F459710
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 311 | 1056 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0268650|Ga0451576_0268650_463_1050 |
| Length | 195 |
| Sequence | MNILQINASIRGAASHSSRLASEVVARLQGAGDTVQLRDLGANPPATIDPAALQALFTPAEQRTPEQAARVAQDDALIAELQAADTLVIGMPMYNFTVPVQFKSWLDAICRAQVTFRYTANGPEGLLTGKRAVIVLARGGNYTPDSDTQVPYLRQVLGFVGITDITFIHAEGLNLGPDAEAAALASARSAIAALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 100 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 166 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 176 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 177 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 206 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 207 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 208 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 209 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 210 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 211 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 212 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 213 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 262 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 283 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 285 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 290 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 297 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 298 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 299 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 301 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 304 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 305 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 306 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 307 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 308 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 309 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 310 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 311 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.8 |
| Metatranscriptomes | 12.5 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.42 |
| Nodule | 0 |
| Rhizoplane | 3.98 |
| Rhizosphere | 70.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451576_0268650 | 3300045051 | Bacteria | 1783 |
| 2 | JGI25156J39149_1019066 | 3300002705 | Bacteria | 1248 |
| 3 | JGI25154J39366_1004745 | 3300002738 | Bacteria | 2339 |
| 4 | JGI25157J39369_1000038 | 3300002741 | Bacteria | 130270 |
| 5 | JGI25152J39213_1016178 | 3300002773 | Bacteria | 1448 |
| 6 | JGI25150J39212_1000655 | 3300002774 | Bacteria | 12871 |
| 7 | JGI25159J45721_1010954 | 3300002987 | Unclassified | 2260 |
| 8 | JGI25153J46596_10007539 | 3300003215 | Bacteria | 5330 |
| 9 | rootH1_10003266 | 3300003316 | Bacteria | 13926 |
| 10 | rootL2_10047996 | 3300003322 | Bacteria | 3629 |
| 11 | rootL2_10072243 | 3300003322 | Bacteria | 2728 |
| 12 | rootL2_10074193 | 3300003322 | Bacteria | 3346 |
| 13 | rootH1_10001251 | 3300003323 | Bacteria | 8205 |
| 14 | rootH1_10025546 | 3300003323 | Bacteria | 7590 |
| 15 | JGI25161J50226_1000182 | 3300003374 | Bacteria | 42010 |
| 16 | Ga0055539_1002371 | 3300003752 | Bacteria | 2924 |
| 17 | Ga0055533_1000026 | 3300003756 | Bacteria | 323407 |
| 18 | Ga0055525_1000525 | 3300003759 | Bacteria | 18477 |
| 19 | Ga0055526_1000780 | 3300003771 | Bacteria | 23749 |
| 20 | Ga0055526_1003391 | 3300003771 | Bacteria | 10146 |
| 21 | Ga0055537_1003470 | 3300003773 | Bacteria | 4844 |
| 22 | Ga0055524_1000187 | 3300003775 | Bacteria | 68927 |
| 23 | Ga0055524_1018949 | 3300003775 | Bacteria | 2369 |
| 24 | Ga0055524_1023255 | 3300003775 | Unclassified | 2000 |
| 25 | Ga0055534_1002067 | 3300003784 | Bacteria | 7243 |
| 26 | Ga0055528_1003283 | 3300003790 | Bacteria | 8223 |
| 27 | Ga0055530_10000444 | 3300003791 | Bacteria | 36774 |
| 28 | Ga0055530_10001759 | 3300003791 | Bacteria | 15132 |
| 29 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 30 | Ga0055531_10001467 | 3300003794 | Bacteria | 17357 |
| 31 | Ga0055543_1000112 | 3300004625 | Bacteria | 69589 |
| 32 | Ga0065165_1005676 | 3300005262 | Bacteria | 6881 |
| 33 | Ga0065712_10179619 | 3300005290 | Bacteria | 1199 |
| 34 | Ga0065715_10119799 | 3300005293 | Bacteria | 2276 |
| 35 | Ga0070658_10022875 | 3300005327 | Bacteria | 5016 |
| 36 | Ga0070658_10055262 | 3300005327 | Bacteria | 3225 |
| 37 | Ga0070676_10287396 | 3300005328 | Bacteria | 1110 |
| 38 | Ga0070690_100646440 | 3300005330 | Bacteria | 807 |
| 39 | Ga0070670_100316581 | 3300005331 | Bacteria | 1366 |
| 40 | Ga0070670_100762186 | 3300005331 | Bacteria | 872 |
| 41 | Ga0070677_10001601 | 3300005333 | Bacteria | 7161 |
| 42 | Ga0070677_10252453 | 3300005333 | Bacteria | 876 |
| 43 | Ga0068869_100794247 | 3300005334 | Bacteria | 813 |
| 44 | Ga0070682_100040109 | 3300005337 | Bacteria | 2880 |
| 45 | Ga0070682_100645589 | 3300005337 | Bacteria | 842 |
| 46 | Ga0068868_100011500 | 3300005338 | Bacteria | 6446 |
| 47 | Ga0070660_100007544 | 3300005339 | Bacteria | 7579 |
| 48 | Ga0070660_100023161 | 3300005339 | Bacteria | 4599 |
| 49 | Ga0070660_100085866 | 3300005339 | Bacteria | 2475 |
| 50 | Ga0070689_100268722 | 3300005340 | Bacteria | 1411 |
| 51 | Ga0070661_100219477 | 3300005344 | Bacteria | 1458 |
| 52 | Ga0070669_100008226 | 3300005353 | Bacteria | 7450 |
| 53 | Ga0070675_100001473 | 3300005354 | Bacteria | 17347 |
| 54 | Ga0070675_100242132 | 3300005354 | Bacteria | 1576 |
| 55 | Ga0070671_100011093 | 3300005355 | Bacteria | 7236 |
| 56 | Ga0070671_100030101 | 3300005355 | Bacteria | 4480 |
| 57 | Ga0070674_100002004 | 3300005356 | Bacteria | 11146 |
| 58 | Ga0070674_100327471 | 3300005356 | Bacteria | 1230 |
| 59 | Ga0070673_100030008 | 3300005364 | Bacteria | 4063 |
| 60 | Ga0070673_100050971 | 3300005364 | Bacteria | 3239 |
| 61 | Ga0070673_100733199 | 3300005364 | Bacteria | 909 |
| 62 | Ga0070667_100113363 | 3300005367 | Bacteria | 2353 |
| 63 | Ga0070667_100145705 | 3300005367 | Bacteria | 2077 |
| 64 | Ga0070700_100794532 | 3300005441 | Bacteria | 761 |
| 65 | Ga0070708_100000818 | 3300005445 | Bacteria | 23467 |
| 66 | Ga0070678_100005561 | 3300005456 | Bacteria | 7307 |
| 67 | Ga0070678_100152466 | 3300005456 | Bacteria | 1863 |
| 68 | Ga0070678_100616722 | 3300005456 | Bacteria | 970 |
| 69 | Ga0070678_100868289 | 3300005456 | Bacteria | 823 |
| 70 | Ga0070662_100005173 | 3300005457 | Bacteria | 8321 |
| 71 | Ga0070662_100389227 | 3300005457 | Bacteria | 1149 |
| 72 | Ga0068867_100000086 | 3300005459 | Bacteria | 58298 |
