8052174270 | Bacteria | 3881265 |
| 527 | 8054282866 | 8054280661 | Bacteria | 4232245 |
| 528 | 8057632289 | 8057632132 | Bacteria | 4726859 |
| 529 | Ga0400485_08672 | |||
| 530 | JGI25151J46595_10000735 | |||
| 531 | JGI25151J46595_10012054 | |||
| 532 | JGI25151J46595_10036225 | |||
| 533 | JGI25151J46595_10060372 | |||
| 534 | Ga0006562J51391_1000677 | |||
| 535 | Ga0006562J51391_1002825 | |||
| 536 | Ga0055538_1000160 | |||
| 537 | Ga0055532_1000266 | |||
| 538 | Ga0055536_1003459 | |||
| 539 | Ga0058863_11363707 | |||
| 540 | Ga0070711_100479857 | |||
| 541 | Ga0070712_101568234 | |||
| 542 | Ga0105244_10012810 | |||
| 543 | Ga0105250_10187379 | |||
| 544 | Ga0105250_10518546 | |||
| 545 | Ga0114129_12053283 | |||
| 546 | Ga0105248_11636698 | |||
| 547 | Ga0206353_11437168 | |||
| 548 | Ga0209784_100044 | |||
| 549 | Ga0209147_100198 | |||
| 550 | Ga0209147_103236 | |||
| 551 | Ga0209130_1015250 | |||
| 552 | Ga0209676_1000745 | |||
| 553 | Ga0209676_1052171 | |||
| 554 | Ga0209025_1000639 | |||
| 555 | Ga0209025_1009107 | |||
| 556 | Ga0209025_1046751 | |||
| 557 | Ga0207663_10366822 | |||
| 558 | Ga0207644_10393324 | |||
| 559 | Ga0209969_1079114 | |||
| 560 | Ga0209967_1033174 | |||
| 561 | Ga0210000_1001373 | |||
| 562 | Ga0209970_1000914 | |||
| 563 | Ga0209971_1022190 | |||
| 564 | Ga0307408_100125708 | |||
| 565 | Ga0316575_10014577 | |||
| 566 | Ga0316575_10086985 | |||
| 567 | Ga0316575_10138549 | |||
| 568 | Ga0316575_10190521 | |||
| 569 | Ga0316579_10226842 | |||
| 570 | Ga0316579_10341644 | |||
| 571 | Ga0316579_10368239 | |||
| 572 | Ga0316576_10002450 | |||
| 573 | Ga0316576_10003583 | |||
| 574 | Ga0316576_10008020 | |||
| 575 | Ga0316576_10041668 | |||
| 576 | Ga0316576_10122358 | |||
| 577 | Ga0316576_10309782 | |||
| 578 | Ga0316576_10515711 | |||
| 579 | Ga0316576_10553966 | |||
| 580 | Ga0316576_10559621 | |||
| 581 | Ga0316578_10000551 | |||
| 582 | Ga0316578_10007960 | |||
| 583 | Ga0316578_10007997 | |||
| 584 | Ga0316578_10030344 | |||
| 585 | Ga0316578_10042373 | |||
| 586 | Ga0316578_10067761 | |||
| 587 | Ga0316578_10102922 | |||
| 588 | Ga0316578_10126520 | |||
| 589 | Ga0316578_10453227 | |||
| 590 | Ga0316577_10002746 | |||
| 591 | Ga0316577_10023848 | |||
| 592 | Ga0316577_10054965 | |||
| 593 | Ga0316577_10119833 | |||
| 594 | Ga0316577_10127257 | |||
| 595 | Ga0316577_10400099 | |||
| 596 | Ga0316577_10402591 | |||
| 597 | Ga0307412_10192496 | |||
| 598 | Ga0307409_100007174 | |||
| 599 | Ga0307409_102846143 | |||
| 600 | Ga0307416_100170833 | |||
| 601 | Ga0307416_100710482 | |||
| 602 | Ga0307416_100940777 | |||
| 603 | Ga0307416_101860606 | |||
| 604 | Ga0316583_10001747 | |||
| 605 | Ga0316583_10010218 | |||
| 606 | Ga0316583_10014899 | |||
| 607 | Ga0316583_10074729 | |||
| 608 | Ga0316585_10100676 | |||
| 609 | Ga0316580_10005751 | |||
| 610 | Ga0316593_10000043 | |||
| 611 | Ga0316593_10000056 | |||
| 612 | Ga0316593_10001768 | |||
| 613 | Ga0316593_10002618 | |||
| 614 | Ga0316593_10004750 | |||
| 615 | Ga0316593_10005892 | |||
