F459722

General Info

Members Datasets Scaffolds Average Seq Length
528 283 1056 404

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000641|Ga0495686_0000641_6126_7433
Length 435
Sequence LTARRAFSTPRDRAKYKKRVGTAGGERLQHAGDAHVSDAILGQVALGYSPFIDRNRSVSATRLTVAPLKPDAQLDVSQLLEAVGSVWPASGGRVSLNVASERLLEDLLRAEPTANLMVEVPAFMAAEPANSDSIRILHAKGNTLLIKGRPLRELPRDVLPCFKYSIIDLSDERRLGEVAAPAGVTRSIGHVQSGVRTIADMEASFARGAQAVLGWPIDDAIATSARPTRQAAPVDIQVIIELIGRVDKEEAIDRLEATLKRDPALAFKLLRYINSPAFGLRVEISSFSHAIMLLGYQRLKRWLALLLATASKEVNLKPVMFAAVRRGLLMEELVRGASGDEETRNEVFICGVFSLLDRMFKQPFDQLLASIPVPERVHQALVDETGPFHPYLTVVRAAESESLFDLRDAADAMMTSVGDVNRAQLRALMAAGSLE

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
191 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
244 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
245 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
257 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
258 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
262 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
263 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
275 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
276 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
277 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
278 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
279 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
280 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
281 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
282 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
283 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.83
Nodule 0.38
Rhizoplane 5.11
Rhizosphere 73.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000641 3300047472 Bacteria 48207
2 JGI24740J21852_10013497 3300001979 Bacteria 3043
3 JGI25152J39213_1014456 3300002773 Bacteria 1600
4 JGI25153J46596_10001793 3300003215 Bacteria 12736
5 JGI25153J46596_10003312 3300003215 Bacteria 9055
6 Ga0055524_1001151 3300003775 Bacteria 15925
7 Ga0055530_10001410 3300003791 Bacteria 17677
8 Ga0055540_1000014 3300003792 Bacteria 234171
9 Ga0065165_1001294 3300005262 Bacteria 28122
10 Ga0070658_10039942 3300005327 Bacteria 3786
11 Ga0070676_10001564 3300005328 Bacteria 11610
12 Ga0070676_10006112 3300005328 Bacteria 6429
13 Ga0070670_100000850 3300005331 Bacteria 23893
14 Ga0070670_100012047 3300005331 Bacteria 7398
15 Ga0070670_100038810 3300005331 Bacteria 4095
16 Ga0070670_100104778 3300005331 Bacteria 2436
17 Ga0070677_10001161 3300005333 Bacteria 8470
18 Ga0070677_10022759 3300005333 Bacteria 2311
19 Ga0070677_10027191 3300005333 Bacteria 2152
20 Ga0070677_10046189 3300005333 Bacteria 1741
21 Ga0068869_100001930 3300005334 Bacteria 12450
22 Ga0068869_100007786 3300005334 Bacteria 6873
23 Ga0068869_100032429 3300005334 Bacteria 3681
24 Ga0070666_10001417 3300005335 Bacteria 14515
25 Ga0070680_100062401 3300005336 Bacteria 3052
26 Ga0068868_100005488 3300005338 Bacteria 8921
27 Ga0068868_100065939 3300005338 Bacteria 2877
28 Ga0068868_100130850 3300005338 Bacteria 2053
29 Ga0070689_100038903 3300005340 Bacteria 3640
30 Ga0070661_100000220 3300005344 Bacteria 47213
31 Ga0070661_100004395 3300005344 Bacteria 9720
32 Ga0070668_100020353 3300005347 Bacteria 5007
33 Ga0070668_100055970 3300005347 Bacteria 3045
34 Ga0070669_100017583 3300005353 Bacteria 5100
35 Ga0070669_100023126 3300005353 Bacteria 4449
36 Ga0070669_100058833 3300005353 Bacteria 2821
37 Ga0070675_100002378 3300005354 Bacteria 14007
38 Ga0070675_100005838 3300005354 Bacteria 9428
39 Ga0070675_100170894 3300005354 Bacteria 1874
40 Ga0070675_100294131 3300005354 Bacteria 1429
41 Ga0070671_100001602 3300005355 Bacteria 17027
42 Ga0070671_100010767 3300005355 Bacteria 7337
43 Ga0070671_100025795 3300005355 Bacteria 4826
44 Ga0070671_100028140 3300005355 Bacteria 4628
45 Ga0070671_100068350 3300005355 Bacteria 2963
46 Ga0070671_100082694 3300005355 Bacteria 2685
47 Ga0070671_100259578 3300005355 Bacteria 1476
48 Ga0070674_100004197 3300005356 Bacteria 8183
49 Ga0070674_100027692 3300005356 Bacteria 3716
50 Ga0070674_100068029 3300005356 Bacteria 2507
51 Ga0070673_100101271 3300005364 Bacteria 2373
52 Ga0070688_100008052 3300005365 Bacteria 5706
53 Ga0070659_100008236 3300005366 Bacteria 7612
54 Ga0070659_100013477 3300005366 Bacteria 6086
55 Ga0070659_100026701 3300005366 Bacteria 4445
56 Ga0070667_100000700 3300005367 Bacteria 32341
57 Ga0070667_100022869 3300005367 Bacteria 5184
58 Ga0070667_100063344 3300005367 Bacteria 3133
59 Ga0070663_100000511 3300005455 Bacteria 20575
60 Ga0070663_100046580 3300005455 Bacteria 3069
61 Ga0070663_100075636 3300005455 Bacteria 2461
62 Ga0070678_100004257 3300005456 Bacteria 8088
63 Ga0070678_100026242 3300005456 Bacteria 3936
64 Ga0070678_100053222 3300005456 Bacteria 2943
65 Ga0070678_100080176 3300005456 Bacteria 2471
66 Ga0070678_100191278 3300005456 Bacteria 1683
67 Ga0070662_100003680 3300005457 Bacteria 9583
68 Ga0070662_100051438 3300005457 Bacteria 2975
69 Ga0070681_10065472 3300005458 Bacteria 3603
70 Ga0068867_100000790 3300005459 Bacteria 21397
71 Ga0068867_100001505 3300005459 Bacteria 16135
72 Ga0068867_100048546 3300005459 Bacteria 3123
73 Ga0068867_100061021 3300005459 Bacteria 2798
74 Ga0070706_100005275 3300005467 Bacteria 12329
75 Ga0070707_100016301 3300005468 Bacteria 6975
76 Ga0070679_100036242 3300005530 Bacteria 4895
77 Ga0070684_100043726 3300005535 Bacteria 3870
78 Ga0068853_100023812 3300005539 Bacteria 5130
79 Ga0068853_100107354 3300005539 Bacteria 2475
80 Ga0070672_100005230 3300005543 Bacteria 8586
81 Ga0070672_100013351 3300005543 Bacteria 5800
82 Ga0070672_100018310 3300005543 Bacteria 5060
83 Ga0070672_100072588 3300005543 Bacteria 2740
84 Ga0070695_100136846 3300005545 Bacteria 1694
85 Ga0070693_100039465 3300005547 Bacteria 2645
86 Ga0070665_100028628 3300005548 Bacteria 5609
87 Ga0070665_100099839 3300005548 Bacteria 2907
88 Ga0070665_100255654 3300005548 Bacteria 1753
89 Ga0070664_100000267 3300005564 Bacteria 37668
90 Ga0070664_100025846 3300005564 Bacteria 4868
91 Ga0068857_100009741 3300005577 Bacteria 8345
92 Ga0068857_100015810 3300005577 Bacteria 6603
93 Ga0068857_100096776 3300005577 Bacteria 2645
94 Ga0068854_100008232 3300005578 Bacteria 6694
95 Ga0068854_100060485 3300005578 Bacteria 2741
96 Ga0068854_100086561 3300005578 Bacteria 2323
97 Ga0068856_100037445 3300005614 Bacteria 4760
98 Ga0068856_100047332 3300005614 Bacteria 4236
99 Ga0068852_100015611 3300005616 Bacteria 5899
100 Ga0068852_100032179 3300005616 Bacteria 4340
101 Ga0068864_100001169 3300005618 Bacteria 21827
102 Ga0068864_100018861 3300005618 Bacteria 5768
103 Ga0068864_100028539 3300005618 Bacteria 4718
104 Ga0068864_100036915 3300005618 Bacteria 4167
105 Ga0068851_10004895 3300005834 Bacteria 6067
106 Ga0068870_10088587 3300005840 Bacteria 1726
107 Ga0068863_100003087 3300005841 Bacteria 16458
108 Ga0068858_100001403 3300005842 Bacteria 24769
109 Ga0068860_100010683 3300005843 Bacteria 9068
110 Ga0068860_100017927 3300005843 Bacteria 6894
111 Ga0068860_100100037 3300005843 Bacteria 2766
112 Ga0068862_100236157 3300005844 Bacteria 1660
113 Ga0075363_100001312 3300006048 Bacteria 9293
114 Ga0075364_10071683 3300006051 Bacteria 2282
115 Ga0070716_100058552 3300006173 Bacteria 2218
116 Ga0075362_10001775 3300006177 Bacteria 7027
117 Ga0075367_10004973 3300006178 Bacteria 6556
118 Ga0075366_10002196 3300006195 Bacteria 9958
119 Ga0075366_10003537 3300006195 Bacteria 8256
120 Ga0075366_10015046 3300006195 Bacteria 4425
121 Ga0075366_10034864 3300006195 Bacteria 2966
122 Ga0075366_10065619 3300006195 Bacteria 2159
123 Ga0097621_100031891 3300006237 Bacteria 4183
124 Ga0075370_10000544 3300006353 Bacteria 14442
125 Ga0075370_10001735 3300006353 Bacteria 9703
126 Ga0075370_10002192 3300006353 Bacteria 8970
127 Ga0075370_10004146 3300006353 Bacteria 6986
128 Ga0075370_10004604 3300006353 Bacteria 6728
129 Ga0075370_10008319 3300006353 Bacteria 5332
130 Ga0068871_100006389 3300006358 Bacteria 8331
131 Ga0068871_100015057 3300006358 Bacteria 5782
132 Ga0068871_100023376 3300006358 Bacteria 4780
133 Ga0068871_100046989 3300006358 Bacteria 3479
134 Ga0075430_100022549 3300006846 Bacteria 5359
135 Ga0075429_100001909 3300006880 Bacteria 17285
136 Ga0068865_100041519 3300006881 Bacteria 3131
137 Ga0068865_100144474 3300006881 Bacteria 1798
138 Ga0079104_1000013 3300006946 Bacteria 349477
139 Ga0105240_10042958 3300009093 Bacteria 5757
140 Ga0105243_10105836 3300009148 Bacteria 2344
141 Ga0105248_10023381 3300009177 Bacteria 6865
142 Ga0105248_10059995 3300009177 Bacteria 4271
143 Ga0105237_10000441 3300009545 Bacteria 59156
144 Ga0105249_10079525 3300009553 Bacteria 3043
145 Ga0105239_10000417 3300010375 Bacteria 62040
146 Ga0105239_10061949 3300010375 Bacteria 4106
147 Ga0157373_10044056 3300013100 Bacteria 3185
148 Ga0157371_10084941 3300013102 Bacteria 2243
149 Ga0157371_10086880 3300013102 Bacteria 2215
150 Ga0157370_10215048 3300013104 Bacteria 1781
151 Ga0157369_10016240 3300013105 Bacteria 8378
152 Ga0157369_10281376 3300013105 Bacteria 1732
153 Ga0157374_10030550 3300013296 Bacteria 4893
154 Ga0157374_10252998 3300013296 Bacteria 1734
155 Ga0157378_10076710 3300013297 Bacteria 3012
156 Ga0157378_10304473 3300013297 Bacteria 1544
157 Ga0163162_10092316 3300013306 Bacteria 3111
158 Ga0163162_10125563 3300013306 Bacteria 2672
159 Ga0157372_10012500 3300013307 Bacteria 9047
160 Ga0157372_10015768 3300013307 Bacteria 8107
161 Ga0157375_10020984 3300013308 Bacteria 5979
162 Ga0157375_10092557 3300013308 Bacteria 3087
163 Ga0157375_10119325 3300013308 Bacteria 2745
164 Ga0157375_10218821 3300013308 Bacteria 2062
165 Ga0157375_10400307 3300013308 Bacteria 1540
166 Ga0163163_10004471 3300014325 Bacteria 11926
167 Ga0157380_10025010 3300014326 Bacteria 4524
168 Ga0157380_10081888 3300014326 Bacteria 2641
169 Ga0157377_10000091 3300014745 Bacteria 66087
170 Ga0157377_10011248 3300014745 Bacteria 4460
171 Ga0157379_10025520 3300014968 Bacteria 5251
172 Ga0157379_10037635 3300014968 Bacteria 4315
173 Ga0157376_10034126 3300014969 Bacteria 4105
174 Ga0163161_10013653 3300017792 Bacteria 5655
175 Ga0163161_10028838 3300017792 Bacteria 3944
176 Ga0163161_10178971 3300017792 Bacteria 1625
177 Ga0207425_1000333 3300025245 Bacteria 33033
178 Ga0209129_1000027 3300025258 Bacteria 409587
179 Ga0209675_1007396 3300025291 Bacteria 4217
180 Ga0209564_1000014 3300025295 Bacteria 621501
181 Ga0209758_1000193 3300025297 Bacteria 134744
182 Ga0209758_1000208 3300025297 Bacteria 128596
183 Ga0209050_1000142 3300025298 Bacteria 172356
184 Ga0209050_1000198 3300025298 Bacteria 134820
185 Ga0209050_1006967 3300025298 Bacteria 6512
186 Ga0209256_1000130 3300025299 Bacteria 163227
187 Ga0209256_1012809 3300025299 Bacteria 3171
188 Ga0209051_1000035 3300025303 Bacteria 346999
189 Ga0209257_1000346 3300025304 Bacteria 95662
190 Ga0207697_10004245 3300025315 Bacteria 6886
191 Ga0207697_10022878 3300025315 Bacteria 2560
192 Ga0207656_10007396 3300025321 Bacteria 3997
193 Ga0207656_10015902 3300025321 Bacteria 2920
194 Ga0207682_10005976 3300025893 Bacteria 4923
195 Ga0207682_10023234 3300025893 Bacteria 2448
196 Ga0207682_10024932 3300025893 Bacteria 2371
197 Ga0207682_10040945 3300025893 Bacteria 1890
198 Ga0207682_10043516 3300025893 Bacteria 1838
199 Ga0207688_10051915 3300025901 Bacteria 2297
200 Ga0207680_10002275 3300025903 Bacteria 8950
201 Ga0207680_10035991 3300025903 Bacteria 2848
202 Ga0207645_10011311 3300025907 Bacteria 6099
203 Ga0207645_10015942 3300025907 Bacteria 4978
204 Ga0207645_10048629 3300025907 Bacteria 2709
205 Ga0207645_10100415 3300025907 Bacteria 1866
206 Ga0207645_10106162 3300025907 Bacteria 1815
207 Ga0207684_10002424 3300025910 Bacteria 18808
208 Ga0207707_10028520 3300025912 Bacteria 4879
209 Ga0207695_10015223 3300025913 Bacteria 9070
210 Ga0207695_10070632 3300025913 Bacteria 3568
211 Ga0207671_10002786 3300025914 Bacteria 18241
212 Ga0207660_10038330 3300025917 Bacteria 3345
213 Ga0207657_10040431 3300025919 Bacteria 4131
214 Ga0207657_10067246 3300025919 Bacteria 3048
215 Ga0207657_10190493 3300025919 Bacteria 1655
216 Ga0207649_10004236 3300025920 Bacteria 7815
217 Ga0207649_10014866 3300025920 Bacteria 4366
218 Ga0207652_10010623 3300025921 Bacteria 7412
219 Ga0207646_10038390 3300025922 Bacteria 4314
220 Ga0207681_10003527 3300025923 Bacteria 9744
221 Ga0207681_10005845 3300025923 Bacteria 7542
222 Ga0207681_10024798 3300025923 Bacteria 3851
223 Ga0207681_10072811 3300025923 Bacteria 2401
224 Ga0207681_10076583 3300025923 Bacteria 2349
225 Ga0207694_10142580 3300025924 Bacteria 1927
226 Ga0207650_10001495 3300025925 Bacteria 16717
227 Ga0207650_10002422 3300025925 Bacteria 12992
228 Ga0207650_10002662 3300025925 Bacteria 12361
229 Ga0207650_10013864 3300025925 Bacteria 5591
230 Ga0207659_10000197 3300025926 Bacteria 35939
231 Ga0207659_10000491 3300025926 Bacteria 23784
232 Ga0207659_10096067 3300025926 Bacteria 2224
233 Ga0207644_10003393 3300025931 Bacteria 10277
234 Ga0207644_10003455 3300025931 Bacteria 10217
235 Ga0207644_10026560 3300025931 Bacteria 3991
236 Ga0207644_10044039 3300025931 Bacteria 3169
237 Ga0207644_10112187 3300025931 Bacteria 2063
238 Ga0207644_10123039 3300025931 Bacteria 1977
239 Ga0207690_10002989 3300025932 Bacteria 10183
240 Ga0207690_10041816 3300025932 Bacteria 3006
241 Ga0207706_10000544 3300025933 Bacteria 39990
242 Ga0207706_10000993 3300025933 Bacteria 28866
243 Ga0207706_10001576 3300025933 Bacteria 22614
244 Ga0207706_10106786 3300025933 Bacteria 2464
245 Ga0207686_10026833 3300025934 Bacteria 3366
246 Ga0207709_10023421 3300025935 Bacteria 3514
247 Ga0207709_10026271 3300025935 Bacteria 3343
248 Ga0207709_10065359 3300025935 Bacteria 2287
249 Ga0207669_10002886 3300025937 Bacteria 7372
250 Ga0207669_10022293 3300025937 Bacteria 3361
251 Ga0207691_10004989 3300025940 Bacteria 12802
252 Ga0207691_10009144 3300025940 Bacteria 9507
253 Ga0207691_10015065 3300025940 Bacteria 7358
254 Ga0207691_10111566 3300025940 Bacteria 2432
255 Ga0207711_10016610 3300025941 Bacteria 6113
256 Ga0207711_10047246 3300025941 Bacteria 3679
257 Ga0207711_10050423 3300025941 Bacteria 3563
258 Ga0207711_10061461 3300025941 Bacteria 3239
259 Ga0207711_10068625 3300025941 Bacteria 3071
260 Ga0207711_10132857 3300025941 Bacteria 2233
261 Ga0207689_10000855 3300025942 Bacteria 29354
262 Ga0207689_10003648 3300025942 Bacteria 14048
263 Ga0207689_10018163 3300025942 Bacteria 5938
264 Ga0207689_10050362 3300025942 Bacteria 3434
265 Ga0207661_10042231 3300025944 Bacteria 3594
266 Ga0207661_10092185 3300025944 Bacteria 2525
267 Ga0207679_10000486 3300025945 Bacteria 27449
268 Ga0207679_10174845 3300025945 Bacteria 1771
269 Ga0207667_10166048 3300025949 Bacteria 2269
270 Ga0207651_10032121 3300025960 Bacteria 3367
271 Ga0207712_10014153 3300025961 Bacteria 5121
272 Ga0207668_10056346 3300025972 Bacteria 2737
273 Ga0207640_10008411 3300025981 Bacteria 5732
274 Ga0207640_10024472 3300025981 Bacteria 3643
275 Ga0207658_10000584 3300025986 Bacteria 32681
276 Ga0207658_10003965 3300025986 Bacteria 10396
277 Ga0207658_10005437 3300025986 Bacteria 8735
278 Ga0207658_10030903 3300025986 Bacteria 3798
279 Ga0207658_10033108 3300025986 Bacteria 3684
280 Ga0207658_10094852 3300025986 Bacteria 2323
281 Ga0207677_10000523 3300026023 Bacteria 24613
282 Ga0207677_10012873 3300026023 Bacteria 4829
283 Ga0207677_10071933 3300026023 Bacteria 2442
284 Ga0207703_10000325 3300026035 Bacteria 51876
285 Ga0207703_10111500 3300026035 Bacteria 2335
286 Ga0207639_10006545 3300026041 Bacteria 7924
287 Ga0207639_10045710 3300026041 Bacteria 3300
288 Ga0207678_10003625 3300026067 Bacteria 13877
289 Ga0207678_10017597 3300026067 Bacteria 6276
290 Ga0207678_10155292 3300026067 Bacteria 1954
291 Ga0207702_10026873 3300026078 Bacteria 4779
292 Ga0207641_10001571 3300026088 Bacteria 22312
293 Ga0207641_10129171 3300026088 Bacteria 2266
294 Ga0207641_10202534 3300026088 Bacteria 1831
295 Ga0207648_10001338 3300026089 Bacteria 27369
296 Ga0207648_10002162 3300026089 Bacteria 21355
297 Ga0207648_10041343 3300026089 Bacteria 4048
298 Ga0207648_10044536 3300026089 Bacteria 3893
299 Ga0207648_10074488 3300026089 Bacteria 2958
300 Ga0207676_10000490 3300026095 Bacteria 33231
301 Ga0207676_10004059 3300026095 Bacteria 10327
302 Ga0207676_10007412 3300026095 Bacteria 7781
303 Ga0207676_10014315 3300026095 Bacteria 5705
304 Ga0207676_10020395 3300026095 Bacteria 4850
305 Ga0207674_10021787 3300026116 Bacteria 6896
306 Ga0207674_10033221 3300026116 Bacteria 5402
307 Ga0207675_100000911 3300026118 Bacteria 29492
308 Ga0207675_100118816 3300026118 Bacteria 2500
309 Ga0207683_10008423 3300026121 Bacteria 8824
310 Ga0207683_10060515 3300026121 Bacteria 3329
311 Ga0207683_10103260 3300026121 Bacteria 2546
312 Ga0207683_10309977 3300026121 Bacteria 1445
313 Ga0207698_10009024 3300026142 Bacteria 6333
314 Ga0207698_10035985 3300026142 Bacteria 3628
315 Ga0207698_10060582 3300026142 Bacteria 2944
316 Ga0207698_10115067 3300026142 Bacteria 2264
317 Ga0207698_10178880 3300026142 Bacteria 1876
318 Ga0209281_1000076 3300027111 Bacteria 263350
319 Ga0209995_1004239 3300027471 Bacteria 2291
320 Ga0209966_1000250 3300027695 Bacteria 19646
321 Ga0268266_10004766 3300028379 Bacteria 12893
322 Ga0268266_10076620 3300028379 Bacteria 2907
323 Ga0268266_10313906 3300028379 Bacteria 1465
324 Ga0268265_10103371 3300028380 Bacteria 2307
325 Ga0268264_10043201 3300028381 Bacteria 3734
326 Ga0268264_10097161 3300028381 Bacteria 2552
327 Ga0307517_10000358 3300028786 Bacteria 78437
328 Ga0307515_10000232 3300028794 Bacteria 137778
329 Ga0307515_10012249 3300028794 Bacteria 16150
330 Ga0307515_10046000 3300028794 Bacteria 6684
331 Ga0307515_10097254 3300028794 Bacteria 3600
332 Ga0307512_10058446 3300030522 Bacteria 3004
333 Ga0265328_10012280 3300031239 Bacteria 3410
334 Ga0265327_10000341 3300031251 Bacteria 88581
335 Ga0265316_10000770 3300031344 Bacteria 35350
336 Ga0307513_10042456 3300031456 Bacteria 5007
337 Ga0307513_10090390 3300031456 Bacteria 3123
338 Ga0307513_10109616 3300031456 Bacteria 2758
339 Ga0307509_10007751 3300031507 Bacteria 13919
340 Ga0307509_10010057 3300031507 Bacteria 11671
341 Ga0307509_10198674 3300031507 Bacteria 1845
342 Ga0307408_100047721 3300031548 Bacteria 3068
343 Ga0307408_100077938 3300031548 Bacteria 2469
344 Ga0307408_100197137 3300031548 Bacteria 1627
345 Ga0307508_10001328 3300031616 Bacteria 27985
346 Ga0307508_10007433 3300031616 Bacteria 10204
347 Ga0307508_10046851 3300031616 Bacteria 3858
348 Ga0307514_10001289 3300031649 Bacteria 32516
349 Ga0307514_10006184 3300031649 Bacteria 10502
350 Ga0307516_10000705 3300031730 Bacteria 45448
351 Ga0307516_10009234 3300031730 Bacteria 11036
352 Ga0307516_10061610 3300031730 Bacteria 3639
353 Ga0307516_10090480 3300031730 Bacteria 2889
354 Ga0307405_10026545 3300031731 Bacteria 3343
355 Ga0307410_10002589 3300031852 Bacteria 8782
356 Ga0307407_10004834 3300031903 Bacteria 5777
357 Ga0307412_10040965 3300031911 Bacteria 2999
358 Ga0307412_10089832 3300031911 Bacteria 2146
359 Ga0307412_10180564 3300031911 Bacteria 1587
360 Ga0307409_100002804 3300031995 Bacteria 9214
361 Ga0307409_100117620 3300031995 Bacteria 2243
362 Ga0307416_100001904 3300032002 Bacteria 11656
363 Ga0307416_100021844 3300032002 Bacteria 4605
364 Ga0307416_100027530 3300032002 Bacteria 4212
365 Ga0307414_10061772 3300032004 Bacteria 2655
366 Ga0307414_10205700 3300032004 Bacteria 1605
367 Ga0307411_10006762 3300032005 Bacteria 5769
368 Ga0307411_10031968 3300032005 Bacteria 3246
369 Ga0307411_10207945 3300032005 Bacteria 1509
370 Ga0307415_100020097 3300032126 Bacteria 4070
371 Ga0307510_10010166 3300033180 Bacteria 11189
372 Ga0307510_10021392 3300033180 Bacteria 7537
373 Ga0373938_0009821 3300034957 Bacteria 1742
374 Ga0373932_0020399 3300035112 Bacteria 1738
375 Ga0373960_0005337 3300035121 Bacteria 2972
376 Ga0373931_0010779 3300035691 Bacteria 4401
377 Ga0373931_0015069 3300035691 Bacteria 3788
378 Ga0373935_0106237 3300035692 Bacteria 1858
379 Ga0373937_0011428 3300036401 Bacteria 7792
380 Ga0373937_0025052 3300036401 Bacteria 5386
381 Ga0373937_0035619 3300036401 Bacteria 4531
382 Ga0395900_0000025 3300037418 Bacteria 321217
383 Ga0395898_0001478 3300037466 Bacteria 32803
384 Ga0395905_0000460 3300037471 Bacteria 56900
385 Ga0395905_0008848 3300037471 Bacteria 9894
386 Ga0395905_0068259 3300037471 Bacteria 3330
387 Ga0395905_0232625 3300037471 Bacteria 1723
388 Ga0436365_1344679 3300039437 Bacteria 3804
389 Ga0451793_1360215 3300041452 Bacteria 2662
390 Ga0451795_0308091 3300041456 Bacteria 3102
391 Ga0451798_0692568 3300041458 Bacteria 3075
392 Ga0451800_0446976 3300041459 Bacteria 3148
393 Ga0451804_0374343 3300041463 Bacteria 2124
394 Ga0451807_2227266 3300041486 Bacteria 1773
395 Ga0451853_2629430 3300041512 Bacteria 2468
396 Ga0451853_2923840 3300041512 Bacteria 1521
397 Ga0450919_000201 3300042121 Bacteria 6573
398 Ga0450898_008760 3300042134 Bacteria 1605
399 Ga0439434_0011310 3300042435 Bacteria 2638
400 Ga0439434_0017057 3300042435 Bacteria 2172
401 Ga0450918_000044 3300042531 Bacteria 25679
402 Ga0466969_0000097 3300044656 Bacteria 45819
403 Ga0466969_0009150 3300044656 Bacteria 5253
404 Ga0466972_0000265 3300044658 Bacteria 33659
405 Ga0466972_0013816 3300044658 Bacteria 4053
406 Ga0466965_0044621 3300044683 Bacteria 2191
407 Ga0466966_0008359 3300044684 Bacteria 6854
408 Ga0466966_0020415 3300044684 Bacteria 4355
409 Ga0466966_0028421 3300044684 Bacteria 3643
410 Ga0466961_0001117 3300044693 Bacteria 16493
411 Ga0466963_0006046 3300044694 Bacteria 7131
412 Ga0466964_0001370 3300044706 Bacteria 8317
413 Ga0453684_0008576 3300044712 Bacteria 18241
414 Ga0453684_0309156 3300044712 Bacteria 1794
415 Ga0466970_0010330 3300044765 Bacteria 4737
416 Ga0466957_0071376 3300044842 Bacteria 2147
417 Ga0466959_0001732 3300045049 Bacteria 13559
418 Ga0466959_0031045 3300045049 Bacteria 3954
419 Ga0466959_0047691 3300045049 Bacteria 3150
420 Ga0451576_0130356 3300045051 Bacteria 2621
421 Ga0495592_0000264 3300046454 Bacteria 44823
422 Ga0495629_0131782 3300046459 Bacteria 1741
423 Ga0495638_0035697 3300046460 Bacteria 3168
424 Ga0495606_0169108 3300046507 Bacteria 1270
425 Ga0495610_0017698 3300046512 Bacteria 4055
426 Ga0495620_0055612 3300046515 Bacteria 1667
427 Ga0495632_0003863 3300046519 Bacteria 10422
428 Ga0495632_0017435 3300046519 Bacteria 3963
429 Ga0495648_0099407 3300046524 Bacteria 1610
430 Ga0495652_0146929 3300046529 Bacteria 1847
431 Ga0495597_0012405 3300046542 Bacteria 4111
432 Ga0495645_0047774 3300046543 Bacteria 3118
433 Ga0495645_0065858 3300046543 Bacteria 2621
434 Ga0495625_0001732 3300046660 Bacteria 25240
435 Ga0495625_0006616 3300046660 Bacteria 10289
436 Ga0495635_0053076 3300046663 Bacteria 2793
437 Ga0495647_0025011 3300046681 Bacteria 2178
438 Ga0495624_0102143 3300046690 Bacteria 1765
439 Ga0495649_0031360 3300046694 Bacteria 2931
440 Ga0495687_000212 3300047443 Bacteria 83406
441 Ga0495687_004511 3300047443 Bacteria 9358
442 Ga0495593_0014916 3300047673 Bacteria 4414
443 Ga0496101_0057784 3300048904 Bacteria 2807
444 Ga0496102_0082646 3300048905 Bacteria 2963
445 Ga0496104_0050709 3300048907 Bacteria 3916
446 Ga0496104_0079074 3300048907 Bacteria 3134
447 Ga0496106_0016544 3300048909 Bacteria 5457
448 Ga0496106_0052181 3300048909 Bacteria 3084
449 Ga0496108_0042620 3300048911 Bacteria 3789
450 Ga0496108_0075360 3300048911 Bacteria 2850
451 Ga0496108_0348377 3300048911 Bacteria 1292
452 Ga0496109_0038516 3300048912 Bacteria 4323
453 Ga0496109_0056683 3300048912 Bacteria 3575
454 Ga0496109_0323278 3300048912 Bacteria 1456
455 Ga0496110_0028330 3300048913 Bacteria 4810
456 Ga0496110_0103797 3300048913 Bacteria 2550
457 Ga0496111_0062338 3300048914 Bacteria 2704
458 Ga0496111_0277389 3300048914 Bacteria 1243
459 Ga0496112_0008219 3300048915 Bacteria 9332
460 Ga0496113_0002254 3300048916 Bacteria 11121
461 Ga0496114_0022122 3300048917 Bacteria 5179
462 Ga0496114_0042884 3300048917 Bacteria 3751
463 Ga0496115_0026926 3300048918 Bacteria 4493
464 Ga0496121_0008117 3300048924 Bacteria 12482
465 Ga0496124_0000344 3300048927 Bacteria 85082
466 Ga0496124_0037045 3300048927 Bacteria 4246
467 Ga0496125_0015785 3300048928 Bacteria 7278
468 Ga0501043_0000004 3300049579 Bacteria 291085
469 Ga0501046_0000016 3300049580 Bacteria 234374
470 Ga0501047_0000012 3300049581 Bacteria 368824
471 Ga0501048_0000091 3300049582 Bacteria 48347
472 Ga0501198_000028 3300049649 Bacteria 64045
473 Ga0501222_000024 3300049662 Bacteria 65412
474 Ga0501265_006696 3300049762 Bacteria 1344
475 Ga0501045_0004631 3300049824 Bacteria 9498
476 nmdc:mga03683_43810_c1 3300050489 Bacteria 1848
477 nmdc:mga03n38_38675_c1 3300050490 Bacteria 2065
478 nmdc:mga00v17_64387_c1 3300050491 Bacteria 2259
479 nmdc:mga0k408_10704_c1 3300050493 Bacteria 4969
480 nmdc:mga0k408_11352_c1 3300050493 Bacteria 4849
481 nmdc:mga0k408_1421_c1 3300050493 Bacteria 12955
482 nmdc:mga0k408_24058_c1 3300050493 Bacteria 3440
483 nmdc:mga0k408_3190_c1 3300050493 Bacteria 8684
484 nmdc:mga0k408_58259_c1 3300050493 Bacteria 2243
485 nmdc:mga0k408_8385_c1 3300050493 Bacteria 5543
486 nmdc:mga0k408_920_c1 3300050493 Bacteria 16100
487 nmdc:mga06z11_5994_c1 3300050494 Bacteria 4912
488 nmdc:mga07m45_17267_c1 3300050496 Bacteria 3873
489 nmdc:mga07m45_2013_c1 3300050496 Bacteria 9419
490 nmdc:mga07m45_2402_c1 3300050496 Bacteria 8784
491 nmdc:mga07m45_3003_c1 3300050496 Bacteria 8037
492 nmdc:mga07m45_9661_c1 3300050496 Bacteria 5013
493 nmdc:mga09592_7517_c1 3300050508 Bacteria 8864
494 nmdc:mga0qj67_17913_c1 3300050509 Bacteria 5392
495 nmdc:mga08y16_307697_c1 3300050511 Bacteria 1632
496 Ga0500578_0000006 3300053086 Bacteria 234598
497 Ga0500578_0019216 3300053086 Bacteria 4387
498 Ga0500644_0018480 3300053088 Bacteria 2043
499 Ga0500583_0050067 3300053092 Bacteria 1936
500 Ga0500651_0017238 3300053093 Bacteria 4451
501 Ga0500562_014359 3300053108 Bacteria 2029
502 Ga0500593_000146 3300053117 Bacteria 28072
503 Ga0500623_027963 3300053127 Bacteria 2922
504 Ga0500628_008175 3300053129 Bacteria 1812
505 Ga0500642_0021124 3300053130 Bacteria 2572
506 Ga0500652_000158 3300053131 Bacteria 26062
507 Ga0500652_034854 3300053131 Bacteria 1996
508 Ga0500658_0003740 3300053134 Bacteria 5728
509 Ga0500559_0000092 3300053136 Bacteria 71917
510 Ga0500568_0002391 3300053139 Bacteria 11083
511 Ga0500568_0009756 3300053139 Bacteria 4541
512 Ga0500619_000010 3300053154 Bacteria 61024
513 Ga0500622_0000851 3300053156 Bacteria 26072
514 Ga0500622_0037214 3300053156 Bacteria 2542
515 Ga0500636_0108994 3300053177 Bacteria 1567
516 Ga0500587_001096 3300053739 Bacteria 3710
517 Ga0466962_0009609 3300061719 Bacteria 4639
518 Ga0466962_0021304 3300061719 Bacteria 3113
519 2587725102 2585428057 Bacteria 6737412
520 2587731538 2585428058 Bacteria 6853932
521 2587756226 2585428062 Bacteria 6842168
522 2588295185 2588253510 Bacteria 6901809
523 2643967008 2643221592 Bacteria 6608788
524 2644142623 2643221625 Bacteria 6512927
525 2644243747 2643221644 Bacteria 6865017
526 2644273702 2643221648 Bacteria 6521465
527 2644301805 2643221654 Bacteria 5273570
528 2644338738 2643221660 Bacteria 4208257
529 Ga0495686_0000641
530 JGI24740J21852_10013497
531 JGI25152J39213_1014456
532 JGI25153J46596_10001793
533 JGI25153J46596_10003312
534 Ga0055524_1001151
535 Ga0055530_10001410
536 Ga0055540_1000014
537 Ga0065165_1001294
538 Ga0070658_10039942
539 Ga0070676_10001564
540 Ga0070676_10006112
541 Ga0070670_100000850
542 Ga0070670_100012047
543 Ga0070670_100038810
544 Ga0070670_100104778
545 Ga0070677_10001161
546 Ga0070677_10022759
547 Ga0070677_10027191
548 Ga0070677_10046189
549 Ga0068869_100001930
550 Ga0068869_100007786
551 Ga0068869_100032429
552 Ga0070666_10001417
553 Ga0070680_100062401
554 Ga0068868_100005488
555 Ga0068868_100065939
556 Ga0068868_100130850
557 Ga0070689_100038903
558 Ga0070661_100000220
559 Ga0070661_100004395
560 Ga0070668_100020353
561 Ga0070668_100055970
562 Ga0070669_100017583
563 Ga0070669_100023126
564 Ga0070669_100058833
565 Ga0070675_100002378
566 Ga0070675_100005838
567 Ga0070675_100170894
568 Ga0070675_100294131
569 Ga0070671_100001602
570 Ga0070671_100010767
571 Ga0070671_100025795
572 Ga0070671_100028140
573 Ga0070671_100068350
574 Ga0070671_100082694
575 Ga0070671_100259578
576 Ga0070674_100004197
577 Ga0070674_100027692
578 Ga0070674_100068029
579 Ga0070673_100101271
580 Ga0070688_100008052
581 Ga0070659_100008236
582 Ga0070659_100013477
583 Ga0070659_100026701
584 Ga0070667_100000700
585 Ga0070667_100022869
586 Ga0070667_100063344
587 Ga0070663_100000511
588 Ga0070663_100046580
589 Ga0070663_100075636
590 Ga0070678_100004257
591 Ga0070678_100026242
592 Ga0070678_100053222
593 Ga0070678_100080176
594 Ga0070678_100191278
595 Ga0070662_100003680
596 Ga0070662_100051438
597 Ga0070681_10065472
598 Ga0068867_100000790
599 Ga0068867_100001505
600 Ga0068867_100048546
601 Ga0068867_100061021
602 Ga0070706_100005275
603 Ga0070707_100016301
604 Ga0070679_100036242
605 Ga0070684_100043726
606 Ga0068853_100023812
607 Ga0068853_100107354
608 Ga0070672_100005230
609 Ga0070672_100013351
610 Ga0070672_100018310
611 Ga0070672_100072588
612 Ga0070695_100136846
613 Ga0070693_100039465
614 Ga0070665_100028628
615 Ga0070665_100099839
616 Ga0070665_100255654
617 Ga0070664_100000267
618 Ga0070664_100025846
619 Ga0068857_100009741
620 Ga0068857_100015810
621 Ga0068857_100096776
622 Ga0068854_100008232
623 Ga0068854_100060485
624 Ga0068854_100086561
625 Ga0068856_100037445
626 Ga0068856_100047332
627 Ga0068852_100015611
628 Ga0068852_100032179
629 Ga0068864_100001169
630 Ga0068864_100018861
631 Ga0068864_100028539
632 Ga0068864_100036915
633 Ga0068851_10004895
634 Ga0068870_10088587
635 Ga0068863_100003087
636 Ga0068858_100001403
637 Ga0068860_100010683
638 Ga0068860_100017927
639 Ga0068860_100100037
640 Ga0068862_100236157
641 Ga0075363_100001312
642 Ga0075364_10071683
643 Ga0070716_100058552
644 Ga0075362_10001775
645 Ga0075367_10004973
646 Ga0075366_10002196
647 Ga0075366_10003537
648 Ga0075366_10015046
649 Ga0075366_10034864
650 Ga0075366_10065619
651 Ga0097621_100031891
652 Ga0075370_10000544
653 Ga0075370_10001735
654 Ga0075370_10002192
655 Ga0075370_10004146
656 Ga0075370_10004604
657 Ga0075370_10008319
658 Ga0068871_100006389
659 Ga0068871_100015057
660 Ga0068871_100023376
661 Ga0068871_100046989
662 Ga0075430_100022549
663 Ga0075429_100001909
664 Ga0068865_100041519
665 Ga0068865_100144474
666 Ga0079104_1000013
667 Ga0105240_10042958
668 Ga0105243_10105836
669 Ga0105248_10023381
670 Ga0105248_10059995
671 Ga0105237_10000441
672 Ga0105249_10079525
673 Ga0105239_10000417
674 Ga0105239_10061949
675 Ga0157373_10044056
676 Ga0157371_10084941
677 Ga0157371_10086880
678 Ga0157370_10215048
679 Ga0157369_10016240
680 Ga0157369_10281376
681 Ga0157374_10030550
682 Ga0157374_10252998
683 Ga0157378_10076710
684 Ga0157378_10304473
685 Ga0163162_10092316
686 Ga0163162_10125563
687 Ga0157372_10012500
688 Ga0157372_10015768
689 Ga0157375_10020984
690 Ga0157375_10092557
691 Ga0157375_10119325
692 Ga0157375_10218821
693 Ga0157375_10400307
694 Ga0163163_10004471
695 Ga0157380_10025010
696 Ga0157380_10081888
697 Ga0157377_10000091
698 Ga0157377_10011248
699 Ga0157379_10025520
700 Ga0157379_10037635
701 Ga0157376_10034126
702 Ga0163161_10013653
703 Ga0163161_10028838
704 Ga0163161_10178971
705 Ga0207425_1000333
706 Ga0209129_1000027
707 Ga0209675_1007396
708 Ga0209564_1000014
709 Ga0209758_1000193
710 Ga0209758_1000208
711 Ga0209050_1000142
712 Ga0209050_1000198
713 Ga0209050_1006967
714 Ga0209256_1000130
715 Ga0209256_1012809
716 Ga0209051_1000035
717 Ga0209257_1000346
718 Ga0207697_10004245
719 Ga0207697_10022878
720 Ga0207656_10007396
721 Ga0207656_10015902
722 Ga0207682_10005976
723 Ga0207682_10023234
724 Ga0207682_10024932
725 Ga0207682_10040945
726 Ga0207682_10043516
727 Ga0207688_10051915
728 Ga0207680_10002275
729 Ga0207680_10035991
730 Ga0207645_10011311
731 Ga0207645_10015942
732 Ga0207645_10048629
733 Ga0207645_10100415
734 Ga0207645_10106162
735 Ga0207684_10002424
736 Ga0207707_10028520
737 Ga0207695_10015223
738 Ga0207695_10070632
739 Ga0207671_10002786
740 Ga0207660_10038330
741 Ga0207657_10040431
742 Ga0207657_10067246
743 Ga0207657_10190493
744 Ga0207649_10004236
745 Ga0207649_10014866
746 Ga0207652_10010623
747 Ga0207646_10038390
748 Ga0207681_10003527
749 Ga0207681_10005845
750 Ga0207681_10024798
751 Ga0207681_10072811
752 Ga0207681_10076583
753 Ga0207694_10142580
754 Ga0207650_10001495
755 Ga0207650_10002422
756 Ga0207650_10002662
757 Ga0207650_10013864
758 Ga0207659_10000197
759 Ga0207659_10000491
760 Ga0207659_10096067
761 Ga0207644_10003393
762 Ga0207644_10003455
763 Ga0207644_10026560
764 Ga0207644_10044039
765 Ga0207644_10112187
766 Ga0207644_10123039
767 Ga0207690_10002989
768 Ga0207690_10041816
769 Ga0207706_10000544
770 Ga0207706_10000993
771 Ga0207706_10001576
772 Ga0207706_10106786
773 Ga0207686_10026833
774 Ga0207709_10023421
775 Ga0207709_10026271
776 Ga0207709_10065359
777 Ga0207669_10002886
778 Ga0207669_10022293
779 Ga0207691_10004989
780 Ga0207691_10009144
781 Ga0207691_10015065
782 Ga0207691_10111566
783 Ga0207711_10016610
784 Ga0207711_10047246
785 Ga0207711_10050423
786 Ga0207711_10061461
787 Ga0207711_10068625
788 Ga0207711_10132857
789 Ga0207689_10000855
790 Ga0207689_10003648
791 Ga0207689_10018163
792 Ga0207689_10050362
793 Ga0207661_10042231
794 Ga0207661_10092185
795 Ga0207679_10000486
796 Ga0207679_10174845
797 Ga0207667_10166048
798 Ga0207651_10032121
799 Ga0207712_10014153
800 Ga0207668_10056346
801 Ga0207640_10008411
802 Ga0207640_10024472
803 Ga0207658_10000584
804 Ga0207658_10003965
805 Ga0207658_10005437
806 Ga0207658_10030903
807 Ga0207658_10033108
808 Ga0207658_10094852
809 Ga0207677_10000523
810 Ga0207677_10012873
811 Ga0207677_10071933
812 Ga0207703_10000325
813 Ga0207703_10111500
814 Ga0207639_10006545
815 Ga0207639_10045710
816 Ga0207678_10003625
817 Ga0207678_10017597
818 Ga0207678_10155292
819 Ga0207702_10026873
820 Ga0207641_10001571
821 Ga0207641_10129171
822 Ga0207641_10202534
823 Ga0207648_10001338
824 Ga0207648_10002162
825 Ga0207648_10041343
826 Ga0207648_10044536
827 Ga0207648_10074488
828 Ga0207676_10000490
829 Ga0207676_10004059
830 Ga0207676_10007412
831 Ga0207676_10014315
832 Ga0207676_10020395
833 Ga0207674_10021787
834 Ga0207674_10033221
835 Ga0207675_100000911
836 Ga0207675_100118816
837 Ga0207683_10008423
838 Ga0207683_10060515
839 Ga0207683_10103260
840 Ga0207683_10309977
841 Ga0207698_10009024
842 Ga0207698_10035985
843 Ga0207698_10060582
844 Ga0207698_10115067
845 Ga0207698_10178880
846 Ga0209281_1000076
847 Ga0209995_1004239
848 Ga0209966_1000250
849 Ga0268266_10004766
850 Ga0268266_10076620
851 Ga0268266_10313906
852 Ga0268265_10103371
853 Ga0268264_10043201
854 Ga0268264_10097161
855 Ga0307517_10000358
856 Ga0307515_10000232
857 Ga0307515_10012249
858 Ga0307515_10046000
859 Ga0307515_10097254
860 Ga0307512_10058446
861 Ga0265328_10012280
862 Ga0265327_10000341
863 Ga0265316_10000770
864 Ga0307513_10042456
865 Ga0307513_10090390
866 Ga0307513_10109616
867 Ga0307509_10007751
868 Ga0307509_10010057
869 Ga0307509_10198674
870 Ga0307408_100047721
871 Ga0307408_100077938
872 Ga0307408_100197137
873 Ga0307508_10001328
874 Ga0307508_10007433
875 Ga0307508_10046851
876 Ga0307514_10001289
877 Ga0307514_10006184
878 Ga0307516_10000705
879 Ga0307516_10009234
880 Ga0307516_10061610
881 Ga0307516_10090480
882 Ga0307405_10026545
883 Ga0307410_10002589
884 Ga0307407_10004834
885 Ga0307412_10040965
886 Ga0307412_10089832
887 Ga0307412_10180564
888 Ga0307409_100002804
889 Ga0307409_100117620
890 Ga0307416_100001904
891 Ga0307416_100021844
892 Ga0307416_100027530
893 Ga0307414_10061772
894 Ga0307414_10205700
895 Ga0307411_10006762
896 Ga0307411_10031968
897 Ga0307411_10207945
898 Ga0307415_100020097
899 Ga0307510_10010166
900 Ga0307510_10021392
901 Ga0373938_0009821
902 Ga0373932_0020399
903 Ga0373960_0005337
904 Ga0373931_0010779
905 Ga0373931_0015069
906 Ga0373935_0106237
907 Ga0373937_0011428
908 Ga0373937_0025052
909 Ga0373937_0035619
910 Ga0395900_0000025
911 Ga0395898_0001478
912 Ga0395905_0000460
913 Ga0395905_0008848
914 Ga0395905_0068259
915 Ga0395905_0232625
916 Ga0436365_1344679
917 Ga0451793_1360215
918 Ga0451795_0308091
919 Ga0451798_0692568
920 Ga0451800_0446976
921 Ga0451804_0374343
922 Ga0451807_2227266
923 Ga0451853_2629430
924 Ga0451853_2923840
925 Ga0450919_000201
926 Ga0450898_008760
927 Ga0439434_0011310
928 Ga0439434_0017057
929 Ga0450918_000044
930 Ga0466969_0000097
931 Ga0466969_0009150
932 Ga0466972_0000265
933 Ga0466972_0013816
934 Ga0466965_0044621
935 Ga0466966_0008359
936 Ga0466966_0020415
937 Ga0466966_0028421
938 Ga0466961_0001117
939 Ga0466963_0006046
940 Ga0466964_0001370
941 Ga0453684_0008576
942 Ga0453684_0309156
943 Ga0466970_0010330
944 Ga0466957_0071376
945 Ga0466959_0001732
946 Ga0466959_0031045
947 Ga0466959_0047691
948 Ga0451576_0130356
949 Ga0495592_0000264
950 Ga0495629_0131782
951 Ga0495638_0035697
952 Ga0495606_0169108
953 Ga0495610_0017698
954 Ga0495620_0055612
955 Ga0495632_0003863
956 Ga0495632_0017435
957 Ga0495648_0099407
958 Ga0495652_0146929
959 Ga0495597_0012405
960 Ga0495645_0047774
961 Ga0495645_0065858
962 Ga0495625_0001732
963 Ga0495625_0006616
964 Ga0495635_0053076
965 Ga0495647_0025011
966 Ga0495624_0102143
967 Ga0495649_0031360
968 Ga0495687_000212
969 Ga0495687_004511
970 Ga0495593_0014916
971 Ga0496101_0057784
972 Ga0496102_0082646
973 Ga0496104_0050709
974 Ga0496104_0079074
975 Ga0496106_0016544
976 Ga0496106_0052181
977 Ga0496108_0042620
978 Ga0496108_0075360
979 Ga0496108_0348377
980 Ga0496109_0038516
981 Ga0496109_0056683
982 Ga0496109_0323278
983 Ga0496110_0028330
984 Ga0496110_0103797
985 Ga0496111_0062338
986 Ga0496111_0277389
987 Ga0496112_0008219
988 Ga0496113_0002254
989 Ga0496114_0022122
990 Ga0496114_0042884
991 Ga0496115_0026926
992 Ga0496121_0008117
993 Ga0496124_0000344
994 Ga0496124_0037045
995 Ga0496125_0015785
996 Ga0501043_0000004
997 Ga0501046_0000016
998 Ga0501047_0000012
999 Ga0501048_0000091
1000 Ga0501198_000028
1001 Ga0501222_000024
1002 Ga0501265_006696
1003 Ga0501045_0004631
1004 nmdc:mga03683_43810_c1
1005 nmdc:mga03n38_38675_c1
1006 nmdc:mga00v17_64387_c1
1007 nmdc:mga0k408_10704_c1
1008 nmdc:mga0k408_11352_c1
1009 nmdc:mga0k408_1421_c1
1010 nmdc:mga0k408_24058_c1
1011 nmdc:mga0k408_3190_c1
1012 nmdc:mga0k408_58259_c1
1013 nmdc:mga0k408_8385_c1
1014 nmdc:mga0k408_920_c1
1015 nmdc:mga06z11_5994_c1
1016 nmdc:mga07m45_17267_c1
1017 nmdc:mga07m45_2013_c1
1018 nmdc:mga07m45_2402_c1
1019 nmdc:mga07m45_3003_c1
1020 nmdc:mga07m45_9661_c1
1021 nmdc:mga09592_7517_c1
1022 nmdc:mga0qj67_17913_c1
1023 nmdc:mga08y16_307697_c1
1024 Ga0500578_0000006
1025 Ga0500578_0019216
1026 Ga0500644_0018480
1027 Ga0500583_0050067
1028 Ga0500651_0017238
1029 Ga0500562_014359
1030 Ga0500593_000146
1031 Ga0500623_027963
1032 Ga0500628_008175
1033 Ga0500642_0021124
1034 Ga0500652_000158
1035 Ga0500652_034854
1036 Ga0500658_0003740
1037 Ga0500559_0000092
1038 Ga0500568_0002391
1039 Ga0500568_0009756
1040 Ga0500619_000010
1041 Ga0500622_0000851
1042 Ga0500622_0037214
1043 Ga0500636_0108994
1044 Ga0500587_001096
1045 Ga0466962_0009609
1046 Ga0466962_0021304
1047 2587725102
1048 2587731538
1049 2587756226
1050 2588295185
1051 2643967008
1052 2644142623
1053 2644243747
1054 2644273702
1055 2644301805
1056 2644338738

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08668

HDOD

HDOD domain

232

360

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pwk-assembly1.cif.gz_A vibrio cholerae lapd s helix-ggdef-eal (bound to c-di-gmp) 0.6834 3 182
3gg1-assembly1.cif.gz_A klebsiella pneumoniae blrp1 ph 8.0 calcium/cy-digmp complex 0.6742 9 182
6hq4-assembly1.cif.gz_A structure of eal enzyme bd1971 - camp bound form 0.6694 9 183
6hq7-assembly1.cif.gz_A structure of eal enzyme bd1971 - cgmp bound form 0.6671 9 183
8arv-assembly1.cif.gz_B structure of the eal domain of bifa from pseudomonas aeruginosa 0.6638 3 183
ID Description Score Start End Superfamily
af_P23842_476_729_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.6679 5 183 3.20.20.450
4q37E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.6619 78 133 3.40.50.280
af_P13518_396_644_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.6611 5 182 3.20.20.450
4hu4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.6583 9 184 3.20.20.450
af_P77334_408_660_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.657 9 183 3.20.20.450
ID Description Score Start End GO Terms
AF-S6B3S6-F1-model_v4 Diguanylate phosphodiesterase 0.9448 201 401
AF-A0A2N2SE73-F1-model_v4 Regulator 0.9438 288 398
AF-A0A5C7Q336-F1-model_v4 HDOD domain-containing protein 0.9388 3 402
AF-A0A5C7Q336-F1-model_v4 HDOD domain-containing protein 0.9321 3 402
AF-A0A4Q3NFQ9-F1-model_v4 deleted 0.9288 201 401

Map