| 73 | Ga0068867_100096314 | 3300005459 | Bacteria | 2253 |
| 74 | Ga0068867_100160265 | 3300005459 | Bacteria | 1774 |
| 75 | Ga0068867_100253022 | 3300005459 | Bacteria | 1433 |
| 76 | Ga0070699_100273387 | 3300005518 | Bacteria | 1513 |
| 77 | Ga0070684_100223041 | 3300005535 | Bacteria | 1720 |
| 78 | Ga0068853_100388325 | 3300005539 | Bacteria | 1305 |
| 79 | Ga0068853_100981307 | 3300005539 | Bacteria | 813 |
| 80 | Ga0070672_100000367 | 3300005543 | Bacteria | 25974 |
| 81 | Ga0070672_100007805 | 3300005543 | Bacteria | 7298 |
| 82 | Ga0070686_100289371 | 3300005544 | Bacteria | 1211 |
| 83 | Ga0070665_100068041 | 3300005548 | Bacteria | 3571 |
| 84 | Ga0068855_100001767 | 3300005563 | Bacteria | 26998 |
| 85 | Ga0068855_100038331 | 3300005563 | Bacteria | 5694 |
| 86 | Ga0068855_100289055 | 3300005563 | Bacteria | 1818 |
| 87 | Ga0068855_100653855 | 3300005563 | Bacteria | 1129 |
| 88 | Ga0070664_100029166 | 3300005564 | Bacteria | 4599 |
| 89 | Ga0068857_100004097 | 3300005577 | Bacteria | 12280 |
| 90 | Ga0068857_100156332 | 3300005577 | Bacteria | 2068 |
| 91 | Ga0068854_100009523 | 3300005578 | Bacteria | 6271 |
| 92 | Ga0068856_100002296 | 3300005614 | Bacteria | 19713 |
| 93 | Ga0068856_101183924 | 3300005614 | Bacteria | 781 |
| 94 | Ga0068852_100786968 | 3300005616 | Bacteria | 965 |
| 95 | Ga0068852_100875522 | 3300005616 | Bacteria | 915 |
| 96 | Ga0068859_100918221 | 3300005617 | Bacteria | 960 |
| 97 | Ga0068864_100018312 | 3300005618 | Bacteria | 5849 |
| 98 | Ga0068864_100023287 | 3300005618 | Bacteria | 5199 |
| 99 | Ga0068864_100142004 | 3300005618 | Bacteria | 2167 |
| 100 | Ga0068861_100906416 | 3300005719 | Bacteria | 835 |
| 101 | Ga0068870_10139262 | 3300005840 | Bacteria | 1418 |
| 102 | Ga0068863_100074674 | 3300005841 | Bacteria | 3208 |
| 103 | Ga0068860_100410901 | 3300005843 | Bacteria | 1340 |
| 104 | Ga0068862_100031756 | 3300005844 | Bacteria | 4461 |
| 105 | Ga0068862_100144841 | 3300005844 | Bacteria | 2111 |
| 106 | Ga0075432_10066585 | 3300006058 | Bacteria | 1289 |
| 107 | Ga0075362_10222980 | 3300006177 | Bacteria | 922 |
| 108 | Ga0075366_10001671 | 3300006195 | Bacteria | 11141 |
| 109 | Ga0075366_10002150 | 3300006195 | Bacteria | 10037 |
| 110 | Ga0075366_10014138 | 3300006195 | Bacteria | 4555 |
| 111 | Ga0075366_10028889 | 3300006195 | Bacteria | 3256 |
| 112 | Ga0075366_10101444 | 3300006195 | Bacteria | 1727 |
| 113 | Ga0075366_10102319 | 3300006195 | Bacteria | 1720 |
| 114 | Ga0075366_10205226 | 3300006195 | Unclassified | 1199 |
| 115 | Ga0075366_10214769 | 3300006195 | Bacteria | 1171 |
| 116 | Ga0075366_10226641 | 3300006195 | Bacteria | 1139 |
| 117 | Ga0075366_10307601 | 3300006195 | Bacteria | 970 |
| 118 | Ga0075370_10001645 | 3300006353 | Bacteria | 9866 |
| 119 | Ga0075370_10038071 | 3300006353 | Bacteria | 2706 |
| 120 | Ga0075370_10063586 | 3300006353 | Bacteria | 2104 |
| 121 | Ga0068871_100394113 | 3300006358 | Bacteria | 1232 |
| 122 | Ga0068871_100532837 | 3300006358 | Bacteria | 1062 |
| 123 | Ga0075429_100014531 | 3300006880 | Bacteria | 6822 |
| 124 | Ga0097620_100918226 | 3300006931 | Bacteria | 960 |
| 125 | Ga0075435_100102283 | 3300007076 | Unclassified | 2375 |
| 126 | Ga0105240_10018658 | 3300009093 | Bacteria | 9297 |
| 127 | Ga0105247_10289544 | 3300009101 | Bacteria | 1132 |
| 128 | Ga0105243_10010856 | 3300009148 | Bacteria | 6891 |
| 129 | Ga0105243_10047416 | 3300009148 | Bacteria | 3382 |
| 130 | Ga0105243_10171712 | 3300009148 | Bacteria | 1878 |
| 131 | Ga0105243_10751321 | 3300009148 | Bacteria | 956 |
| 132 | Ga0105241_10009231 | 3300009174 | Bacteria | 7253 |
| 133 | Ga0105242_10055776 | 3300009176 | Bacteria | 3233 |
| 134 | Ga0105248_10000471 | 3300009177 | Bacteria | 45843 |
| 135 | Ga0105248_10001875 | 3300009177 | Bacteria | 23322 |
| 136 | Ga0105248_10146220 | 3300009177 | Bacteria | 2667 |
| 137 | Ga0105237_10429091 | 3300009545 | Bacteria | 1327 |
| 138 | Ga0105238_10047236 | 3300009551 | Bacteria | 4343 |
| 139 | Ga0105239_10021588 | 3300010375 | Bacteria | 7100 |
| 140 | Ga0105239_10507692 | 3300010375 | Bacteria | 1371 |
| 141 | Ga0157373_10004343 | 3300013100 | Bacteria | 10672 |
| 142 | Ga0157370_10348212 | 3300013104 | Bacteria | 1366 |
| 143 | Ga0157369_10029515 | 3300013105 | Bacteria | 6059 |
| 144 | Ga0157374_10064011 | 3300013296 | Bacteria | 3450 |
| 145 | Ga0157378_10568233 | 3300013297 | Bacteria | 1142 |
| 146 | Ga0157378_10690996 | 3300013297 | Bacteria | 1039 |
| 147 | Ga0163162_10283320 | 3300013306 | Bacteria | 1789 |
| 148 | Ga0163162_10388153 | 3300013306 | Bacteria | 1529 |
| 149 | Ga0157372_10224846 | 3300013307 | Bacteria | 2176 |
| 150 | Ga0157375_10410376 | 3300013308 | Bacteria | 1521 |
| 151 | Ga0157375_10849141 | 3300013308 | Bacteria | 1060 |
| 152 | Ga0163163_10028813 | 3300014325 | Bacteria | 5337 |
| 153 | Ga0163163_10660601 | 3300014325 | Bacteria | 1109 |
| 154 | Ga0157377_10000038 | 3300014745 | Bacteria | 113777 |
| 155 | Ga0157379_10615951 | 3300014968 | Bacteria | 1014 |
| 156 | Ga0157379_10620012 | 3300014968 | Bacteria | 1011 |
| 157 | Ga0157376_10016519 | 3300014969 | Bacteria | 5607 |
| 158 | Ga0157376_10319849 | 3300014969 | Bacteria | 1475 |
| 159 | Ga0163161_10060906 | 3300017792 | Bacteria | 2748 |
| 160 | Ga0163161_10149756 | 3300017792 | Bacteria | 1773 |
| 161 | Ga0163161_10393364 | 3300017792 | Bacteria | 1110 |
| 162 | Ga0206352_10163021 | 3300020078 | Bacteria | 924 |
| 163 | Ga0213872_10011831 | 3300021361 | Bacteria | 4122 |
| 164 | Ga0213872_10087888 | 3300021361 | Bacteria | 1392 |
| 165 | Ga0209436_100484 | 3300025208 | Bacteria | 17563 |
| 166 | Ga0209436_102860 | 3300025208 | Bacteria | 4886 |
| 167 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 168 | Ga0209563_100069 | 3300025230 | Bacteria | 253154 |
| 169 | Ga0207427_101384 | 3300025231 | Bacteria | 8888 |
| 170 | Ga0209258_100870 | 3300025242 | Bacteria | 15963 |
| 171 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 172 | Ga0207425_1000130 | 3300025245 | Bacteria | 70791 |
| 173 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 174 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 175 | Ga0209677_100048 | 3300025253 | Bacteria | 183563 |
| 176 | Ga0209677_100263 | 3300025253 | Bacteria | 35585 |
| 177 | Ga0209677_101400 | 3300025253 | Bacteria | 10475 |
| 178 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 179 | Ga0209759_1001348 | 3300025256 | Bacteria | 14283 |
| 180 | Ga0209759_1003047 | 3300025256 | Bacteria | 6903 |
| 181 | Ga0209759_1013641 | 3300025256 | Bacteria | 2188 |
| 182 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 183 | Ga0209129_1008481 | 3300025258 | Bacteria | 2854 |
| 184 | Ga0209565_1000572 | 3300025263 | Bacteria | 25033 |
| 185 | Ga0209565_1000878 | 3300025263 | Bacteria | 16520 |
| 186 | Ga0209565_1003147 | 3300025263 | Bacteria | 5511 |
| 187 | Ga0209130_1000237 | 3300025284 | Bacteria | 70739 |
| 188 | Ga0209130_1004662 | 3300025284 | Bacteria | 5089 |
| 189 | Ga0209675_1004686 | 3300025291 | Bacteria | 6001 |
| 190 | Ga0209675_1031846 | 3300025291 | Bacteria | 1242 |
| 191 | Ga0209564_1000311 | 3300025295 | Bacteria | 95587 |
| 192 | Ga0209564_1042286 | 3300025295 | Bacteria | 1211 |
| 193 | Ga0209758_1000041 | 3300025297 | Bacteria | 410328 |
| 194 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 195 | Ga0209050_1000280 | 3300025298 | Bacteria | 108968 |
| 196 | Ga0209050_1000664 | 3300025298 | Bacteria | 52795 |
| 197 | Ga0209050_1001427 | 3300025298 | Bacteria | 25782 |
| 198 | Ga0209256_1000068 | 3300025299 | Bacteria | 246064 |
| 199 | Ga0209256_1000952 | 3300025299 | Bacteria | 35118 |
| 200 | Ga0209256_1038346 | 3300025299 | Bacteria | 1242 |
| 201 | Ga0207426_1003864 | 3300025302 | Bacteria | 7725 |
| 202 | Ga0209051_1006353 | 3300025303 | Bacteria | 6685 |
| 203 | Ga0209051_1015749 | 3300025303 | Bacteria | 3464 |
| 204 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 205 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 206 | Ga0209257_1010241 | 3300025304 | Bacteria | 4797 |
| 207 | Ga0209257_1010307 | 3300025304 | Bacteria | 4756 |
| 208 | Ga0207682_10001930 | 3300025893 | Bacteria | 9419 |
| 209 | Ga0207682_10168334 | 3300025893 | Bacteria | 996 |
| 210 | Ga0207692_10066964 | 3300025898 | Bacteria | 1879 |
| 211 | Ga0207680_10075899 | 3300025903 | Bacteria | 2097 |
| 212 | Ga0207645_10083293 | 3300025907 | Bacteria | 2051 |
| 213 | Ga0207643_10122785 | 3300025908 | Bacteria | 1540 |
| 214 | Ga0207705_10018721 | 3300025909 | Bacteria | 4954 |
| 215 | Ga0207705_10064063 | 3300025909 | Bacteria | 2656 |
| 216 | Ga0207654_10034576 | 3300025911 | Bacteria | 2809 |
| 217 | Ga0207695_10015011 | 3300025913 | Bacteria | 9138 |
| 218 | Ga0207671_10205106 | 3300025914 | Bacteria | 1541 |
| 219 | Ga0207657_10035980 | 3300025919 | Bacteria | 4435 |
| 220 | Ga0207657_10340135 | 3300025919 | Bacteria | 1184 |
| 221 | Ga0207649_10140899 | 3300025920 | Bacteria | 1650 |
| 222 | Ga0207649_10256540 | 3300025920 | Bacteria | 1262 |
| 223 | Ga0207681_10134357 | 3300025923 | Bacteria | 1833 |
| 224 | Ga0207694_10003229 | 3300025924 | Bacteria | 12990 |
| 225 | Ga0207650_10002288 | 3300025925 | Bacteria | 13348 |
| 226 | Ga0207650_10261946 | 3300025925 | Bacteria | 1403 |
| 227 | Ga0207659_10008394 | 3300025926 | Bacteria | 6410 |
| 228 | Ga0207659_10266419 | 3300025926 | Bacteria | 1396 |
| 229 | Ga0207644_10004038 | 3300025931 | Bacteria | 9522 |
| 230 | Ga0207644_10012860 | 3300025931 | Bacteria | 5567 |
| 231 | Ga0207644_10019766 | 3300025931 | Bacteria | 4573 |
| 232 | Ga0207644_10186620 | 3300025931 | Bacteria | 1628 |
| 233 | Ga0207690_10084713 | 3300025932 | Bacteria | 2223 |
| 234 | Ga0207706_10011506 | 3300025933 | Bacteria | 8059 |
| 235 | Ga0207706_10064935 | 3300025933 | Bacteria | 3214 |
| 236 | Ga0207686_10220807 | 3300025934 | Bacteria | 1368 |
| 237 | Ga0207709_10009847 | 3300025935 | Bacteria | 5263 |
| 238 | Ga0207709_10047846 | 3300025935 | Bacteria | 2602 |
| 239 | Ga0207709_10095285 | 3300025935 | Bacteria | 1955 |
| 240 | Ga0207709_10412626 | 3300025935 | Bacteria | 1035 |
| 241 | Ga0207669_10408656 | 3300025937 | Bacteria | 1065 |
| 242 | Ga0207691_10001841 | 3300025940 | Bacteria | 20724 |
| 243 | Ga0207691_10283967 | 3300025940 | Bacteria | 1424 |
| 244 | Ga0207711_10001495 | 3300025941 | Bacteria | 21766 |
| 245 | Ga0207711_10085580 | 3300025941 | Bacteria | 2762 |
| 246 | Ga0207689_10714861 | 3300025942 | Bacteria | 845 |
| 247 | Ga0207679_10087070 | 3300025945 | Bacteria | 2404 |
| 248 | Ga0207667_10003101 | 3300025949 | Bacteria | 20573 |
| 249 | Ga0207667_10013387 | 3300025949 | Bacteria | 9386 |
| 250 | Ga0207667_10061040 | 3300025949 | Bacteria | 3945 |
| 251 | Ga0207651_10004659 | 3300025960 | Bacteria | 6950 |
| 252 | Ga0207651_10007681 | 3300025960 | Bacteria | 5759 |
| 253 | Ga0207658_10026500 | 3300025986 | Bacteria | 4064 |
| 254 | Ga0207658_10046373 | 3300025986 | Bacteria | 3174 |
| 255 | Ga0207677_10010426 | 3300026023 | Bacteria | 5258 |
| 256 | Ga0207677_10205238 | 3300026023 | Bacteria | 1570 |
| 257 | Ga0207639_10039927 | 3300026041 | Bacteria | 3500 |
| 258 | Ga0207639_10226783 | 3300026041 | Bacteria | 1617 |
| 259 | Ga0207639_10230622 | 3300026041 | Bacteria | 1604 |
| 260 | Ga0207702_10005216 | 3300026078 | Bacteria | 11410 |
| 261 | Ga0207702_10586637 | 3300026078 | Bacteria | 1093 |
| 262 | Ga0207641_10303652 | 3300026088 | Bacteria | 1508 |
| 263 | Ga0207641_10436134 | 3300026088 | Bacteria | 1264 |
| 264 | Ga0207641_10947338 | 3300026088 | Bacteria | 856 |
| 265 | Ga0207648_10000053 | 3300026089 | Bacteria | 107516 |
| 266 | Ga0207648_10017318 | 3300026089 | Bacteria | 6562 |
| 267 | Ga0207648_10075975 | 3300026089 | Bacteria | 2928 |
| 268 | Ga0207648_10177150 | 3300026089 | Bacteria | 1886 |
| 269 | Ga0207676_10021173 | 3300026095 | Bacteria | 4769 |
| 270 | Ga0207676_10027340 | 3300026095 | Bacteria | 4248 |
| 271 | Ga0207676_10266404 | 3300026095 | Bacteria | 1549 |
| 272 | Ga0207675_100047872 | 3300026118 | Bacteria | 3991 |
| 273 | Ga0207675_101005551 | 3300026118 | Bacteria | 852 |
| 274 | Ga0207683_10005954 | 3300026121 | Bacteria | 10447 |
| 275 | Ga0207683_10181403 | 3300026121 | Bacteria | 1909 |
| 276 | Ga0207683_10505360 | 3300026121 | Bacteria | 1116 |
| 277 | Ga0207698_10468311 | 3300026142 | Bacteria | 1220 |
| 278 | Ga0207698_11412983 | 3300026142 | Bacteria | 711 |
| 279 | Ga0209998_10048829 | 3300027717 | Bacteria | 976 |
| 280 | Ga0209974_10004417 | 3300027876 | Bacteria | 5003 |
| 281 | Ga0268266_10334911 | 3300028379 | Bacteria | 1419 |
| 282 | Ga0268265_10396457 | 3300028380 | Bacteria | 1274 |
| 283 | Ga0268264_10684018 | 3300028381 | Bacteria | 1018 |
| 284 | Ga0307515_10001629 | 3300028794 | Bacteria | 49963 |
| 285 | Ga0307515_10066207 | 3300028794 | Bacteria | 5010 |
| 286 | Ga0307515_10076602 | 3300028794 | Bacteria | 4433 |
| 287 | Ga0307515_10087646 | 3300028794 | Bacteria | 3946 |
| 288 | Ga0307515_10185483 | 3300028794 | Bacteria | 2011 |
| 289 | Ga0307515_10248555 | 3300028794 | Bacteria | 1535 |
| 290 | Ga0307515_10381387 | 3300028794 | Bacteria | 1042 |
| 291 | Ga0265324_10023001 | 3300029957 | Bacteria | 2223 |
| 292 | Ga0307512_10034290 | 3300030522 | Bacteria | 4344 |
| 293 | Ga0265330_10003812 | 3300031235 | Bacteria | 7771 |
| 294 | Ga0265332_10000841 | 3300031238 | Bacteria | 18651 |
| 295 | Ga0265325_10033294 | 3300031241 | Bacteria | 2748 |
| 296 | Ga0265339_10024672 | 3300031249 | Bacteria | 3461 |
| 297 | Ga0265331_10000936 | 3300031250 | Bacteria | 23357 |
| 298 | Ga0265327_10016553 | 3300031251 | Bacteria | 4674 |
| 299 | Ga0265316_10081530 | 3300031344 | Bacteria | 2480 |
| 300 | Ga0307513_10018405 | 3300031456 | Bacteria | 8345 |
| 301 | Ga0307513_10056239 | 3300031456 | Bacteria | 4202 |
| 302 | Ga0307513_10208749 | 3300031456 | Bacteria | 1786 |
| 303 | Ga0307408_100000016 | 3300031548 | Bacteria | 356896 |
| 304 | Ga0307408_100001185 | 3300031548 | Bacteria | 19736 |
| 305 | Ga0307408_100137393 | 3300031548 | Bacteria | 1914 |
| 306 | Ga0307408_100259889 | 3300031548 | Bacteria | 1436 |
| 307 | Ga0307408_100790460 | 3300031548 | Bacteria | 860 |
| 308 | Ga0307508_10000133 | 3300031616 | Bacteria | 87867 |
| 309 | Ga0307508_10008282 | 3300031616 | Bacteria | 9624 |
| 310 | Ga0307514_10001199 | 3300031649 | Bacteria | 34587 |
| 311 | Ga0310114_106115 | 3300031678 | Bacteria | 1229 |
| 312 | Ga0265314_10022857 | 3300031711 | Bacteria | 4782 |
| 313 | Ga0265314_10088545 | 3300031711 | Bacteria | 2021 |
| 314 | Ga0265342_10011638 | 3300031712 | Bacteria | 6004 |
| 315 | Ga0307516_10001653 | 3300031730 | Bacteria | 30675 |
| 316 | Ga0307516_10004130 | 3300031730 | Bacteria | 18101 |
| 317 | Ga0307516_10529591 | 3300031730 | Bacteria | 832 |
| 318 | Ga0307405_10143158 | 3300031731 | Bacteria | 1670 |
| 319 | Ga0307413_10008938 | 3300031824 | Bacteria | 4763 |
| 320 | Ga0307413_10865361 | 3300031824 | Bacteria | 765 |
| 321 | Ga0307410_10006974 | 3300031852 | Bacteria | 6149 |
| 322 | Ga0307406_10680800 | 3300031901 | Bacteria | 857 |
| 323 | Ga0307412_10021971 | 3300031911 | Bacteria | 3904 |
| 324 | Ga0307412_10069539 | 3300031911 | Bacteria | 2397 |
| 325 | Ga0307412_10205664 | 3300031911 | Bacteria | 1498 |
| 326 | Ga0307412_10881956 | 3300031911 | Bacteria | 783 |
| 327 | Ga0307409_100358191 | 3300031995 | Bacteria | 1379 |
| 328 | Ga0307409_100373413 | 3300031995 | Bacteria | 1353 |
| 329 | Ga0307409_101270618 | 3300031995 | Bacteria | 761 |
| 330 | Ga0307416_100506068 | 3300032002 | Bacteria | 1273 |
| 331 | Ga0307416_100561127 | 3300032002 | Bacteria | 1217 |
| 332 | Ga0307414_10294130 | 3300032004 | Bacteria | 1370 |
| 333 | Ga0307411_10001686 | 3300032005 | Bacteria | 9255 |
| 334 | Ga0307411_10007222 | 3300032005 | Bacteria | 5634 |
| 335 | Ga0307411_10366328 | 3300032005 | Bacteria | 1180 |
| 336 | Ga0307507_10072829 | 3300033179 | Bacteria | 3093 |
| 337 | Ga0373932_0030684 | 3300035112 | Bacteria | 1492 |
| 338 | Ga0373932_0259455 | 3300035112 | Bacteria | 637 |
| 339 | Ga0373956_0389125 | 3300035119 | Bacteria | 665 |
| 340 | Ga0373931_0011014 | 3300035691 | Bacteria | 4360 |
| 341 | Ga0373927_0278669 | 3300035695 | Bacteria | 1100 |
| 342 | Ga0310110_009968 | 3300036535 | Bacteria | 1389 |
| 343 | Ga0373925_0230941 | 3300037068 | Bacteria | 1479 |
| 344 | Ga0395898_0035646 | 3300037466 | Bacteria | 4945 |
| 345 | Ga0395905_0000782 | 3300037471 | Bacteria | 41773 |
| 346 | Ga0395905_0029628 | 3300037471 | Bacteria | 5158 |
| 347 | Ga0395905_0376182 | 3300037471 | Bacteria | 1314 |
| 348 | Ga0395905_0516671 | 3300037471 | Bacteria | 1095 |
| 349 | Ga0395901_0164392 | 3300038443 | Bacteria | 2330 |
| 350 | Ga0436361_0089148 | 3300039447 | Bacteria | 4791 |
| 351 | Ga0436361_0674953 | 3300039447 | Bacteria | 2121 |
| 352 | Ga0451789_0665935 | 3300041443 | Bacteria | 761 |
| 353 | Ga0451795_1163136 | 3300041456 | Bacteria | 2854 |
| 354 | Ga0451837_1651674 | 3300041494 | Bacteria | 1057 |
| 355 | Ga0451853_0688630 | 3300041512 | Bacteria | 1206 |
| 356 | Ga0439449_0023753 | 3300042007 | Bacteria | 2293 |
| 357 | Ga0450917_007568 | 3300042120 | Bacteria | 830 |
| 358 | Ga0450888_007523 | 3300042126 | Bacteria | 1207 |
| 359 | Ga0450890_001567 | 3300042127 | Bacteria | 3288 |
| 360 | Ga0450892_000865 | 3300042130 | Bacteria | 3298 |
| 361 | Ga0450889_000295 | 3300042144 | Bacteria | 5611 |
| 362 | Ga0439459_0016544 | 3300042438 | Bacteria | 1364 |
| 363 | Ga0439464_0086757 | 3300042439 | Bacteria | 940 |
| 364 | Ga0450916_001506 | 3300042530 | Bacteria | 2341 |
| 365 | Ga0451577_0002689 | 3300042876 | Bacteria | 20732 |
| 366 | Ga0451577_0114053 | 3300042876 | Bacteria | 2419 |
| 367 | Ga0466969_0000010 | 3300044656 | Bacteria | 117215 |
| 368 | Ga0466963_0013321 | 3300044694 | Bacteria | 5049 |
| 369 | Ga0453684_0018778 | 3300044712 | Bacteria | 10582 |
| 370 | Ga0453684_0668863 | 3300044712 | Bacteria | 1131 |
| 371 | Ga0451576_0023757 | 3300045051 | Bacteria | 6633 |
| 372 | Ga0451576_0026680 | 3300045051 | Bacteria | 6211 |
| 373 | Ga0466967_0415475 | 3300045976 | Bacteria | 1310 |
| 374 | Ga0495617_000739 | 3300046452 | Bacteria | 16079 |
| 375 | Ga0495651_0272826 | 3300046462 | Bacteria | 1146 |
| 376 | Ga0495650_0003225 | 3300046471 | Bacteria | 12118 |
| 377 | Ga0495580_0074020 | 3300046472 | Bacteria | 2378 |
| 378 | Ga0495639_0008991 | 3300046475 | Bacteria | 4283 |
| 379 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 380 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 381 | Ga0495606_0000015 | 3300046507 | Bacteria | 288808 |
| 382 | Ga0495606_0002047 | 3300046507 | Bacteria | 24702 |
| 383 | Ga0495606_0379548 | 3300046507 | Bacteria | 742 |
| 384 | Ga0495610_0130149 | 3300046512 | Bacteria | 1093 |
| 385 | Ga0495616_0001036 | 3300046513 | Bacteria | 19887 |
| 386 | Ga0495643_0073530 | 3300046522 | Bacteria | 1791 |
| 387 | Ga0495648_0000012 | 3300046524 | Bacteria | 294111 |
| 388 | Ga0495642_0036103 | 3300046528 | Bacteria | 1997 |
| 389 | Ga0495609_0005783 | 3300046538 | Bacteria | 6424 |
| 390 | Ga0495611_0006678 | 3300046648 | Bacteria | 4908 |
| 391 | Ga0495625_0000836 | 3300046660 | Bacteria | 42292 |
| 392 | Ga0495625_0015143 | 3300046660 | Bacteria | 6120 |
| 393 | Ga0495658_0430497 | 3300046683 | Bacteria | 842 |
| 394 | Ga0495649_0000107 | 3300046694 | Bacteria | 74394 |
| 395 | Ga0495589_0012806 | 3300046794 | Bacteria | 4336 |
| 396 | Ga0495672_0118434 | 3300047320 | Bacteria | 1411 |
| 397 | Ga0495683_0052365 | 3300047323 | Bacteria | 2038 |
| 398 | Ga0495683_0097141 | 3300047323 | Bacteria | 1420 |
| 399 | Ga0495677_0005267 | 3300047445 | Bacteria | 4916 |
| 400 | Ga0495673_0024365 | 3300047469 | Bacteria | 2925 |
| 401 | Ga0495615_0020053 | 3300048090 | Bacteria | 1493 |
| 402 | Ga0496101_0507573 | 3300048904 | Bacteria | 953 |
| 403 | Ga0496102_0004336 | 3300048905 | Bacteria | 11995 |
| 404 | Ga0496102_0043870 | 3300048905 | Bacteria | 4056 |
| 405 | Ga0496104_0041019 | 3300048907 | Bacteria | 4339 |
| 406 | Ga0496104_0266443 | 3300048907 | Bacteria | 1626 |
| 407 | Ga0496104_0364401 | 3300048907 | Bacteria | 1358 |
| 408 | Ga0496104_0599432 | 3300048907 | Bacteria | 1012 |
| 409 | Ga0496105_0086151 | 3300048908 | Bacteria | 2596 |
| 410 | Ga0496105_0446326 | 3300048908 | Bacteria | 1022 |
| 411 | Ga0496106_0433763 | 3300048909 | Bacteria | 1056 |
| 412 | Ga0496108_0132577 | 3300048911 | Bacteria | 2142 |
| 413 | Ga0496109_0049985 | 3300048912 | Bacteria | 3809 |
| 414 | Ga0496109_0219499 | 3300048912 | Bacteria | 1788 |
| 415 | Ga0496109_0888812 | 3300048912 | Bacteria | 829 |
| 416 | Ga0496110_0234851 | 3300048913 | Bacteria | 1668 |
| 417 | Ga0496110_0263396 | 3300048913 | Bacteria | 1569 |
| 418 | Ga0496110_0926171 | 3300048913 | Bacteria | 778 |
| 419 | Ga0496112_0090918 | 3300048915 | Bacteria | 3021 |
| 420 | Ga0496113_0019957 | 3300048916 | Bacteria | 4701 |
| 421 | Ga0496126_0060046 | 3300048929 | Bacteria | 3422 |
| 422 | Ga0501306_019325 | 3300049127 | Bacteria | 939 |
| 423 | Ga0501306_022724 | 3300049127 | Bacteria | 886 |
| 424 | Ga0501306_023974 | 3300049127 | Bacteria | 869 |
| 425 | Ga0501306_036644 | 3300049127 | Bacteria | 748 |
| 426 | Ga0501306_038126 | 3300049127 | Bacteria | 737 |
| 427 | Ga0501306_047748 | 3300049127 | Bacteria | 680 |
| 428 | Ga0501308_008344 | 3300049128 | Bacteria | 1107 |
| 429 | Ga0501308_014112 | 3300049128 | Bacteria | 931 |
| 430 | Ga0501308_017156 | 3300049128 | Bacteria | 874 |
| 431 | Ga0501308_025863 | 3300049128 | Bacteria | 763 |
| 432 | Ga0501308_032844 | 3300049128 | Bacteria | 703 |
| 433 | Ga0501309_019874 | 3300049129 | Bacteria | 937 |
| 434 | Ga0501309_022375 | 3300049129 | Bacteria | 894 |
| 435 | Ga0501309_026787 | 3300049129 | Bacteria | 834 |
| 436 | Ga0501309_042344 | 3300049129 | Bacteria | 699 |
| 437 | Ga0501309_043192 | 3300049129 | Bacteria | 693 |
| 438 | Ga0501310_005408 | 3300049130 | Bacteria | 1310 |
| 439 | Ga0501310_015935 | 3300049130 | Bacteria | 896 |
| 440 | Ga0501310_016771 | 3300049130 | Bacteria | 881 |
| 441 | Ga0501310_032224 | 3300049130 | Bacteria | 701 |
| 442 | Ga0501304_002111 | 3300049160 | Bacteria | 1353 |
| 443 | Ga0501304_009171 | 3300049160 | Bacteria | 845 |
| 444 | Ga0501304_010073 | 3300049160 | Bacteria | 821 |
| 445 | Ga0501305_004967 | 3300049161 | Bacteria | 1589 |
| 446 | Ga0501305_025679 | 3300049161 | Bacteria | 894 |
| 447 | Ga0501305_061837 | 3300049161 | Bacteria | 646 |
| 448 | Ga0501307_014970 | 3300049162 | Bacteria | 953 |
| 449 | Ga0501307_015866 | 3300049162 | Bacteria | 934 |
| 450 | Ga0501307_036511 | 3300049162 | Bacteria | 701 |
| 451 | Ga0501301_001001 | 3300049524 | Bacteria | 1766 |
| 452 | Ga0501311_021877 | 3300049527 | Bacteria | 875 |
| 453 | Ga0501312_022694 | 3300049528 | Bacteria | 941 |
| 454 | Ga0501312_027371 | 3300049528 | Bacteria | 879 |
| 455 | Ga0501312_041842 | 3300049528 | Bacteria | 751 |
| 456 | Ga0501313_004639 | 3300049529 | Bacteria | 1420 |
| 457 | Ga0501313_012288 | 3300049529 | Bacteria | 996 |
| 458 | Ga0501313_022124 | 3300049529 | Bacteria | 791 |
| 459 | Ga0501314_005403 | 3300049530 | Bacteria | 1087 |
| 460 | Ga0501314_006300 | 3300049530 | Bacteria | 1031 |
| 461 | Ga0501314_009495 | 3300049530 | Bacteria | 894 |
| 462 | Ga0501314_010826 | 3300049530 | Bacteria | 854 |
| 463 | Ga0501315_013319 | 3300049531 | Bacteria | 1028 |
| 464 | Ga0501315_013691 | 3300049531 | Bacteria | 1019 |
| 465 | Ga0501315_019056 | 3300049531 | Bacteria | 910 |
| 466 | Ga0501315_020848 | 3300049531 | Bacteria | 883 |
| 467 | Ga0501315_046432 | 3300049531 | Bacteria | 671 |
| 468 | Ga0501316_014237 | 3300049532 | Bacteria | 947 |
| 469 | Ga0501318_016402 | 3300049534 | Bacteria | 895 |
| 470 | Ga0501321_008375 | 3300049537 | Bacteria | 1096 |
| 471 | Ga0501321_015649 | 3300049537 | Bacteria | 895 |
| 472 | Ga0501321_032352 | 3300049537 | Bacteria | 705 |
| 473 | Ga0501321_034690 | 3300049537 | Bacteria | 688 |
| 474 | Ga0501321_044859 | 3300049537 | Bacteria | 632 |
| 475 | Ga0501322_004430 | 3300049538 | Bacteria | 944 |
| 476 | Ga0501322_005818 | 3300049538 | Bacteria | 863 |
| 477 | Ga0501322_006249 | 3300049538 | Bacteria | 844 |
| 478 | Ga0501322_007047 | 3300049538 | Bacteria | 811 |
| 479 | Ga0501322_009782 | 3300049538 | Bacteria | 730 |
| 480 | Ga0501322_011512 | 3300049538 | Bacteria | 693 |
| 481 | Ga0501323_037184 | 3300049539 | Bacteria | 703 |
| 482 | Ga0501324_008437 | 3300049540 | Bacteria | 908 |
| 483 | Ga0501325_021040 | 3300049541 | Bacteria | 688 |
| 484 | Ga0501334_10657 | 3300049550 | Bacteria | 666 |
| 485 | Ga0501340_004446 | 3300049556 | Bacteria | 884 |
| 486 | Ga0501032_0115274 | 3300049569 | Bacteria | 1777 |
| 487 | Ga0501034_0274939 | 3300049571 | Bacteria | 1625 |
| 488 | Ga0501043_0000002 | 3300049579 | Bacteria | 351081 |
| 489 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 490 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 491 | Ga0501048_0122131 | 3300049582 | Bacteria | 1840 |
| 492 | Ga0501211_011872 | 3300049658 | Bacteria | 859 |
| 493 | Ga0501227_010609 | 3300049665 | Bacteria | 1999 |
| 494 | Ga0501252_008151 | 3300049682 | Bacteria | 1200 |
| 495 | Ga0501255_007710 | 3300049684 | Bacteria | 1148 |
| 496 | Ga0501045_0001048 | 3300049824 | Bacteria | 18195 |
| 497 | nmdc:mga03683_208573_c1 | 3300050489 | Bacteria | 898 |
| 498 | nmdc:mga03n38_96993_c1 | 3300050490 | Bacteria | 1415 |
| 499 | nmdc:mga0k408_1147_c1 | 3300050493 | Bacteria | 14519 |
| 500 | nmdc:mga0k408_137125_c1 | 3300050493 | Bacteria | 1454 |
| 501 | nmdc:mga0k408_14103_c1 | 3300050493 | Bacteria | 4395 |
| 502 | nmdc:mga0k408_298415_c1 | 3300050493 | Bacteria | 962 |
| 503 | nmdc:mga0k408_32895_c1 | 3300050493 | Bacteria | 2963 |
| 504 | nmdc:mga0k408_4840_c1 | 3300050493 | Bacteria | 7141 |
| 505 | nmdc:mga0k408_533_c1 | 3300050493 | Bacteria | 20949 |
| 506 | nmdc:mga07m45_114_c1 | 3300050496 | Bacteria | 32256 |
| 507 | nmdc:mga07m45_14185_c1 | 3300050496 | Bacteria | 4240 |
| 508 | nmdc:mga09592_2396_c1 | 3300050508 | Bacteria | 15137 |
| 509 | nmdc:mga0a205_200296_c1 | 3300050515 | Unclassified | 1887 |
| 510 | Ga0495655_0176144 | 3300053083 | Unclassified | 687 |
| 511 | Ga0500578_0256687 | 3300053086 | Bacteria | 1051 |
| 512 | Ga0500608_092540 | 3300053122 | Bacteria | 1411 |
| 513 | Ga0500559_0030666 | 3300053136 | Bacteria | 2306 |
| 514 | Ga0500590_019010 | 3300053148 | Bacteria | 3560 |
| 515 | Ga0500619_000030 | 3300053154 | Bacteria | 46680 |
| 516 | Ga0500636_0002776 | 3300053177 | Bacteria | 9766 |
| 517 | Ga0500587_002994 | 3300053739 | Bacteria | 2391 |
| 518 | Ga0500661_004209 | 3300055283 | Bacteria | 2692 |
| 519 | Ga0466962_0231622 | 3300061719 | Bacteria | 906 |
| 520 | 2587756789 | 2585428062 | Bacteria | 6842168 |
| 521 | 2643743391 | 2643221544 | Bacteria | 5886209 |
| 522 | 2643932569 | 2643221585 | Bacteria | 5812563 |
| 523 | 2644260839 | 2643221646 | Bacteria | 6433402 |
| 524 | 2644313820 | 2643221656 | Bacteria | 5809961 |
| 525 | 2739056312 | 2738541337 | Bacteria | 6183410 |
| 526 | 2932413186 | 2932410948 | Bacteria | 6312192 |
| 527 | 2932417247 | 2932416698 | Bacteria | 6315112 |
| 528 | 8055228875 | 8055225921 | Bacteria | 3341787 |
| 529 | Ga0451576_0268650 | |||
| 530 | JGI25156J39149_1019066 | |||
| 531 | JGI25154J39366_1004745 | |||
| 532 | JGI25157J39369_1000038 | |||
| 533 | JGI25152J39213_1016178 | |||
| 534 | JGI25150J39212_1000655 | |||
| 535 | JGI25159J45721_1010954 | |||
| 536 | JGI25153J46596_10007539 | |||
| 537 | rootH1_10003266 | |||
| 538 | rootL2_10047996 | |||
| 539 | rootL2_10072243 | |||
| 540 | rootL2_10074193 | |||
| 541 | rootH1_10001251 | |||
| 542 | rootH1_10025546 | |||
| 543 | JGI25161J50226_1000182 | |||
| 544 | Ga0055539_1002371 | |||
| 545 | Ga0055533_1000026 | |||
| 546 | Ga0055525_1000525 | |||
| 547 | Ga0055526_1000780 | |||
| 548 | Ga0055526_1003391 | |||
| 549 | Ga0055537_1003470 | |||
| 550 | Ga0055524_1000187 | |||
| 551 | Ga0055524_1018949 | |||
| 552 | Ga0055524_1023255 | |||
| 553 | Ga0055534_1002067 | |||
| 554 | Ga0055528_1003283 | |||
| 555 | Ga0055530_10000444 | |||
| 556 | Ga0055530_10001759 | |||
| 557 | Ga0055531_10000001 | |||
| 558 | Ga0055531_10001467 | |||
| 559 | Ga0055543_1000112 | |||
| 560 | Ga0065165_1005676 | |||
| 561 | Ga0065712_10179619 | |||
| 562 | Ga0065715_10119799 | |||
| 563 | Ga0070658_10022875 | |||
| 564 | Ga0070658_10055262 | |||
| 565 | Ga0070676_10287396 | |||
| 566 | Ga0070690_100646440 | |||
| 567 | Ga0070670_100316581 | |||
| 568 | Ga0070670_100762186 | |||
| 569 | Ga0070677_10001601 | |||
| 570 | Ga0070677_10252453 | |||
| 571 | Ga0068869_100794247 | |||
| 572 | Ga0070682_100040109 | |||
| 573 | Ga0070682_100645589 | |||
| 574 | Ga0068868_100011500 | |||
| 575 | Ga0070660_100007544 | |||
| 576 | Ga0070660_100023161 | |||
| 577 | Ga0070660_100085866 | |||
| 578 | Ga0070689_100268722 | |||
| 579 | Ga0070661_100219477 | |||
| 580 | Ga0070669_100008226 | |||
| 581 | Ga0070675_100001473 | |||
| 582 | Ga0070675_100242132 | |||
| 583 | Ga0070671_100011093 | |||
| 584 | Ga0070671_100030101 | |||
| 585 | Ga0070674_100002004 | |||
| 586 | Ga0070674_100327471 | |||
| 587 | Ga0070673_100030008 | |||
| 588 | Ga0070673_100050971 | |||
| 589 | Ga0070673_100733199 | |||
| 590 | Ga0070667_100113363 | |||
| 591 | Ga0070667_100145705 | |||
| 592 | Ga0070700_100794532 | |||
| 593 | Ga0070708_100000818 | |||
| 594 | Ga0070678_100005561 | |||
| 595 | Ga0070678_100152466 | |||
| 596 | Ga0070678_100616722 | |||
| 597 | Ga0070678_100868289 | |||
| 598 | Ga0070662_100005173 | |||
| 599 | Ga0070662_100389227 | |||
| 600 | Ga0068867_100000086 | |||
| 601 | Ga0068867_100096314 | |||
| 602 | Ga0068867_100160265 | |||
| 603 | Ga0068867_100253022 | |||
| 604 | Ga0070699_100273387 | |||
| 605 | Ga0070684_100223041 | |||
| 606 | Ga0068853_100388325 | |||
| 607 | Ga0068853_100981307 | |||
| 608 | Ga0070672_100000367 | |||
| 609 | Ga0070672_100007805 | |||
| 610 | Ga0070686_100289371 | |||
| 611 | Ga0070665_100068041 | |||
| 612 | Ga0068855_100001767 | |||
| 613 | Ga0068855_100038331 | |||
| 614 | Ga0068855_100289055 | |||
| 615 | Ga0068855_100653855 | |||
| 616 | Ga0070664_100029166 | |||
| 617 | Ga0068857_100004097 | |||
| 618 | Ga0068857_100156332 | |||
| 619 | Ga0068854_100009523 | |||
| 620 | Ga0068856_100002296 | |||
| 621 | Ga0068856_101183924 | |||
| 622 | Ga0068852_100786968 | |||
| 623 | Ga0068852_100875522 | |||
| 624 | Ga0068859_100918221 | |||
| 625 | Ga0068864_100018312 | |||
| 626 | Ga0068864_100023287 | |||
| 627 | Ga0068864_100142004 | |||
| 628 | Ga0068861_100906416 | |||
| 629 | Ga0068870_10139262 | |||
| 630 | Ga0068863_100074674 | |||
| 631 | Ga0068860_100410901 | |||
| 632 | Ga0068862_100031756 | |||
| 633 | Ga0068862_100144841 | |||
| 634 | Ga0075432_10066585 | |||
| 635 | Ga0075362_10222980 | |||
| 636 | Ga0075366_10001671 | |||
| 637 | Ga0075366_10002150 | |||
| 638 | Ga0075366_10014138 | |||
| 639 | Ga0075366_10028889 | |||
| 640 | Ga0075366_10101444 | |||
| 641 | Ga0075366_10102319 | |||
| 642 | Ga0075366_10205226 | |||
| 643 | Ga0075366_10214769 | |||
| 644 | Ga0075366_10226641 | |||
| 645 | Ga0075366_10307601 | |||
| 646 | Ga0075370_10001645 | |||
| 647 | Ga0075370_10038071 | |||
| 648 | Ga0075370_10063586 | |||
| 649 | Ga0068871_100394113 | |||
| 650 | Ga0068871_100532837 | |||
| 651 | Ga0075429_100014531 | |||
| 652 | Ga0097620_100918226 | |||
| 653 | Ga0075435_100102283 | |||
| 654 | Ga0105240_10018658 | |||
| 655 | Ga0105247_10289544 | |||
| 656 | Ga0105243_10010856 | |||
| 657 | Ga0105243_10047416 | |||
| 658 | Ga0105243_10171712 | |||
| 659 | Ga0105243_10751321 | |||
| 660 | Ga0105241_10009231 | |||
| 661 | Ga0105242_10055776 | |||
| 662 | Ga0105248_10000471 | |||
| 663 | Ga0105248_10001875 | |||
| 664 | Ga0105248_10146220 | |||
| 665 | Ga0105237_10429091 | |||
| 666 | Ga0105238_10047236 | |||
| 667 | Ga0105239_10021588 | |||
| 668 | Ga0105239_10507692 | |||
| 669 | Ga0157373_10004343 | |||
| 670 | Ga0157370_10348212 | |||
| 671 | Ga0157369_10029515 | |||
| 672 | Ga0157374_10064011 | |||
| 673 | Ga0157378_10568233 | |||
| 674 | Ga0157378_10690996 | |||
| 675 | Ga0163162_10283320 | |||
| 676 | Ga0163162_10388153 | |||
| 677 | Ga0157372_10224846 | |||
| 678 | Ga0157375_10410376 | |||
| 679 | Ga0157375_10849141 | |||
| 680 | Ga0163163_10028813 | |||
| 681 | Ga0163163_10660601 | |||
| 682 | Ga0157377_10000038 | |||
| 683 | Ga0157379_10615951 | |||
| 684 | Ga0157379_10620012 | |||
| 685 | Ga0157376_10016519 | |||
| 686 | Ga0157376_10319849 | |||
| 687 | Ga0163161_10060906 | |||
| 688 | Ga0163161_10149756 | |||
| 689 | Ga0163161_10393364 | |||
| 690 | Ga0206352_10163021 | |||
| 691 | Ga0213872_10011831 | |||
| 692 | Ga0213872_10087888 | |||
| 693 | Ga0209436_100484 | |||
| 694 | Ga0209436_102860 | |||
| 695 | Ga0209674_100024 | |||
| 696 | Ga0209563_100069 | |||
| 697 | Ga0207427_101384 | |||
| 698 | Ga0209258_100870 | |||
| 699 | Ga0207425_1000001 | |||
| 700 | Ga0207425_1000130 | |||
| 701 | Ga0209646_1000012 | |||
| 702 | Ga0209026_1000004 | |||
| 703 | Ga0209677_100048 | |||
| 704 | Ga0209677_100263 | |||
| 705 | Ga0209677_101400 | |||
| 706 | Ga0209759_1000003 | |||
| 707 | Ga0209759_1001348 | |||
| 708 | Ga0209759_1003047 | |||
| 709 | Ga0209759_1013641 | |||
| 710 | Ga0209129_1000003 | |||
| 711 | Ga0209129_1008481 | |||
| 712 | Ga0209565_1000572 | |||
| 713 | Ga0209565_1000878 | |||
| 714 | Ga0209565_1003147 | |||
| 715 | Ga0209130_1000237 | |||
| 716 | Ga0209130_1004662 | |||
| 717 | Ga0209675_1004686 | |||
| 718 | Ga0209675_1031846 | |||
| 719 | Ga0209564_1000311 | |||
| 720 | Ga0209564_1042286 | |||
| 721 | Ga0209758_1000041 | |||
| 722 | Ga0209050_1000011 | |||
| 723 | Ga0209050_1000280 | |||
| 724 | Ga0209050_1000664 | |||
| 725 | Ga0209050_1001427 | |||
| 726 | Ga0209256_1000068 | |||
| 727 | Ga0209256_1000952 | |||
| 728 | Ga0209256_1038346 | |||
| 729 | Ga0207426_1003864 | |||
| 730 | Ga0209051_1006353 | |||
| 731 | Ga0209051_1015749 | |||
| 732 | Ga0209257_1000003 | |||
| 733 | Ga0209257_1000033 | |||
| 734 | Ga0209257_1010241 | |||
| 735 | Ga0209257_1010307 | |||
| 736 | Ga0207682_10001930 | |||
| 737 | Ga0207682_10168334 | |||
| 738 | Ga0207692_10066964 | |||
| 739 | Ga0207680_10075899 | |||
| 740 | Ga0207645_10083293 | |||
| 741 | Ga0207643_10122785 | |||
| 742 | Ga0207705_10018721 | |||
| 743 | Ga0207705_10064063 | |||
| 744 | Ga0207654_10034576 | |||
| 745 | Ga0207695_10015011 | |||
| 746 | Ga0207671_10205106 | |||
| 747 | Ga0207657_10035980 | |||
| 748 | Ga0207657_10340135 | |||
| 749 | Ga0207649_10140899 | |||
| 750 | Ga0207649_10256540 | |||
| 751 | Ga0207681_10134357 | |||
| 752 | Ga0207694_10003229 | |||
| 753 | Ga0207650_10002288 | |||
| 754 | Ga0207650_10261946 | |||
| 755 | Ga0207659_10008394 | |||
| 756 | Ga0207659_10266419 | |||
| 757 | Ga0207644_10004038 | |||
| 758 | Ga0207644_10012860 | |||
| 759 | Ga0207644_10019766 | |||
| 760 | Ga0207644_10186620 | |||
| 761 | Ga0207690_10084713 | |||
| 762 | Ga0207706_10011506 | |||
| 763 | Ga0207706_10064935 | |||
| 764 | Ga0207686_10220807 | |||
| 765 | Ga0207709_10009847 | |||
| 766 | Ga0207709_10047846 | |||
| 767 | Ga0207709_10095285 | |||
| 768 | Ga0207709_10412626 | |||
| 769 | Ga0207669_10408656 | |||
| 770 | Ga0207691_10001841 | |||
| 771 | Ga0207691_10283967 | |||
| 772 | Ga0207711_10001495 | |||
| 773 | Ga0207711_10085580 | |||
| 774 | Ga0207689_10714861 | |||
| 775 | Ga0207679_10087070 | |||
| 776 | Ga0207667_10003101 | |||
| 777 | Ga0207667_10013387 | |||
| 778 | Ga0207667_10061040 | |||
| 779 | Ga0207651_10004659 | |||
| 780 | Ga0207651_10007681 | |||
| 781 | Ga0207658_10026500 | |||
| 782 | Ga0207658_10046373 | |||
| 783 | Ga0207677_10010426 | |||
| 784 | Ga0207677_10205238 | |||
| 785 | Ga0207639_10039927 | |||
| 786 | Ga0207639_10226783 | |||
| 787 | Ga0207639_10230622 | |||
| 788 | Ga0207702_10005216 | |||
| 789 | Ga0207702_10586637 | |||
| 790 | Ga0207641_10303652 | |||
| 791 | Ga0207641_10436134 | |||
| 792 | Ga0207641_10947338 | |||
| 793 | Ga0207648_10000053 | |||
| 794 | Ga0207648_10017318 | |||
| 795 | Ga0207648_10075975 | |||
| 796 | Ga0207648_10177150 | |||
| 797 | Ga0207676_10021173 | |||
| 798 | Ga0207676_10027340 | |||
| 799 | Ga0207676_10266404 | |||
| 800 | Ga0207675_100047872 | |||
| 801 | Ga0207675_101005551 | |||
| 802 | Ga0207683_10005954 | |||
| 803 | Ga0207683_10181403 | |||
| 804 | Ga0207683_10505360 | |||
| 805 | Ga0207698_10468311 | |||
| 806 | Ga0207698_11412983 | |||
| 807 | Ga0209998_10048829 | |||
| 808 | Ga0209974_10004417 | |||
| 809 | Ga0268266_10334911 | |||
| 810 | Ga0268265_10396457 | |||
| 811 | Ga0268264_10684018 | |||
| 812 | Ga0307515_10001629 | |||
| 813 | Ga0307515_10066207 | |||
| 814 | Ga0307515_10076602 | |||
| 815 | Ga0307515_10087646 | |||
| 816 | Ga0307515_10185483 | |||
| 817 | Ga0307515_10248555 | |||
| 818 | Ga0307515_10381387 | |||
| 819 | Ga0265324_10023001 | |||
| 820 | Ga0307512_10034290 | |||
| 821 | Ga0265330_10003812 | |||
| 822 | Ga0265332_10000841 | |||
| 823 | Ga0265325_10033294 | |||
| 824 | Ga0265339_10024672 | |||
| 825 | Ga0265331_10000936 | |||
| 826 | Ga0265327_10016553 | |||
| 827 | Ga0265316_10081530 | |||
| 828 | Ga0307513_10018405 | |||
| 829 | Ga0307513_10056239 | |||
| 830 | Ga0307513_10208749 | |||
| 831 | Ga0307408_100000016 | |||
| 832 | Ga0307408_100001185 | |||
| 833 | Ga0307408_100137393 | |||
| 834 | Ga0307408_100259889 | |||
| 835 | Ga0307408_100790460 | |||
| 836 | Ga0307508_10000133 | |||
| 837 | Ga0307508_10008282 | |||
| 838 | Ga0307514_10001199 | |||
| 839 | Ga0310114_106115 | |||
| 840 | Ga0265314_10022857 | |||
| 841 | Ga0265314_10088545 | |||
| 842 | Ga0265342_10011638 | |||
| 843 | Ga0307516_10001653 | |||
| 844 | Ga0307516_10004130 | |||
| 845 | Ga0307516_10529591 | |||
| 846 | Ga0307405_10143158 | |||
| 847 | Ga0307413_10008938 | |||
| 848 | Ga0307413_10865361 | |||
| 849 | Ga0307410_10006974 | |||
| 850 | Ga0307406_10680800 | |||
| 851 | Ga0307412_10021971 | |||
| 852 | Ga0307412_10069539 | |||
| 853 | Ga0307412_10205664 | |||
| 854 | Ga0307412_10881956 | |||
| 855 | Ga0307409_100358191 | |||
| 856 | Ga0307409_100373413 | |||
| 857 | Ga0307409_101270618 | |||
| 858 | Ga0307416_100506068 | |||
| 859 | Ga0307416_100561127 | |||
| 860 | Ga0307414_10294130 | |||
| 861 | Ga0307411_10001686 | |||
| 862 | Ga0307411_10007222 | |||
| 863 | Ga0307411_10366328 | |||
| 864 | Ga0307507_10072829 | |||
| 865 | Ga0373932_0030684 | |||
| 866 | Ga0373932_0259455 | |||
| 867 | Ga0373956_0389125 | |||
| 868 | Ga0373931_0011014 | |||
| 869 | Ga0373927_0278669 | |||
| 870 | Ga0310110_009968 | |||
| 871 | Ga0373925_0230941 | |||
| 872 | Ga0395898_0035646 | |||
| 873 | Ga0395905_0000782 | |||
| 874 | Ga0395905_0029628 | |||
| 875 | Ga0395905_0376182 | |||
| 876 | Ga0395905_0516671 | |||
| 877 | Ga0395901_0164392 | |||
| 878 | Ga0436361_0089148 | |||
| 879 | Ga0436361_0674953 | |||
| 880 | Ga0451789_0665935 | |||
| 881 | Ga0451795_1163136 | |||
| 882 | Ga0451837_1651674 | |||
| 883 | Ga0451853_0688630 | |||
| 884 | Ga0439449_0023753 | |||
| 885 | Ga0450917_007568 | |||
| 886 | Ga0450888_007523 | |||
| 887 | Ga0450890_001567 | |||
| 888 | Ga0450892_000865 | |||
| 889 | Ga0450889_000295 | |||
| 890 | Ga0439459_0016544 | |||
| 891 | Ga0439464_0086757 | |||
| 892 | Ga0450916_001506 | |||
| 893 | Ga0451577_0002689 | |||
| 894 | Ga0451577_0114053 | |||
| 895 | Ga0466969_0000010 | |||
| 896 | Ga0466963_0013321 | |||
| 897 | Ga0453684_0018778 | |||
| 898 | Ga0453684_0668863 | |||
| 899 | Ga0451576_0023757 | |||
| 900 | Ga0451576_0026680 | |||
| 901 | Ga0466967_0415475 | |||
| 902 | Ga0495617_000739 | |||
| 903 | Ga0495651_0272826 | |||
| 904 | Ga0495650_0003225 | |||
| 905 | Ga0495580_0074020 | |||
| 906 | Ga0495639_0008991 | |||
| 907 | Ga0495585_0000002 | |||
| 908 | Ga0495583_0000022 | |||
| 909 | Ga0495606_0000015 | |||
| 910 | Ga0495606_0002047 | |||
| 911 | Ga0495606_0379548 | |||
| 912 | Ga0495610_0130149 | |||
| 913 | Ga0495616_0001036 | |||
| 914 | Ga0495643_0073530 | |||
| 915 | Ga0495648_0000012 | |||
| 916 | Ga0495642_0036103 | |||
| 917 | Ga0495609_0005783 | |||
| 918 | Ga0495611_0006678 | |||
| 919 | Ga0495625_0000836 | |||
| 920 | Ga0495625_0015143 | |||
| 921 | Ga0495658_0430497 | |||
| 922 | Ga0495649_0000107 | |||
| 923 | Ga0495589_0012806 | |||
| 924 | Ga0495672_0118434 | |||
| 925 | Ga0495683_0052365 | |||
| 926 | Ga0495683_0097141 | |||
| 927 | Ga0495677_0005267 | |||
| 928 | Ga0495673_0024365 | |||
| 929 | Ga0495615_0020053 | |||
| 930 | Ga0496101_0507573 | |||
| 931 | Ga0496102_0004336 | |||
| 932 | Ga0496102_0043870 | |||
| 933 | Ga0496104_0041019 | |||
| 934 | Ga0496104_0266443 | |||
| 935 | Ga0496104_0364401 | |||
| 936 | Ga0496104_0599432 | |||
| 937 | Ga0496105_0086151 | |||
| 938 | Ga0496105_0446326 | |||
| 939 | Ga0496106_0433763 | |||
| 940 | Ga0496108_0132577 | |||
| 941 | Ga0496109_0049985 | |||
| 942 | Ga0496109_0219499 | |||
| 943 | Ga0496109_0888812 | |||
| 944 | Ga0496110_0234851 | |||
| 945 | Ga0496110_0263396 | |||
| 946 | Ga0496110_0926171 | |||
| 947 | Ga0496112_0090918 | |||
| 948 | Ga0496113_0019957 | |||
| 949 | Ga0496126_0060046 | |||
| 950 | Ga0501306_019325 | |||
| 951 | Ga0501306_022724 | |||
| 952 | Ga0501306_023974 | |||
| 953 | Ga0501306_036644 | |||
| 954 | Ga0501306_038126 | |||
| 955 | Ga0501306_047748 | |||
| 956 | Ga0501308_008344 | |||
| 957 | Ga0501308_014112 | |||
| 958 | Ga0501308_017156 | |||
| 959 | Ga0501308_025863 | |||
| 960 | Ga0501308_032844 | |||
| 961 | Ga0501309_019874 | |||
| 962 | Ga0501309_022375 | |||
| 963 | Ga0501309_026787 | |||
| 964 | Ga0501309_042344 | |||
| 965 | Ga0501309_043192 | |||
| 966 | Ga0501310_005408 | |||
| 967 | Ga0501310_015935 | |||
| 968 | Ga0501310_016771 | |||
| 969 | Ga0501310_032224 | |||
| 970 | Ga0501304_002111 | |||
| 971 | Ga0501304_009171 | |||
| 972 | Ga0501304_010073 | |||
| 973 | Ga0501305_004967 | |||
| 974 | Ga0501305_025679 | |||
| 975 | Ga0501305_061837 | |||
| 976 | Ga0501307_014970 | |||
| 977 | Ga0501307_015866 | |||
| 978 | Ga0501307_036511 | |||
| 979 | Ga0501301_001001 | |||
| 980 | Ga0501311_021877 | |||
| 981 | Ga0501312_022694 | |||
| 982 | Ga0501312_027371 | |||
| 983 | Ga0501312_041842 | |||
| 984 | Ga0501313_004639 | |||
| 985 | Ga0501313_012288 | |||
| 986 | Ga0501313_022124 | |||
| 987 | Ga0501314_005403 | |||
| 988 | Ga0501314_006300 | |||
| 989 | Ga0501314_009495 | |||
| 990 | Ga0501314_010826 | |||
| 991 | Ga0501315_013319 | |||
| 992 | Ga0501315_013691 | |||
| 993 | Ga0501315_019056 | |||
| 994 | Ga0501315_020848 | |||
| 995 | Ga0501315_046432 | |||
| 996 | Ga0501316_014237 | |||
| 997 | Ga0501318_016402 | |||
| 998 | Ga0501321_008375 | |||
| 999 | Ga0501321_015649 | |||
| 1000 | Ga0501321_032352 | |||
| 1001 | Ga0501321_034690 | |||
| 1002 | Ga0501321_044859 | |||
| 1003 | Ga0501322_004430 | |||
| 1004 | Ga0501322_005818 | |||
| 1005 | Ga0501322_006249 | |||
| 1006 | Ga0501322_007047 | |||
| 1007 | Ga0501322_009782 | |||
| 1008 | Ga0501322_011512 | |||
| 1009 | Ga0501323_037184 | |||
| 1010 | Ga0501324_008437 | |||
| 1011 | Ga0501325_021040 | |||
| 1012 | Ga0501334_10657 | |||
| 1013 | Ga0501340_004446 | |||
| 1014 | Ga0501032_0115274 | |||
| 1015 | Ga0501034_0274939 | |||
| 1016 | Ga0501043_0000002 | |||
| 1017 | Ga0501046_0000008 | |||
| 1018 | Ga0501047_0000003 | |||
| 1019 | Ga0501048_0122131 | |||
| 1020 | Ga0501211_011872 | |||
| 1021 | Ga0501227_010609 | |||
| 1022 | Ga0501252_008151 | |||
| 1023 | Ga0501255_007710 | |||
| 1024 | Ga0501045_0001048 | |||
| 1025 | nmdc:mga03683_208573_c1 | |||
| 1026 | nmdc:mga03n38_96993_c1 | |||
| 1027 | nmdc:mga0k408_1147_c1 | |||
| 1028 | nmdc:mga0k408_137125_c1 | |||
| 1029 | nmdc:mga0k408_14103_c1 | |||
| 1030 | nmdc:mga0k408_298415_c1 | |||
| 1031 | nmdc:mga0k408_32895_c1 | |||
| 1032 | nmdc:mga0k408_4840_c1 | |||
| 1033 | nmdc:mga0k408_533_c1 | |||
| 1034 | nmdc:mga07m45_114_c1 | |||
| 1035 | nmdc:mga07m45_14185_c1 | |||
| 1036 | nmdc:mga09592_2396_c1 | |||
| 1037 | nmdc:mga0a205_200296_c1 | |||
| 1038 | Ga0495655_0176144 | |||
| 1039 | Ga0500578_0256687 | |||
| 1040 | Ga0500608_092540 | |||
| 1041 | Ga0500559_0030666 | |||
| 1042 | Ga0500590_019010 | |||
| 1043 | Ga0500619_000030 | |||
| 1044 | Ga0500636_0002776 | |||
| 1045 | Ga0500587_002994 | |||
| 1046 | Ga0500661_004209 | |||
| 1047 | Ga0466962_0231622 | |||
| 1048 | 2587756789 | |||
| 1049 | 2643743391 | |||
| 1050 | 2643932569 | |||
| 1051 | 2644260839 | |||
| 1052 | 2644313820 | |||
| 1053 | 2739056312 | |||
| 1054 | 2932413186 | |||
| 1055 | 2932417247 | |||
| 1056 | 8055228875 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z9b-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals | 0.9537 | 1 | 200 |
| 2z98-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) | 0.9533 | 1 | 200 |
| 7n2x-assembly1.cif.gz_A | the crystal structure of an fmn-dependent nadh:quinone oxidoreductase, azor from escherichia coli | 0.9496 | 2 | 200 |
| 1tik-assembly1.cif.gz_A | crystal structure of acyl carrier protein phosphodiesterase | 0.9494 | 2 | 200 |
| 1t5b-assembly1.cif.gz_B | structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase | 0.9483 | 2 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9472 | 2 | 200 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9186 | 1 | 199 | 3.40.50.360 |
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9064 | 2 | 200 | 3.40.50.360 |
| 6dxpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8959 | 2 | 199 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8924 | 1 | 199 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519ZS40-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9888 | 1 | 203 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-U3TZ50-F1-model_v4 | NAD(P)H dehydrogenase | 0.9887 | 79 | 202 |
|
| AF-A0A149PSZ8-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9861 | 2 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-Q2SUH7-F1-model_v4 | FMN-dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9858 | 2 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-A0A132C5Q7-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9856 | 2 | 200 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |