F459710

General Info

Members Datasets Scaffolds Average Seq Length
528 311 1056 202

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0268650|Ga0451576_0268650_463_1050
Length 195
Sequence MNILQINASIRGAASHSSRLASEVVARLQGAGDTVQLRDLGANPPATIDPAALQALFTPAEQRTPEQAARVAQDDALIAELQAADTLVIGMPMYNFTVPVQFKSWLDAICRAQVTFRYTANGPEGLLTGKRAVIVLARGGNYTPDSDTQVPYLRQVLGFVGITDITFIHAEGLNLGPDAEAAALASARSAIAALA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
177 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
202 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
206 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
207 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
208 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
209 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
210 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
262 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
283 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
284 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
285 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
299 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
300 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
301 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
304 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
305 2643221585 Pelomonas sp. Root662 Isolate Unclassified
306 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
307 2643221656 Pelomonas sp. Root405 Isolate Unclassified
308 2738541337 Pelomonas sp. BT06 Isolate Unclassified
309 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
310 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
311 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.8
Metatranscriptomes 12.5
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.42
Nodule 0
Rhizoplane 3.98
Rhizosphere 70.45
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0268650 3300045051 Bacteria 1783
2 JGI25156J39149_1019066 3300002705 Bacteria 1248
3 JGI25154J39366_1004745 3300002738 Bacteria 2339
4 JGI25157J39369_1000038 3300002741 Bacteria 130270
5 JGI25152J39213_1016178 3300002773 Bacteria 1448
6 JGI25150J39212_1000655 3300002774 Bacteria 12871
7 JGI25159J45721_1010954 3300002987 Unclassified 2260
8 JGI25153J46596_10007539 3300003215 Bacteria 5330
9 rootH1_10003266 3300003316 Bacteria 13926
10 rootL2_10047996 3300003322 Bacteria 3629
11 rootL2_10072243 3300003322 Bacteria 2728
12 rootL2_10074193 3300003322 Bacteria 3346
13 rootH1_10001251 3300003323 Bacteria 8205
14 rootH1_10025546 3300003323 Bacteria 7590
15 JGI25161J50226_1000182 3300003374 Bacteria 42010
16 Ga0055539_1002371 3300003752 Bacteria 2924
17 Ga0055533_1000026 3300003756 Bacteria 323407
18 Ga0055525_1000525 3300003759 Bacteria 18477
19 Ga0055526_1000780 3300003771 Bacteria 23749
20 Ga0055526_1003391 3300003771 Bacteria 10146
21 Ga0055537_1003470 3300003773 Bacteria 4844
22 Ga0055524_1000187 3300003775 Bacteria 68927
23 Ga0055524_1018949 3300003775 Bacteria 2369
24 Ga0055524_1023255 3300003775 Unclassified 2000
25 Ga0055534_1002067 3300003784 Bacteria 7243
26 Ga0055528_1003283 3300003790 Bacteria 8223
27 Ga0055530_10000444 3300003791 Bacteria 36774
28 Ga0055530_10001759 3300003791 Bacteria 15132
29 Ga0055531_10000001 3300003794 Bacteria 543586
30 Ga0055531_10001467 3300003794 Bacteria 17357
31 Ga0055543_1000112 3300004625 Bacteria 69589
32 Ga0065165_1005676 3300005262 Bacteria 6881
33 Ga0065712_10179619 3300005290 Bacteria 1199
34 Ga0065715_10119799 3300005293 Bacteria 2276
35 Ga0070658_10022875 3300005327 Bacteria 5016
36 Ga0070658_10055262 3300005327 Bacteria 3225
37 Ga0070676_10287396 3300005328 Bacteria 1110
38 Ga0070690_100646440 3300005330 Bacteria 807
39 Ga0070670_100316581 3300005331 Bacteria 1366
40 Ga0070670_100762186 3300005331 Bacteria 872
41 Ga0070677_10001601 3300005333 Bacteria 7161
42 Ga0070677_10252453 3300005333 Bacteria 876
43 Ga0068869_100794247 3300005334 Bacteria 813
44 Ga0070682_100040109 3300005337 Bacteria 2880
45 Ga0070682_100645589 3300005337 Bacteria 842
46 Ga0068868_100011500 3300005338 Bacteria 6446
47 Ga0070660_100007544 3300005339 Bacteria 7579
48 Ga0070660_100023161 3300005339 Bacteria 4599
49 Ga0070660_100085866 3300005339 Bacteria 2475
50 Ga0070689_100268722 3300005340 Bacteria 1411
51 Ga0070661_100219477 3300005344 Bacteria 1458
52 Ga0070669_100008226 3300005353 Bacteria 7450
53 Ga0070675_100001473 3300005354 Bacteria 17347
54 Ga0070675_100242132 3300005354 Bacteria 1576
55 Ga0070671_100011093 3300005355 Bacteria 7236
56 Ga0070671_100030101 3300005355 Bacteria 4480
57 Ga0070674_100002004 3300005356 Bacteria 11146
58 Ga0070674_100327471 3300005356 Bacteria 1230
59 Ga0070673_100030008 3300005364 Bacteria 4063
60 Ga0070673_100050971 3300005364 Bacteria 3239
61 Ga0070673_100733199 3300005364 Bacteria 909
62 Ga0070667_100113363 3300005367 Bacteria 2353
63 Ga0070667_100145705 3300005367 Bacteria 2077
64 Ga0070700_100794532 3300005441 Bacteria 761
65 Ga0070708_100000818 3300005445 Bacteria 23467
66 Ga0070678_100005561 3300005456 Bacteria 7307
67 Ga0070678_100152466 3300005456 Bacteria 1863
68 Ga0070678_100616722 3300005456 Bacteria 970
69 Ga0070678_100868289 3300005456 Bacteria 823
70 Ga0070662_100005173 3300005457 Bacteria 8321
71 Ga0070662_100389227 3300005457 Bacteria 1149
72 Ga0068867_100000086 3300005459 Bacteria 58298
73 Ga0068867_100096314 3300005459 Bacteria 2253
74 Ga0068867_100160265 3300005459 Bacteria 1774
75 Ga0068867_100253022 3300005459 Bacteria 1433
76 Ga0070699_100273387 3300005518 Bacteria 1513
77 Ga0070684_100223041 3300005535 Bacteria 1720
78 Ga0068853_100388325 3300005539 Bacteria 1305
79 Ga0068853_100981307 3300005539 Bacteria 813
80 Ga0070672_100000367 3300005543 Bacteria 25974
81 Ga0070672_100007805 3300005543 Bacteria 7298
82 Ga0070686_100289371 3300005544 Bacteria 1211
83 Ga0070665_100068041 3300005548 Bacteria 3571
84 Ga0068855_100001767 3300005563 Bacteria 26998
85 Ga0068855_100038331 3300005563 Bacteria 5694
86 Ga0068855_100289055 3300005563 Bacteria 1818
87 Ga0068855_100653855 3300005563 Bacteria 1129
88 Ga0070664_100029166 3300005564 Bacteria 4599
89 Ga0068857_100004097 3300005577 Bacteria 12280
90 Ga0068857_100156332 3300005577 Bacteria 2068
91 Ga0068854_100009523 3300005578 Bacteria 6271
92 Ga0068856_100002296 3300005614 Bacteria 19713
93 Ga0068856_101183924 3300005614 Bacteria 781
94 Ga0068852_100786968 3300005616 Bacteria 965
95 Ga0068852_100875522 3300005616 Bacteria 915
96 Ga0068859_100918221 3300005617 Bacteria 960
97 Ga0068864_100018312 3300005618 Bacteria 5849
98 Ga0068864_100023287 3300005618 Bacteria 5199
99 Ga0068864_100142004 3300005618 Bacteria 2167
100 Ga0068861_100906416 3300005719 Bacteria 835
101 Ga0068870_10139262 3300005840 Bacteria 1418
102 Ga0068863_100074674 3300005841 Bacteria 3208
103 Ga0068860_100410901 3300005843 Bacteria 1340
104 Ga0068862_100031756 3300005844 Bacteria 4461
105 Ga0068862_100144841 3300005844 Bacteria 2111
106 Ga0075432_10066585 3300006058 Bacteria 1289
107 Ga0075362_10222980 3300006177 Bacteria 922
108 Ga0075366_10001671 3300006195 Bacteria 11141
109 Ga0075366_10002150 3300006195 Bacteria 10037
110 Ga0075366_10014138 3300006195 Bacteria 4555
111 Ga0075366_10028889 3300006195 Bacteria 3256
112 Ga0075366_10101444 3300006195 Bacteria 1727
113 Ga0075366_10102319 3300006195 Bacteria 1720
114 Ga0075366_10205226 3300006195 Unclassified 1199
115 Ga0075366_10214769 3300006195 Bacteria 1171
116 Ga0075366_10226641 3300006195 Bacteria 1139
117 Ga0075366_10307601 3300006195 Bacteria 970
118 Ga0075370_10001645 3300006353 Bacteria 9866
119 Ga0075370_10038071 3300006353 Bacteria 2706
120 Ga0075370_10063586 3300006353 Bacteria 2104
121 Ga0068871_100394113 3300006358 Bacteria 1232
122 Ga0068871_100532837 3300006358 Bacteria 1062
123 Ga0075429_100014531 3300006880 Bacteria 6822
124 Ga0097620_100918226 3300006931 Bacteria 960
125 Ga0075435_100102283 3300007076 Unclassified 2375
126 Ga0105240_10018658 3300009093 Bacteria 9297
127 Ga0105247_10289544 3300009101 Bacteria 1132
128 Ga0105243_10010856 3300009148 Bacteria 6891
129 Ga0105243_10047416 3300009148 Bacteria 3382
130 Ga0105243_10171712 3300009148 Bacteria 1878
131 Ga0105243_10751321 3300009148 Bacteria 956
132 Ga0105241_10009231 3300009174 Bacteria 7253
133 Ga0105242_10055776 3300009176 Bacteria 3233
134 Ga0105248_10000471 3300009177 Bacteria 45843
135 Ga0105248_10001875 3300009177 Bacteria 23322
136 Ga0105248_10146220 3300009177 Bacteria 2667
137 Ga0105237_10429091 3300009545 Bacteria 1327
138 Ga0105238_10047236 3300009551 Bacteria 4343
139 Ga0105239_10021588 3300010375 Bacteria 7100
140 Ga0105239_10507692 3300010375 Bacteria 1371
141 Ga0157373_10004343 3300013100 Bacteria 10672
142 Ga0157370_10348212 3300013104 Bacteria 1366
143 Ga0157369_10029515 3300013105 Bacteria 6059
144 Ga0157374_10064011 3300013296 Bacteria 3450
145 Ga0157378_10568233 3300013297 Bacteria 1142
146 Ga0157378_10690996 3300013297 Bacteria 1039
147 Ga0163162_10283320 3300013306 Bacteria 1789
148 Ga0163162_10388153 3300013306 Bacteria 1529
149 Ga0157372_10224846 3300013307 Bacteria 2176
150 Ga0157375_10410376 3300013308 Bacteria 1521
151 Ga0157375_10849141 3300013308 Bacteria 1060
152 Ga0163163_10028813 3300014325 Bacteria 5337
153 Ga0163163_10660601 3300014325 Bacteria 1109
154 Ga0157377_10000038 3300014745 Bacteria 113777
155 Ga0157379_10615951 3300014968 Bacteria 1014
156 Ga0157379_10620012 3300014968 Bacteria 1011
157 Ga0157376_10016519 3300014969 Bacteria 5607
158 Ga0157376_10319849 3300014969 Bacteria 1475
159 Ga0163161_10060906 3300017792 Bacteria 2748
160 Ga0163161_10149756 3300017792 Bacteria 1773
161 Ga0163161_10393364 3300017792 Bacteria 1110
162 Ga0206352_10163021 3300020078 Bacteria 924
163 Ga0213872_10011831 3300021361 Bacteria 4122
164 Ga0213872_10087888 3300021361 Bacteria 1392
165 Ga0209436_100484 3300025208 Bacteria 17563
166 Ga0209436_102860 3300025208 Bacteria 4886
167 Ga0209674_100024 3300025226 Bacteria 535481
168 Ga0209563_100069 3300025230 Bacteria 253154
169 Ga0207427_101384 3300025231 Bacteria 8888
170 Ga0209258_100870 3300025242 Bacteria 15963
171 Ga0207425_1000001 3300025245 Bacteria 2525432
172 Ga0207425_1000130 3300025245 Bacteria 70791
173 Ga0209646_1000012 3300025246 Bacteria 573300
174 Ga0209026_1000004 3300025250 Bacteria 949012
175 Ga0209677_100048 3300025253 Bacteria 183563
176 Ga0209677_100263 3300025253 Bacteria 35585
177 Ga0209677_101400 3300025253 Bacteria 10475
178 Ga0209759_1000003 3300025256 Bacteria 792130
179 Ga0209759_1001348 3300025256 Bacteria 14283
180 Ga0209759_1003047 3300025256 Bacteria 6903
181 Ga0209759_1013641 3300025256 Bacteria 2188
182 Ga0209129_1000003 3300025258 Bacteria 903689
183 Ga0209129_1008481 3300025258 Bacteria 2854
184 Ga0209565_1000572 3300025263 Bacteria 25033
185 Ga0209565_1000878 3300025263 Bacteria 16520
186 Ga0209565_1003147 3300025263 Bacteria 5511
187 Ga0209130_1000237 3300025284 Bacteria 70739
188 Ga0209130_1004662 3300025284 Bacteria 5089
189 Ga0209675_1004686 3300025291 Bacteria 6001
190 Ga0209675_1031846 3300025291 Bacteria 1242
191 Ga0209564_1000311 3300025295 Bacteria 95587
192 Ga0209564_1042286 3300025295 Bacteria 1211
193 Ga0209758_1000041 3300025297 Bacteria 410328
194 Ga0209050_1000011 3300025298 Bacteria 914037
195 Ga0209050_1000280 3300025298 Bacteria 108968
196 Ga0209050_1000664 3300025298 Bacteria 52795
197 Ga0209050_1001427 3300025298 Bacteria 25782
198 Ga0209256_1000068 3300025299 Bacteria 246064
199 Ga0209256_1000952 3300025299 Bacteria 35118
200 Ga0209256_1038346 3300025299 Bacteria 1242
201 Ga0207426_1003864 3300025302 Bacteria 7725
202 Ga0209051_1006353 3300025303 Bacteria 6685
203 Ga0209051_1015749 3300025303 Bacteria 3464
204 Ga0209257_1000003 3300025304 Bacteria 1702593
205 Ga0209257_1000033 3300025304 Bacteria 671006
206 Ga0209257_1010241 3300025304 Bacteria 4797
207 Ga0209257_1010307 3300025304 Bacteria 4756
208 Ga0207682_10001930 3300025893 Bacteria 9419
209 Ga0207682_10168334 3300025893 Bacteria 996
210 Ga0207692_10066964 3300025898 Bacteria 1879
211 Ga0207680_10075899 3300025903 Bacteria 2097
212 Ga0207645_10083293 3300025907 Bacteria 2051
213 Ga0207643_10122785 3300025908 Bacteria 1540
214 Ga0207705_10018721 3300025909 Bacteria 4954
215 Ga0207705_10064063 3300025909 Bacteria 2656
216 Ga0207654_10034576 3300025911 Bacteria 2809
217 Ga0207695_10015011 3300025913 Bacteria 9138
218 Ga0207671_10205106 3300025914 Bacteria 1541
219 Ga0207657_10035980 3300025919 Bacteria 4435
220 Ga0207657_10340135 3300025919 Bacteria 1184
221 Ga0207649_10140899 3300025920 Bacteria 1650
222 Ga0207649_10256540 3300025920 Bacteria 1262
223 Ga0207681_10134357 3300025923 Bacteria 1833
224 Ga0207694_10003229 3300025924 Bacteria 12990
225 Ga0207650_10002288 3300025925 Bacteria 13348
226 Ga0207650_10261946 3300025925 Bacteria 1403
227 Ga0207659_10008394 3300025926 Bacteria 6410
228 Ga0207659_10266419 3300025926 Bacteria 1396
229 Ga0207644_10004038 3300025931 Bacteria 9522
230 Ga0207644_10012860 3300025931 Bacteria 5567
231 Ga0207644_10019766 3300025931 Bacteria 4573
232 Ga0207644_10186620 3300025931 Bacteria 1628
233 Ga0207690_10084713 3300025932 Bacteria 2223
234 Ga0207706_10011506 3300025933 Bacteria 8059
235 Ga0207706_10064935 3300025933 Bacteria 3214
236 Ga0207686_10220807 3300025934 Bacteria 1368
237 Ga0207709_10009847 3300025935 Bacteria 5263
238 Ga0207709_10047846 3300025935 Bacteria 2602
239 Ga0207709_10095285 3300025935 Bacteria 1955
240 Ga0207709_10412626 3300025935 Bacteria 1035
241 Ga0207669_10408656 3300025937 Bacteria 1065
242 Ga0207691_10001841 3300025940 Bacteria 20724
243 Ga0207691_10283967 3300025940 Bacteria 1424
244 Ga0207711_10001495 3300025941 Bacteria 21766
245 Ga0207711_10085580 3300025941 Bacteria 2762
246 Ga0207689_10714861 3300025942 Bacteria 845
247 Ga0207679_10087070 3300025945 Bacteria 2404
248 Ga0207667_10003101 3300025949 Bacteria 20573
249 Ga0207667_10013387 3300025949 Bacteria 9386
250 Ga0207667_10061040 3300025949 Bacteria 3945
251 Ga0207651_10004659 3300025960 Bacteria 6950
252 Ga0207651_10007681 3300025960 Bacteria 5759
253 Ga0207658_10026500 3300025986 Bacteria 4064
254 Ga0207658_10046373 3300025986 Bacteria 3174
255 Ga0207677_10010426 3300026023 Bacteria 5258
256 Ga0207677_10205238 3300026023 Bacteria 1570
257 Ga0207639_10039927 3300026041 Bacteria 3500
258 Ga0207639_10226783 3300026041 Bacteria 1617
259 Ga0207639_10230622 3300026041 Bacteria 1604
260 Ga0207702_10005216 3300026078 Bacteria 11410
261 Ga0207702_10586637 3300026078 Bacteria 1093
262 Ga0207641_10303652 3300026088 Bacteria 1508
263 Ga0207641_10436134 3300026088 Bacteria 1264
264 Ga0207641_10947338 3300026088 Bacteria 856
265 Ga0207648_10000053 3300026089 Bacteria 107516
266 Ga0207648_10017318 3300026089 Bacteria 6562
267 Ga0207648_10075975 3300026089 Bacteria 2928
268 Ga0207648_10177150 3300026089 Bacteria 1886
269 Ga0207676_10021173 3300026095 Bacteria 4769
270 Ga0207676_10027340 3300026095 Bacteria 4248
271 Ga0207676_10266404 3300026095 Bacteria 1549
272 Ga0207675_100047872 3300026118 Bacteria 3991
273 Ga0207675_101005551 3300026118 Bacteria 852
274 Ga0207683_10005954 3300026121 Bacteria 10447
275 Ga0207683_10181403 3300026121 Bacteria 1909
276 Ga0207683_10505360 3300026121 Bacteria 1116
277 Ga0207698_10468311 3300026142 Bacteria 1220
278 Ga0207698_11412983 3300026142 Bacteria 711
279 Ga0209998_10048829 3300027717 Bacteria 976
280 Ga0209974_10004417 3300027876 Bacteria 5003
281 Ga0268266_10334911 3300028379 Bacteria 1419
282 Ga0268265_10396457 3300028380 Bacteria 1274
283 Ga0268264_10684018 3300028381 Bacteria 1018
284 Ga0307515_10001629 3300028794 Bacteria 49963
285 Ga0307515_10066207 3300028794 Bacteria 5010
286 Ga0307515_10076602 3300028794 Bacteria 4433
287 Ga0307515_10087646 3300028794 Bacteria 3946
288 Ga0307515_10185483 3300028794 Bacteria 2011
289 Ga0307515_10248555 3300028794 Bacteria 1535
290 Ga0307515_10381387 3300028794 Bacteria 1042
291 Ga0265324_10023001 3300029957 Bacteria 2223
292 Ga0307512_10034290 3300030522 Bacteria 4344
293 Ga0265330_10003812 3300031235 Bacteria 7771
294 Ga0265332_10000841 3300031238 Bacteria 18651
295 Ga0265325_10033294 3300031241 Bacteria 2748
296 Ga0265339_10024672 3300031249 Bacteria 3461
297 Ga0265331_10000936 3300031250 Bacteria 23357
298 Ga0265327_10016553 3300031251 Bacteria 4674
299 Ga0265316_10081530 3300031344 Bacteria 2480
300 Ga0307513_10018405 3300031456 Bacteria 8345
301 Ga0307513_10056239 3300031456 Bacteria 4202
302 Ga0307513_10208749 3300031456 Bacteria 1786
303 Ga0307408_100000016 3300031548 Bacteria 356896
304 Ga0307408_100001185 3300031548 Bacteria 19736
305 Ga0307408_100137393 3300031548 Bacteria 1914
306 Ga0307408_100259889 3300031548 Bacteria 1436
307 Ga0307408_100790460 3300031548 Bacteria 860
308 Ga0307508_10000133 3300031616 Bacteria 87867
309 Ga0307508_10008282 3300031616 Bacteria 9624
310 Ga0307514_10001199 3300031649 Bacteria 34587
311 Ga0310114_106115 3300031678 Bacteria 1229
312 Ga0265314_10022857 3300031711 Bacteria 4782
313 Ga0265314_10088545 3300031711 Bacteria 2021
314 Ga0265342_10011638 3300031712 Bacteria 6004
315 Ga0307516_10001653 3300031730 Bacteria 30675
316 Ga0307516_10004130 3300031730 Bacteria 18101
317 Ga0307516_10529591 3300031730 Bacteria 832
318 Ga0307405_10143158 3300031731 Bacteria 1670
319 Ga0307413_10008938 3300031824 Bacteria 4763
320 Ga0307413_10865361 3300031824 Bacteria 765
321 Ga0307410_10006974 3300031852 Bacteria 6149
322 Ga0307406_10680800 3300031901 Bacteria 857
323 Ga0307412_10021971 3300031911 Bacteria 3904
324 Ga0307412_10069539 3300031911 Bacteria 2397
325 Ga0307412_10205664 3300031911 Bacteria 1498
326 Ga0307412_10881956 3300031911 Bacteria 783
327 Ga0307409_100358191 3300031995 Bacteria 1379
328 Ga0307409_100373413 3300031995 Bacteria 1353
329 Ga0307409_101270618 3300031995 Bacteria 761
330 Ga0307416_100506068 3300032002 Bacteria 1273
331 Ga0307416_100561127 3300032002 Bacteria 1217
332 Ga0307414_10294130 3300032004 Bacteria 1370
333 Ga0307411_10001686 3300032005 Bacteria 9255
334 Ga0307411_10007222 3300032005 Bacteria 5634
335 Ga0307411_10366328 3300032005 Bacteria 1180
336 Ga0307507_10072829 3300033179 Bacteria 3093
337 Ga0373932_0030684 3300035112 Bacteria 1492
338 Ga0373932_0259455 3300035112 Bacteria 637
339 Ga0373956_0389125 3300035119 Bacteria 665
340 Ga0373931_0011014 3300035691 Bacteria 4360
341 Ga0373927_0278669 3300035695 Bacteria 1100
342 Ga0310110_009968 3300036535 Bacteria 1389
343 Ga0373925_0230941 3300037068 Bacteria 1479
344 Ga0395898_0035646 3300037466 Bacteria 4945
345 Ga0395905_0000782 3300037471 Bacteria 41773
346 Ga0395905_0029628 3300037471 Bacteria 5158
347 Ga0395905_0376182 3300037471 Bacteria 1314
348 Ga0395905_0516671 3300037471 Bacteria 1095
349 Ga0395901_0164392 3300038443 Bacteria 2330
350 Ga0436361_0089148 3300039447 Bacteria 4791
351 Ga0436361_0674953 3300039447 Bacteria 2121
352 Ga0451789_0665935 3300041443 Bacteria 761
353 Ga0451795_1163136 3300041456 Bacteria 2854
354 Ga0451837_1651674 3300041494 Bacteria 1057
355 Ga0451853_0688630 3300041512 Bacteria 1206
356 Ga0439449_0023753 3300042007 Bacteria 2293
357 Ga0450917_007568 3300042120 Bacteria 830
358 Ga0450888_007523 3300042126 Bacteria 1207
359 Ga0450890_001567 3300042127 Bacteria 3288
360 Ga0450892_000865 3300042130 Bacteria 3298
361 Ga0450889_000295 3300042144 Bacteria 5611
362 Ga0439459_0016544 3300042438 Bacteria 1364
363 Ga0439464_0086757 3300042439 Bacteria 940
364 Ga0450916_001506 3300042530 Bacteria 2341
365 Ga0451577_0002689 3300042876 Bacteria 20732
366 Ga0451577_0114053 3300042876 Bacteria 2419
367 Ga0466969_0000010 3300044656 Bacteria 117215
368 Ga0466963_0013321 3300044694 Bacteria 5049
369 Ga0453684_0018778 3300044712 Bacteria 10582
370 Ga0453684_0668863 3300044712 Bacteria 1131
371 Ga0451576_0023757 3300045051 Bacteria 6633
372 Ga0451576_0026680 3300045051 Bacteria 6211
373 Ga0466967_0415475 3300045976 Bacteria 1310
374 Ga0495617_000739 3300046452 Bacteria 16079
375 Ga0495651_0272826 3300046462 Bacteria 1146
376 Ga0495650_0003225 3300046471 Bacteria 12118
377 Ga0495580_0074020 3300046472 Bacteria 2378
378 Ga0495639_0008991 3300046475 Bacteria 4283
379 Ga0495585_0000002 3300046492 Bacteria 529316
380 Ga0495583_0000022 3300046506 Bacteria 282544
381 Ga0495606_0000015 3300046507 Bacteria 288808
382 Ga0495606_0002047 3300046507 Bacteria 24702
383 Ga0495606_0379548 3300046507 Bacteria 742
384 Ga0495610_0130149 3300046512 Bacteria 1093
385 Ga0495616_0001036 3300046513 Bacteria 19887
386 Ga0495643_0073530 3300046522 Bacteria 1791
387 Ga0495648_0000012 3300046524 Bacteria 294111
388 Ga0495642_0036103 3300046528 Bacteria 1997
389 Ga0495609_0005783 3300046538 Bacteria 6424
390 Ga0495611_0006678 3300046648 Bacteria 4908
391 Ga0495625_0000836 3300046660 Bacteria 42292
392 Ga0495625_0015143 3300046660 Bacteria 6120
393 Ga0495658_0430497 3300046683 Bacteria 842
394 Ga0495649_0000107 3300046694 Bacteria 74394
395 Ga0495589_0012806 3300046794 Bacteria 4336
396 Ga0495672_0118434 3300047320 Bacteria 1411
397 Ga0495683_0052365 3300047323 Bacteria 2038
398 Ga0495683_0097141 3300047323 Bacteria 1420
399 Ga0495677_0005267 3300047445 Bacteria 4916
400 Ga0495673_0024365 3300047469 Bacteria 2925
401 Ga0495615_0020053 3300048090 Bacteria 1493
402 Ga0496101_0507573 3300048904 Bacteria 953
403 Ga0496102_0004336 3300048905 Bacteria 11995
404 Ga0496102_0043870 3300048905 Bacteria 4056
405 Ga0496104_0041019 3300048907 Bacteria 4339
406 Ga0496104_0266443 3300048907 Bacteria 1626
407 Ga0496104_0364401 3300048907 Bacteria 1358
408 Ga0496104_0599432 3300048907 Bacteria 1012
409 Ga0496105_0086151 3300048908 Bacteria 2596
410 Ga0496105_0446326 3300048908 Bacteria 1022
411 Ga0496106_0433763 3300048909 Bacteria 1056
412 Ga0496108_0132577 3300048911 Bacteria 2142
413 Ga0496109_0049985 3300048912 Bacteria 3809
414 Ga0496109_0219499 3300048912 Bacteria 1788
415 Ga0496109_0888812 3300048912 Bacteria 829
416 Ga0496110_0234851 3300048913 Bacteria 1668
417 Ga0496110_0263396 3300048913 Bacteria 1569
418 Ga0496110_0926171 3300048913 Bacteria 778
419 Ga0496112_0090918 3300048915 Bacteria 3021
420 Ga0496113_0019957 3300048916 Bacteria 4701
421 Ga0496126_0060046 3300048929 Bacteria 3422
422 Ga0501306_019325 3300049127 Bacteria 939
423 Ga0501306_022724 3300049127 Bacteria 886
424 Ga0501306_023974 3300049127 Bacteria 869
425 Ga0501306_036644 3300049127 Bacteria 748
426 Ga0501306_038126 3300049127 Bacteria 737
427 Ga0501306_047748 3300049127 Bacteria 680
428 Ga0501308_008344 3300049128 Bacteria 1107
429 Ga0501308_014112 3300049128 Bacteria 931
430 Ga0501308_017156 3300049128 Bacteria 874
431 Ga0501308_025863 3300049128 Bacteria 763
432 Ga0501308_032844 3300049128 Bacteria 703
433 Ga0501309_019874 3300049129 Bacteria 937
434 Ga0501309_022375 3300049129 Bacteria 894
435 Ga0501309_026787 3300049129 Bacteria 834
436 Ga0501309_042344 3300049129 Bacteria 699
437 Ga0501309_043192 3300049129 Bacteria 693
438 Ga0501310_005408 3300049130 Bacteria 1310
439 Ga0501310_015935 3300049130 Bacteria 896
440 Ga0501310_016771 3300049130 Bacteria 881
441 Ga0501310_032224 3300049130 Bacteria 701
442 Ga0501304_002111 3300049160 Bacteria 1353
443 Ga0501304_009171 3300049160 Bacteria 845
444 Ga0501304_010073 3300049160 Bacteria 821
445 Ga0501305_004967 3300049161 Bacteria 1589
446 Ga0501305_025679 3300049161 Bacteria 894
447 Ga0501305_061837 3300049161 Bacteria 646
448 Ga0501307_014970 3300049162 Bacteria 953
449 Ga0501307_015866 3300049162 Bacteria 934
450 Ga0501307_036511 3300049162 Bacteria 701
451 Ga0501301_001001 3300049524 Bacteria 1766
452 Ga0501311_021877 3300049527 Bacteria 875
453 Ga0501312_022694 3300049528 Bacteria 941
454 Ga0501312_027371 3300049528 Bacteria 879
455 Ga0501312_041842 3300049528 Bacteria 751
456 Ga0501313_004639 3300049529 Bacteria 1420
457 Ga0501313_012288 3300049529 Bacteria 996
458 Ga0501313_022124 3300049529 Bacteria 791
459 Ga0501314_005403 3300049530 Bacteria 1087
460 Ga0501314_006300 3300049530 Bacteria 1031
461 Ga0501314_009495 3300049530 Bacteria 894
462 Ga0501314_010826 3300049530 Bacteria 854
463 Ga0501315_013319 3300049531 Bacteria 1028
464 Ga0501315_013691 3300049531 Bacteria 1019
465 Ga0501315_019056 3300049531 Bacteria 910
466 Ga0501315_020848 3300049531 Bacteria 883
467 Ga0501315_046432 3300049531 Bacteria 671
468 Ga0501316_014237 3300049532 Bacteria 947
469 Ga0501318_016402 3300049534 Bacteria 895
470 Ga0501321_008375 3300049537 Bacteria 1096
471 Ga0501321_015649 3300049537 Bacteria 895
472 Ga0501321_032352 3300049537 Bacteria 705
473 Ga0501321_034690 3300049537 Bacteria 688
474 Ga0501321_044859 3300049537 Bacteria 632
475 Ga0501322_004430 3300049538 Bacteria 944
476 Ga0501322_005818 3300049538 Bacteria 863
477 Ga0501322_006249 3300049538 Bacteria 844
478 Ga0501322_007047 3300049538 Bacteria 811
479 Ga0501322_009782 3300049538 Bacteria 730
480 Ga0501322_011512 3300049538 Bacteria 693
481 Ga0501323_037184 3300049539 Bacteria 703
482 Ga0501324_008437 3300049540 Bacteria 908
483 Ga0501325_021040 3300049541 Bacteria 688
484 Ga0501334_10657 3300049550 Bacteria 666
485 Ga0501340_004446 3300049556 Bacteria 884
486 Ga0501032_0115274 3300049569 Bacteria 1777
487 Ga0501034_0274939 3300049571 Bacteria 1625
488 Ga0501043_0000002 3300049579 Bacteria 351081
489 Ga0501046_0000008 3300049580 Bacteria 351167
490 Ga0501047_0000003 3300049581 Bacteria 508375
491 Ga0501048_0122131 3300049582 Bacteria 1840
492 Ga0501211_011872 3300049658 Bacteria 859
493 Ga0501227_010609 3300049665 Bacteria 1999
494 Ga0501252_008151 3300049682 Bacteria 1200
495 Ga0501255_007710 3300049684 Bacteria 1148
496 Ga0501045_0001048 3300049824 Bacteria 18195
497 nmdc:mga03683_208573_c1 3300050489 Bacteria 898
498 nmdc:mga03n38_96993_c1 3300050490 Bacteria 1415
499 nmdc:mga0k408_1147_c1 3300050493 Bacteria 14519
500 nmdc:mga0k408_137125_c1 3300050493 Bacteria 1454
501 nmdc:mga0k408_14103_c1 3300050493 Bacteria 4395
502 nmdc:mga0k408_298415_c1 3300050493 Bacteria 962
503 nmdc:mga0k408_32895_c1 3300050493 Bacteria 2963
504 nmdc:mga0k408_4840_c1 3300050493 Bacteria 7141
505 nmdc:mga0k408_533_c1 3300050493 Bacteria 20949
506 nmdc:mga07m45_114_c1 3300050496 Bacteria 32256
507 nmdc:mga07m45_14185_c1 3300050496 Bacteria 4240
508 nmdc:mga09592_2396_c1 3300050508 Bacteria 15137
509 nmdc:mga0a205_200296_c1 3300050515 Unclassified 1887
510 Ga0495655_0176144 3300053083 Unclassified 687
511 Ga0500578_0256687 3300053086 Bacteria 1051
512 Ga0500608_092540 3300053122 Bacteria 1411
513 Ga0500559_0030666 3300053136 Bacteria 2306
514 Ga0500590_019010 3300053148 Bacteria 3560
515 Ga0500619_000030 3300053154 Bacteria 46680
516 Ga0500636_0002776 3300053177 Bacteria 9766
517 Ga0500587_002994 3300053739 Bacteria 2391
518 Ga0500661_004209 3300055283 Bacteria 2692
519 Ga0466962_0231622 3300061719 Bacteria 906
520 2587756789 2585428062 Bacteria 6842168
521 2643743391 2643221544 Bacteria 5886209
522 2643932569 2643221585 Bacteria 5812563
523 2644260839 2643221646 Bacteria 6433402
524 2644313820 2643221656 Bacteria 5809961
525 2739056312 2738541337 Bacteria 6183410
526 2932413186 2932410948 Bacteria 6312192
527 2932417247 2932416698 Bacteria 6315112
528 8055228875 8055225921 Bacteria 3341787
529 Ga0451576_0268650
530 JGI25156J39149_1019066
531 JGI25154J39366_1004745
532 JGI25157J39369_1000038
533 JGI25152J39213_1016178
534 JGI25150J39212_1000655
535 JGI25159J45721_1010954
536 JGI25153J46596_10007539
537 rootH1_10003266
538 rootL2_10047996
539 rootL2_10072243
540 rootL2_10074193
541 rootH1_10001251
542 rootH1_10025546
543 JGI25161J50226_1000182
544 Ga0055539_1002371
545 Ga0055533_1000026
546 Ga0055525_1000525
547 Ga0055526_1000780
548 Ga0055526_1003391
549 Ga0055537_1003470
550 Ga0055524_1000187
551 Ga0055524_1018949
552 Ga0055524_1023255
553 Ga0055534_1002067
554 Ga0055528_1003283
555 Ga0055530_10000444
556 Ga0055530_10001759
557 Ga0055531_10000001
558 Ga0055531_10001467
559 Ga0055543_1000112
560 Ga0065165_1005676
561 Ga0065712_10179619
562 Ga0065715_10119799
563 Ga0070658_10022875
564 Ga0070658_10055262
565 Ga0070676_10287396
566 Ga0070690_100646440
567 Ga0070670_100316581
568 Ga0070670_100762186
569 Ga0070677_10001601
570 Ga0070677_10252453
571 Ga0068869_100794247
572 Ga0070682_100040109
573 Ga0070682_100645589
574 Ga0068868_100011500
575 Ga0070660_100007544
576 Ga0070660_100023161
577 Ga0070660_100085866
578 Ga0070689_100268722
579 Ga0070661_100219477
580 Ga0070669_100008226
581 Ga0070675_100001473
582 Ga0070675_100242132
583 Ga0070671_100011093
584 Ga0070671_100030101
585 Ga0070674_100002004
586 Ga0070674_100327471
587 Ga0070673_100030008
588 Ga0070673_100050971
589 Ga0070673_100733199
590 Ga0070667_100113363
591 Ga0070667_100145705
592 Ga0070700_100794532
593 Ga0070708_100000818
594 Ga0070678_100005561
595 Ga0070678_100152466
596 Ga0070678_100616722
597 Ga0070678_100868289
598 Ga0070662_100005173
599 Ga0070662_100389227
600 Ga0068867_100000086
601 Ga0068867_100096314
602 Ga0068867_100160265
603 Ga0068867_100253022
604 Ga0070699_100273387
605 Ga0070684_100223041
606 Ga0068853_100388325
607 Ga0068853_100981307
608 Ga0070672_100000367
609 Ga0070672_100007805
610 Ga0070686_100289371
611 Ga0070665_100068041
612 Ga0068855_100001767
613 Ga0068855_100038331
614 Ga0068855_100289055
615 Ga0068855_100653855
616 Ga0070664_100029166
617 Ga0068857_100004097
618 Ga0068857_100156332
619 Ga0068854_100009523
620 Ga0068856_100002296
621 Ga0068856_101183924
622 Ga0068852_100786968
623 Ga0068852_100875522
624 Ga0068859_100918221
625 Ga0068864_100018312
626 Ga0068864_100023287
627 Ga0068864_100142004
628 Ga0068861_100906416
629 Ga0068870_10139262
630 Ga0068863_100074674
631 Ga0068860_100410901
632 Ga0068862_100031756
633 Ga0068862_100144841
634 Ga0075432_10066585
635 Ga0075362_10222980
636 Ga0075366_10001671
637 Ga0075366_10002150
638 Ga0075366_10014138
639 Ga0075366_10028889
640 Ga0075366_10101444
641 Ga0075366_10102319
642 Ga0075366_10205226
643 Ga0075366_10214769
644 Ga0075366_10226641
645 Ga0075366_10307601
646 Ga0075370_10001645
647 Ga0075370_10038071
648 Ga0075370_10063586
649 Ga0068871_100394113
650 Ga0068871_100532837
651 Ga0075429_100014531
652 Ga0097620_100918226
653 Ga0075435_100102283
654 Ga0105240_10018658
655 Ga0105247_10289544
656 Ga0105243_10010856
657 Ga0105243_10047416
658 Ga0105243_10171712
659 Ga0105243_10751321
660 Ga0105241_10009231
661 Ga0105242_10055776
662 Ga0105248_10000471
663 Ga0105248_10001875
664 Ga0105248_10146220
665 Ga0105237_10429091
666 Ga0105238_10047236
667 Ga0105239_10021588
668 Ga0105239_10507692
669 Ga0157373_10004343
670 Ga0157370_10348212
671 Ga0157369_10029515
672 Ga0157374_10064011
673 Ga0157378_10568233
674 Ga0157378_10690996
675 Ga0163162_10283320
676 Ga0163162_10388153
677 Ga0157372_10224846
678 Ga0157375_10410376
679 Ga0157375_10849141
680 Ga0163163_10028813
681 Ga0163163_10660601
682 Ga0157377_10000038
683 Ga0157379_10615951
684 Ga0157379_10620012
685 Ga0157376_10016519
686 Ga0157376_10319849
687 Ga0163161_10060906
688 Ga0163161_10149756
689 Ga0163161_10393364
690 Ga0206352_10163021
691 Ga0213872_10011831
692 Ga0213872_10087888
693 Ga0209436_100484
694 Ga0209436_102860
695 Ga0209674_100024
696 Ga0209563_100069
697 Ga0207427_101384
698 Ga0209258_100870
699 Ga0207425_1000001
700 Ga0207425_1000130
701 Ga0209646_1000012
702 Ga0209026_1000004
703 Ga0209677_100048
704 Ga0209677_100263
705 Ga0209677_101400
706 Ga0209759_1000003
707 Ga0209759_1001348
708 Ga0209759_1003047
709 Ga0209759_1013641
710 Ga0209129_1000003
711 Ga0209129_1008481
712 Ga0209565_1000572
713 Ga0209565_1000878
714 Ga0209565_1003147
715 Ga0209130_1000237
716 Ga0209130_1004662
717 Ga0209675_1004686
718 Ga0209675_1031846
719 Ga0209564_1000311
720 Ga0209564_1042286
721 Ga0209758_1000041
722 Ga0209050_1000011
723 Ga0209050_1000280
724 Ga0209050_1000664
725 Ga0209050_1001427
726 Ga0209256_1000068
727 Ga0209256_1000952
728 Ga0209256_1038346
729 Ga0207426_1003864
730 Ga0209051_1006353
731 Ga0209051_1015749
732 Ga0209257_1000003
733 Ga0209257_1000033
734 Ga0209257_1010241
735 Ga0209257_1010307
736 Ga0207682_10001930
737 Ga0207682_10168334
738 Ga0207692_10066964
739 Ga0207680_10075899
740 Ga0207645_10083293
741 Ga0207643_10122785
742 Ga0207705_10018721
743 Ga0207705_10064063
744 Ga0207654_10034576
745 Ga0207695_10015011
746 Ga0207671_10205106
747 Ga0207657_10035980
748 Ga0207657_10340135
749 Ga0207649_10140899
750 Ga0207649_10256540
751 Ga0207681_10134357
752 Ga0207694_10003229
753 Ga0207650_10002288
754 Ga0207650_10261946
755 Ga0207659_10008394
756 Ga0207659_10266419
757 Ga0207644_10004038
758 Ga0207644_10012860
759 Ga0207644_10019766
760 Ga0207644_10186620
761 Ga0207690_10084713
762 Ga0207706_10011506
763 Ga0207706_10064935
764 Ga0207686_10220807
765 Ga0207709_10009847
766 Ga0207709_10047846
767 Ga0207709_10095285
768 Ga0207709_10412626
769 Ga0207669_10408656
770 Ga0207691_10001841
771 Ga0207691_10283967
772 Ga0207711_10001495
773 Ga0207711_10085580
774 Ga0207689_10714861
775 Ga0207679_10087070
776 Ga0207667_10003101
777 Ga0207667_10013387
778 Ga0207667_10061040
779 Ga0207651_10004659
780 Ga0207651_10007681
781 Ga0207658_10026500
782 Ga0207658_10046373
783 Ga0207677_10010426
784 Ga0207677_10205238
785 Ga0207639_10039927
786 Ga0207639_10226783
787 Ga0207639_10230622
788 Ga0207702_10005216
789 Ga0207702_10586637
790 Ga0207641_10303652
791 Ga0207641_10436134
792 Ga0207641_10947338
793 Ga0207648_10000053
794 Ga0207648_10017318
795 Ga0207648_10075975
796 Ga0207648_10177150
797 Ga0207676_10021173
798 Ga0207676_10027340
799 Ga0207676_10266404
800 Ga0207675_100047872
801 Ga0207675_101005551
802 Ga0207683_10005954
803 Ga0207683_10181403
804 Ga0207683_10505360
805 Ga0207698_10468311
806 Ga0207698_11412983
807 Ga0209998_10048829
808 Ga0209974_10004417
809 Ga0268266_10334911
810 Ga0268265_10396457
811 Ga0268264_10684018
812 Ga0307515_10001629
813 Ga0307515_10066207
814 Ga0307515_10076602
815 Ga0307515_10087646
816 Ga0307515_10185483
817 Ga0307515_10248555
818 Ga0307515_10381387
819 Ga0265324_10023001
820 Ga0307512_10034290
821 Ga0265330_10003812
822 Ga0265332_10000841
823 Ga0265325_10033294
824 Ga0265339_10024672
825 Ga0265331_10000936
826 Ga0265327_10016553
827 Ga0265316_10081530
828 Ga0307513_10018405
829 Ga0307513_10056239
830 Ga0307513_10208749
831 Ga0307408_100000016
832 Ga0307408_100001185
833 Ga0307408_100137393
834 Ga0307408_100259889
835 Ga0307408_100790460
836 Ga0307508_10000133
837 Ga0307508_10008282
838 Ga0307514_10001199
839 Ga0310114_106115
840 Ga0265314_10022857
841 Ga0265314_10088545
842 Ga0265342_10011638
843 Ga0307516_10001653
844 Ga0307516_10004130
845 Ga0307516_10529591
846 Ga0307405_10143158
847 Ga0307413_10008938
848 Ga0307413_10865361
849 Ga0307410_10006974
850 Ga0307406_10680800
851 Ga0307412_10021971
852 Ga0307412_10069539
853 Ga0307412_10205664
854 Ga0307412_10881956
855 Ga0307409_100358191
856 Ga0307409_100373413
857 Ga0307409_101270618
858 Ga0307416_100506068
859 Ga0307416_100561127
860 Ga0307414_10294130
861 Ga0307411_10001686
862 Ga0307411_10007222
863 Ga0307411_10366328
864 Ga0307507_10072829
865 Ga0373932_0030684
866 Ga0373932_0259455
867 Ga0373956_0389125
868 Ga0373931_0011014
869 Ga0373927_0278669
870 Ga0310110_009968
871 Ga0373925_0230941
872 Ga0395898_0035646
873 Ga0395905_0000782
874 Ga0395905_0029628
875 Ga0395905_0376182
876 Ga0395905_0516671
877 Ga0395901_0164392
878 Ga0436361_0089148
879 Ga0436361_0674953
880 Ga0451789_0665935
881 Ga0451795_1163136
882 Ga0451837_1651674
883 Ga0451853_0688630
884 Ga0439449_0023753
885 Ga0450917_007568
886 Ga0450888_007523
887 Ga0450890_001567
888 Ga0450892_000865
889 Ga0450889_000295
890 Ga0439459_0016544
891 Ga0439464_0086757
892 Ga0450916_001506
893 Ga0451577_0002689
894 Ga0451577_0114053
895 Ga0466969_0000010
896 Ga0466963_0013321
897 Ga0453684_0018778
898 Ga0453684_0668863
899 Ga0451576_0023757
900 Ga0451576_0026680
901 Ga0466967_0415475
902 Ga0495617_000739
903 Ga0495651_0272826
904 Ga0495650_0003225
905 Ga0495580_0074020
906 Ga0495639_0008991
907 Ga0495585_0000002
908 Ga0495583_0000022
909 Ga0495606_0000015
910 Ga0495606_0002047
911 Ga0495606_0379548
912 Ga0495610_0130149
913 Ga0495616_0001036
914 Ga0495643_0073530
915 Ga0495648_0000012
916 Ga0495642_0036103
917 Ga0495609_0005783
918 Ga0495611_0006678
919 Ga0495625_0000836
920 Ga0495625_0015143
921 Ga0495658_0430497
922 Ga0495649_0000107
923 Ga0495589_0012806
924 Ga0495672_0118434
925 Ga0495683_0052365
926 Ga0495683_0097141
927 Ga0495677_0005267
928 Ga0495673_0024365
929 Ga0495615_0020053
930 Ga0496101_0507573
931 Ga0496102_0004336
932 Ga0496102_0043870
933 Ga0496104_0041019
934 Ga0496104_0266443
935 Ga0496104_0364401
936 Ga0496104_0599432
937 Ga0496105_0086151
938 Ga0496105_0446326
939 Ga0496106_0433763
940 Ga0496108_0132577
941 Ga0496109_0049985
942 Ga0496109_0219499
943 Ga0496109_0888812
944 Ga0496110_0234851
945 Ga0496110_0263396
946 Ga0496110_0926171
947 Ga0496112_0090918
948 Ga0496113_0019957
949 Ga0496126_0060046
950 Ga0501306_019325
951 Ga0501306_022724
952 Ga0501306_023974
953 Ga0501306_036644
954 Ga0501306_038126
955 Ga0501306_047748
956 Ga0501308_008344
957 Ga0501308_014112
958 Ga0501308_017156
959 Ga0501308_025863
960 Ga0501308_032844
961 Ga0501309_019874
962 Ga0501309_022375
963 Ga0501309_026787
964 Ga0501309_042344
965 Ga0501309_043192
966 Ga0501310_005408
967 Ga0501310_015935
968 Ga0501310_016771
969 Ga0501310_032224
970 Ga0501304_002111
971 Ga0501304_009171
972 Ga0501304_010073
973 Ga0501305_004967
974 Ga0501305_025679
975 Ga0501305_061837
976 Ga0501307_014970
977 Ga0501307_015866
978 Ga0501307_036511
979 Ga0501301_001001
980 Ga0501311_021877
981 Ga0501312_022694
982 Ga0501312_027371
983 Ga0501312_041842
984 Ga0501313_004639
985 Ga0501313_012288
986 Ga0501313_022124
987 Ga0501314_005403
988 Ga0501314_006300
989 Ga0501314_009495
990 Ga0501314_010826
991 Ga0501315_013319
992 Ga0501315_013691
993 Ga0501315_019056
994 Ga0501315_020848
995 Ga0501315_046432
996 Ga0501316_014237
997 Ga0501318_016402
998 Ga0501321_008375
999 Ga0501321_015649
1000 Ga0501321_032352
1001 Ga0501321_034690
1002 Ga0501321_044859
1003 Ga0501322_004430
1004 Ga0501322_005818
1005 Ga0501322_006249
1006 Ga0501322_007047
1007 Ga0501322_009782
1008 Ga0501322_011512
1009 Ga0501323_037184
1010 Ga0501324_008437
1011 Ga0501325_021040
1012 Ga0501334_10657
1013 Ga0501340_004446
1014 Ga0501032_0115274
1015 Ga0501034_0274939
1016 Ga0501043_0000002
1017 Ga0501046_0000008
1018 Ga0501047_0000003
1019 Ga0501048_0122131
1020 Ga0501211_011872
1021 Ga0501227_010609
1022 Ga0501252_008151
1023 Ga0501255_007710
1024 Ga0501045_0001048
1025 nmdc:mga03683_208573_c1
1026 nmdc:mga03n38_96993_c1
1027 nmdc:mga0k408_1147_c1
1028 nmdc:mga0k408_137125_c1
1029 nmdc:mga0k408_14103_c1
1030 nmdc:mga0k408_298415_c1
1031 nmdc:mga0k408_32895_c1
1032 nmdc:mga0k408_4840_c1
1033 nmdc:mga0k408_533_c1
1034 nmdc:mga07m45_114_c1
1035 nmdc:mga07m45_14185_c1
1036 nmdc:mga09592_2396_c1
1037 nmdc:mga0a205_200296_c1
1038 Ga0495655_0176144
1039 Ga0500578_0256687
1040 Ga0500608_092540
1041 Ga0500559_0030666
1042 Ga0500590_019010
1043 Ga0500619_000030
1044 Ga0500636_0002776
1045 Ga0500587_002994
1046 Ga0500661_004209
1047 Ga0466962_0231622
1048 2587756789
1049 2643743391
1050 2643932569
1051 2644260839
1052 2644313820
1053 2739056312
1054 2932413186
1055 2932417247
1056 8055228875

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

1

195

0.93

PF03358

FMN_red

NADPH-dependent FMN reductase

1

168

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9537 1 200
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9533 1 200
7n2x-assembly1.cif.gz_A the crystal structure of an fmn-dependent nadh:quinone oxidoreductase, azor from escherichia coli 0.9496 2 200
1tik-assembly1.cif.gz_A crystal structure of acyl carrier protein phosphodiesterase 0.9494 2 200
1t5b-assembly1.cif.gz_B structural genomics, a protein from salmonella typhimurium similar to e. coli acyl carrier protein phosphodiesterase 0.9483 2 198
ID Description Score Start End Superfamily
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9472 2 200 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9186 1 199 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9064 2 200 3.40.50.360
6dxpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8959 2 199 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8924 1 199 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A519ZS40-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9888 1 203 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-U3TZ50-F1-model_v4 NAD(P)H dehydrogenase 0.9887 79 202
AF-A0A149PSZ8-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9861 2 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-Q2SUH7-F1-model_v4 FMN-dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9858 2 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A132C5Q7-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9856 2 200 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Map