| 616 | Ga0316593_10009459 | |||
| 617 | Ga0316593_10012318 | |||
| 618 | Ga0316593_10018804 | |||
| 619 | Ga0316593_10019872 | |||
| 620 | Ga0316593_10029429 | |||
| 621 | Ga0316593_10043482 | |||
| 622 | Ga0316593_10054157 | |||
| 623 | Ga0316593_10071492 | |||
| 624 | Ga0316593_10097432 | |||
| 625 | Ga0316593_10107573 | |||
| 626 | Ga0316593_10135569 | |||
| 627 | Ga0316593_10179498 | |||
| 628 | Ga0316593_10183681 | |||
| 629 | Ga0316593_10197779 | |||
| 630 | Ga0316593_10268410 | |||
| 631 | Ga0316593_10271789 | |||
| 632 | Ga0316593_10379936 | |||
| 633 | Ga0316592_1000035 | |||
| 634 | Ga0316592_1006430 | |||
| 635 | Ga0316592_1009914 | |||
| 636 | Ga0316592_1012784 | |||
| 637 | Ga0316592_1013391 | |||
| 638 | Ga0316592_1022026 | |||
| 639 | Ga0316592_1025209 | |||
| 640 | Ga0316592_1036895 | |||
| 641 | Ga0316592_1039859 | |||
| 642 | Ga0316592_1059180 | |||
| 643 | Ga0316592_1062339 | |||
| 644 | Ga0316592_1161986 | |||
| 645 | Ga0316586_1032930 | |||
| 646 | Ga0316586_1036605 | |||
| 647 | Ga0316586_1123530 | |||
| 648 | Ga0316588_1000152 | |||
| 649 | Ga0316588_1026017 | |||
| 650 | Ga0316588_1083812 | |||
| 651 | Ga0316588_1097995 | |||
| 652 | Ga0316587_1006788 | |||
| 653 | Ga0316587_1019590 | |||
| 654 | Ga0316596_1000039 | |||
| 655 | Ga0316596_1000061 | |||
| 656 | Ga0316596_1000254 | |||
| 657 | Ga0316596_1000437 | |||
| 658 | Ga0316596_1000458 | |||
| 659 | Ga0316596_1001363 | |||
| 660 | Ga0316596_1001478 | |||
| 661 | Ga0316596_1002150 | |||
| 662 | Ga0316596_1002948 | |||
| 663 | Ga0316596_1004397 | |||
| 664 | Ga0316596_1008803 | |||
| 665 | Ga0316596_1010272 | |||
| 666 | Ga0316596_1012101 | |||
| 667 | Ga0316596_1021887 | |||
| 668 | Ga0316596_1022381 | |||
| 669 | Ga0316596_1026563 | |||
| 670 | Ga0316596_1032765 | |||
| 671 | Ga0316596_1059854 | |||
| 672 | Ga0316596_1065010 | |||
| 673 | Ga0316596_1076356 | |||
| 674 | Ga0316596_1095623 | |||
| 675 | Ga0316596_1101116 | |||
| 676 | Ga0316596_1103976 | |||
| 677 | Ga0316596_1107318 | |||
| 678 | Ga0316596_1119501 | |||
| 679 | Ga0316596_1134913 | |||
| 680 | Ga0316596_1162341 | |||
| 681 | Ga0316596_1217391 | |||
| 682 | Ga0316596_1249077 | |||
| 683 | Ga0316574_0001182 | |||
| 684 | Ga0316574_0012412 | |||
| 685 | Ga0316574_0013553 | |||
| 686 | Ga0316574_0080967 | |||
| 687 | Ga0316574_0281561 | |||
| 688 | Ga0316574_0352888 | |||
| 689 | Ga0316582_0000535 | |||
| 690 | Ga0316582_0003224 | |||
| 691 | Ga0316582_0011702 | |||
| 692 | Ga0316582_0300986 | |||
| 693 | Ga0316582_0674490 | |||
| 694 | Ga0316584_0004587 | |||
| 695 | Ga0316584_0009686 | |||
| 696 | Ga0316584_0009934 | |||
| 697 | Ga0316584_0026734 | |||
| 698 | Ga0316584_0091701 | |||
| 699 | Ga0316584_0092561 | |||
| 700 | Ga0316584_0111354 | |||
| 701 | Ga0316584_0230198 | |||
| 702 | Ga0316584_0272749 | |||
| 703 | Ga0316584_0273989 | |||
| 704 | Ga0316584_0338004 | |||
| 705 | Ga0316584_0374800 | |||
| 706 | Ga0316584_0886525 | |||
| 707 | Ga0395900_0168524 | |||
| 708 | Ga0395900_1436329 | |||
| 709 | Ga0395898_0428885 | |||
| 710 | Ga0395898_1319504 | |||
| 711 | Ga0316581_0007723 | |||
| 712 | Ga0316581_0160042 | |||
| 713 | Ga0316581_0237357 | |||
| 714 | Ga0395901_1895418 | |||
| 715 | Ga0400484_20003 | |||
| 716 | Ga0400484_27667 | |||
| 717 | Ga0400484_37672 | |||
| 718 | Ga0400490_03324 | |||
| 719 | Ga0400490_05180 | |||
| 720 | Ga0400490_26141 | |||
| 721 | Ga0400491_13944 | |||
| 722 | Ga0400485_08047 | |||
| 723 | Ga0400485_10318 | |||
| 724 | Ga0400488_00038 | |||
| 725 | Ga0400488_03335 | |||
| 726 | Ga0400488_57235 | |||
| 727 | Ga0400486_17114 | |||
| 728 | Ga0400486_17728 | |||
| 729 | Ga0400486_21368 | |||
| 730 | Ga0400486_33075 | |||
| 731 | Ga0400483_001312 | |||
| 732 | Ga0400483_012769 | |||
| 733 | Ga0400483_120099 | |||
| 734 | Ga0400483_221082 | |||
| 735 | Ga0400483_228134 | |||
| 736 | Ga0400483_251558 | |||
| 737 | Ga0400483_265905 | |||
| 738 | Ga0400489_23715 | |||
| 739 | Ga0400489_59643 | |||
| 740 | Ga0400489_66216 | |||
| 741 | Ga0400489_74615 | |||
| 742 | Ga0400489_76217 | |||
| 743 | Ga0400489_86209 | |||
| 744 | Ga0400487_33846 | |||
| 745 | Ga0400487_55496 | |||
| 746 | Ga0451789_0260892 | |||
| 747 | Ga0451577_0244654 | |||
| 748 | Ga0453684_0408481 | |||
| 749 | Ga0466957_0269967 | |||
| 750 | Ga0451576_0004083 | |||
| 751 | Ga0495590_0042229 | |||
| 752 | Ga0495605_0075252 | |||
| 753 | Ga0495584_0703913 | |||
| 754 | Ga0495654_0251932 | |||
| 755 | Ga0495597_0372709 | |||
| 756 | Ga0495633_0065769 | |||
| 757 | Ga0495661_0085148 | |||
| 758 | Ga0495661_0247133 | |||
| 759 | Ga0495657_0667183 | |||
| 760 | Ga0495670_0045580 | |||
| 761 | Ga0495670_0306785 | |||
| 762 | Ga0495660_0004825 | |||
| 763 | Ga0495672_0407259 | |||
| 764 | Ga0495676_0133814 | |||
| 765 | Ga0495680_0347683 | |||
| 766 | Ga0495684_0700380 | |||
| 767 | Ga0496100_0679634 | |||
| 768 | Ga0496101_0038405 | |||
| 769 | Ga0496102_0011196 | |||
| 770 | Ga0496102_0099351 | |||
| 771 | Ga0496102_0629539 | |||
| 772 | Ga0496103_0047911 | |||
| 773 | Ga0496103_0276565 | |||
| 774 | Ga0496103_0478435 | |||
| 775 | Ga0496104_0348085 | |||
| 776 | Ga0496104_0353513 | |||
| 777 | Ga0496108_1201168 | |||
| 778 | Ga0496109_0087437 | |||
| 779 | Ga0496110_0003743 | |||
| 780 | Ga0496110_0311758 | |||
| 781 | Ga0496110_1272718 | |||
| 782 | Ga0496111_0005358 | |||
| 783 | Ga0496111_1138120 | |||
| 784 | Ga0496112_0264091 | |||
| 785 | Ga0496112_1425031 | |||
| 786 | Ga0496113_0413632 | |||
| 787 | Ga0496122_0199829 | |||
| 788 | Ga0496126_0078001 | |||
| 789 | Ga0501306_000030 | |||
| 790 | Ga0501306_000138 | |||
| 791 | Ga0501306_000285 | |||
| 792 | Ga0501306_003694 | |||
| 793 | Ga0501306_004132 | |||
| 794 | Ga0501308_000106 | |||
| 795 | Ga0501308_000127 | |||
| 796 | Ga0501308_003239 | |||
| 797 | Ga0501309_003421 | |||
| 798 | Ga0501309_020491 | |||
| 799 | Ga0501309_053604 | |||
| 800 | Ga0501310_000940 | |||
| 801 | Ga0501310_009955 | |||
| 802 | Ga0501341_00024 | |||
| 803 | Ga0501341_00074 | |||
| 804 | Ga0501341_00193 | |||
| 805 | Ga0501341_00222 | |||
| 806 | Ga0501341_02017 | |||
| 807 | Ga0501341_02439 | |||
| 808 | Ga0501341_03220 | |||
| 809 | Ga0501341_14051 | |||
| 810 | Ga0501343_000392 | |||
| 811 | Ga0501343_001442 | |||
| 812 | Ga0501343_002494 | |||
| 813 | Ga0501343_002627 | |||
| 814 | Ga0501343_003186 | |||
| 815 | Ga0501343_008110 | |||
| 816 | Ga0501343_008265 | |||
| 817 | Ga0501344_00011 | |||
| 818 | Ga0501344_00060 | |||
| 819 | Ga0501344_00166 | |||
| 820 | Ga0501344_11047 | |||
| 821 | Ga0501344_11091 | |||
| 822 | Ga0501345_00004 | |||
| 823 | Ga0501345_00405 | |||
| 824 | Ga0501304_000046 | |||
| 825 | Ga0501304_002674 | |||
| 826 | Ga0501304_006007 | |||
| 827 | Ga0501304_006207 | |||
| 828 | Ga0501305_000007 | |||
| 829 | Ga0501305_000048 | |||
| 830 | Ga0501305_002503 | |||
| 831 | Ga0501305_002856 | |||
| 832 | Ga0501305_003944 | |||
| 833 | Ga0501305_008928 | |||
| 834 | Ga0501305_009687 | |||
| 835 | Ga0501305_055142 | |||
| 836 | Ga0501307_000011 | |||
| 837 | Ga0501307_000155 | |||
| 838 | Ga0501307_008353 | |||
| 839 | Ga0501307_014662 | |||
| 840 | Ga0501307_051525 | |||
| 841 | Ga0501342_00056 | |||
| 842 | Ga0501342_00181 | |||
| 843 | Ga0501342_01190 | |||
| 844 | Ga0501290_096348 | |||
| 845 | Ga0501311_000009 | |||
| 846 | Ga0501311_000124 | |||
| 847 | Ga0501311_000152 | |||
| 848 | Ga0501311_005953 | |||
| 849 | Ga0501311_008221 | |||
| 850 | Ga0501311_020732 | |||
| 851 | Ga0501312_000002 | |||
| 852 | Ga0501312_000051 | |||
| 853 | Ga0501312_000171 | |||
| 854 | Ga0501312_000739 | |||
| 855 | Ga0501312_007190 | |||
| 856 | Ga0501312_028693 | |||
| 857 | Ga0501313_000003 | |||
| 858 | Ga0501313_000081 | |||
| 859 | Ga0501313_000360 | |||
| 860 | Ga0501313_000781 | |||
| 861 | Ga0501313_002469 | |||
| 862 | Ga0501313_034153 | |||
| 863 | Ga0501313_054732 | |||
| 864 | Ga0501314_000773 | |||
| 865 | Ga0501314_000797 | |||
| 866 | Ga0501314_002612 | |||
| 867 | Ga0501314_005241 | |||
| 868 | Ga0501315_000006 | |||
| 869 | Ga0501315_000072 | |||
| 870 | Ga0501315_000123 | |||
| 871 | Ga0501315_001506 | |||
| 872 | Ga0501315_010592 | |||
| 873 | Ga0501315_013630 | |||
| 874 | Ga0501315_063675 | |||
| 875 | Ga0501315_104606 | |||
| 876 | Ga0501316_000137 | |||
| 877 | Ga0501316_000153 | |||
| 878 | Ga0501316_000268 | |||
| 879 | Ga0501316_002234 | |||
| 880 | Ga0501316_002272 | |||
| 881 | Ga0501316_008645 | |||
| 882 | Ga0501317_000414 | |||
| 883 | Ga0501317_000563 | |||
| 884 | Ga0501317_001025 | |||
| 885 | Ga0501317_006422 | |||
| 886 | Ga0501317_010097 | |||
| 887 | Ga0501317_031788 | |||
| 888 | Ga0501318_000003 | |||
| 889 | Ga0501318_006139 | |||
| 890 | Ga0501318_008046 | |||
| 891 | Ga0501318_008247 | |||
| 892 | Ga0501318_010585 | |||
| 893 | Ga0501318_017200 | |||
| 894 | Ga0501318_039571 | |||
| 895 | Ga0501319_000003 | |||
| 896 | Ga0501319_000047 | |||
| 897 | Ga0501319_000238 | |||
| 898 | Ga0501320_000070 | |||
| 899 | Ga0501320_000079 | |||
| 900 | Ga0501320_005312 | |||
| 901 | Ga0501320_013920 | |||
| 902 | Ga0501320_022962 | |||
| 903 | Ga0501320_028615 | |||
| 904 | Ga0501321_000002 | |||
| 905 | Ga0501321_000088 | |||
| 906 | Ga0501321_000089 | |||
| 907 | Ga0501321_009872 | |||
| 908 | Ga0501321_018443 | |||
| 909 | Ga0501321_025183 | |||
| 910 | Ga0501321_083253 | |||
| 911 | Ga0501322_000335 | |||
| 912 | Ga0501322_000404 | |||
| 913 | Ga0501322_004788 | |||
| 914 | Ga0501322_008588 | |||
| 915 | Ga0501323_000116 | |||
| 916 | Ga0501323_000308 | |||
| 917 | Ga0501323_002710 | |||
| 918 | Ga0501323_007909 | |||
| 919 | Ga0501323_051645 | |||
| 920 | Ga0501324_000153 | |||
| 921 | Ga0501324_002993 | |||
| 922 | Ga0501324_003211 | |||
| 923 | Ga0501324_003902 | |||
| 924 | Ga0501324_004891 | |||
| 925 | Ga0501325_000006 | |||
| 926 | Ga0501325_012344 | |||
| 927 | Ga0501325_056130 | |||
| 928 | Ga0501326_00045 | |||
| 929 | Ga0501326_00113 | |||
| 930 | Ga0501326_00177 | |||
| 931 | Ga0501326_02651 | |||
| 932 | Ga0501326_13868 | |||
| 933 | Ga0501327_00035 | |||
| 934 | Ga0501327_00389 | |||
| 935 | Ga0501327_01957 | |||
| 936 | Ga0501327_03203 | |||
| 937 | Ga0501328_00014 | |||
| 938 | Ga0501328_00064 | |||
| 939 | Ga0501328_00270 | |||
| 940 | Ga0501328_00940 | |||
| 941 | Ga0501328_08228 | |||
| 942 | Ga0501329_00157 | |||
| 943 | Ga0501329_00304 | |||
| 944 | Ga0501329_00684 | |||
| 945 | Ga0501330_000139 | |||
| 946 | Ga0501330_003198 | |||
| 947 | Ga0501331_00073 | |||
| 948 | Ga0501331_00179 | |||
| 949 | Ga0501331_01395 | |||
| 950 | Ga0501331_01778 | |||
| 951 | Ga0501332_00490 | |||
| 952 | Ga0501332_00546 | |||
| 953 | Ga0501332_02078 | |||
| 954 | Ga0501332_02832 | |||
| 955 | Ga0501332_14030 | |||
| 956 | Ga0501333_001637 | |||
| 957 | Ga0501333_001872 | |||
| 958 | Ga0501333_002894 | |||
| 959 | Ga0501333_003008 | |||
| 960 | Ga0501333_016748 | |||
| 961 | Ga0501334_00014 | |||
| 962 | Ga0501334_00634 | |||
| 963 | Ga0501334_01174 | |||
| 964 | Ga0501334_02083 | |||
| 965 | Ga0501334_03876 | |||
| 966 | Ga0501334_09586 | |||
| 967 | Ga0501335_000116 | |||
| 968 | Ga0501335_001159 | |||
| 969 | Ga0501335_001571 | |||
| 970 | Ga0501335_005235 | |||
| 971 | Ga0501335_008105 | |||
| 972 | Ga0501336_000332 | |||
| 973 | Ga0501336_000875 | |||
| 974 | Ga0501336_001822 | |||
| 975 | Ga0501336_005798 | |||
| 976 | Ga0501336_009033 | |||
| 977 | Ga0501337_000050 | |||
| 978 | Ga0501337_000210 | |||
| 979 | Ga0501337_000952 | |||
| 980 | Ga0501337_004275 | |||
| 981 | Ga0501338_00355 | |||
| 982 | Ga0501338_00393 | |||
| 983 | Ga0501338_01217 | |||
| 984 | Ga0501338_01413 | |||
| 985 | Ga0501338_02524 | |||
| 986 | Ga0501338_03097 | |||
| 987 | Ga0501339_00013 | |||
| 988 | Ga0501339_00086 | |||
| 989 | Ga0501340_000004 | |||
| 990 | Ga0501340_000079 | |||
| 991 | Ga0501340_001704 | |||
| 992 | Ga0501202_090762 | |||
| 993 | Ga0501217_012762 | |||
| 994 | Ga0501225_0121924 | |||
| 995 | Ga0501212_064783 | |||
| 996 | Ga0587067_189236 | |||
| 997 | 2511698004 | |||
| 998 | 2545559757 | |||
| 999 | 2555470885 | |||
| 1000 | 2578930714 | |||
| 1001 | 2595092272 | |||
| 1002 | 2600199447 | |||
| 1003 | 2600401649 | |||
| 1004 | 2631982460 | |||
| 1005 | 2644741863 | |||
| 1006 | 2651530325 | |||
| 1007 | 2674421120 | |||
| 1008 | 2686995327 | |||
| 1009 | 2687496576 | |||
| 1010 | 2695629924 | |||
| 1011 | 2717918177 | |||
| 1012 | 2738839005 | |||
| 1013 | 2739271693 | |||
| 1014 | 2740990509 | |||
| 1015 | 2757568907 | |||
| 1016 | 2777764208 | |||
| 1017 | 2777837283 | |||
| 1018 | 2809057183 | |||
| 1019 | 2812314466 | |||
| 1020 | 2817478192 | |||
| 1021 | 2819726065 | |||
| 1022 | 2823526419 | |||
| 1023 | 2857358451 | |||
| 1024 | 2857590955 | |||
| 1025 | 2857608868 | |||
| 1026 | 2857613421 | |||
| 1027 | 2860837583 | |||
| 1028 | 2877768802 | |||
| 1029 | 2880169744 | |||
| 1030 | 2897109771 | |||
| 1031 | 2904564593 | |||
| 1032 | 2908669316 | |||
| 1033 | 2919097074 | |||
| 1034 | 2919419356 | |||
| 1035 | 2919730769 | |||
| 1036 | 2928513045 | |||
| 1037 | 2936343060 | |||
| 1038 | 2954776077 | |||
| 1039 | 2962290794 | |||
| 1040 | 2969137001 | |||
| 1041 | 2969141170 | |||
| 1042 | 2969766250 | |||
| 1043 | 2969774918 | |||
| 1044 | 2971893531 | |||
| 1045 | 2977254692 | |||
| 1046 | 2980492745 | |||
| 1047 | 2990275695 | |||
| 1048 | 3006858520 | |||
| 1049 | 3006883632 | |||
| 1050 | 3006980025 | |||
| 1051 | 8022631637 | |||
| 1052 | 8022655881 | |||
| 1053 | 8051956514 | |||
| 1054 | 8052174990 | |||
| 1055 | 8054282866 | |||
| 1056 | 8057632289 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c8z-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9847 | 1 | 110 |
| 6pvk-assembly1.cif.gz_S | bacterial 45srbga ribosomal particle class a | 0.9805 | 3 | 110 |
| 7nhn-assembly1.cif.gz_V | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9799 | 1 | 110 |
| 7nhk-assembly1.cif.gz_V | lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis | 0.9782 | 2 | 110 |
| 8c8z-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.9754 | 1 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P56795_7_145_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9839 | 2 | 109 | 3.90.470.10 |
| 4g5uS00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.971 | 1 | 113 | 3.90.470.10 |
| 5mmiT00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.965 | 2 | 110 | 3.90.470.10 |
| af_P9WHC1_2_148_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.9642 | 2 | 112 | 3.90.470.10 |
| 5jvgP00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.962 | 4 | 113 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q6ME58-F1-model_v4 | Large ribosomal subunit protein uL22 (50S ribosomal protein L22) | 0.9927 | 1 | 110 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A1Q5XPU4-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9885 | 1 | 110 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A810E2E7-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9883 | 1 | 110 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A1I0KXI5-F1-model_v4 | Large ribosomal subunit protein uL22 | 0.9881 | 1 | 110 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-Q1WS95-F1-model_v4 | Large ribosomal subunit protein uL22 (50S ribosomal protein L22) | 0.9854 | 2 | 110 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |