F459724

General Info

Members Datasets Scaffolds Average Seq Length
528 307 1056 155

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0106625|Ga0496102_0106625_543_1067
Length 174
Sequence MRAIVQSPALCTEVNLMSGHDYHAGIRWERAGAVFTDNRYSRGHSWHFDGGVVVPASSSPHTVRVPLSVEAAVDPEEALVAALASCHMLWFLSLAAGARWCVDDYGDDAVGSMGRNAAGKIAMLSVTLRPRVRFCGERVPGREEILQLHERAHEECFIANSVTTTVHIEPVFDA

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
188 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
216 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
219 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
298 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
302 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
303 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
304 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
305 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
306 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
307 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0.38
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 0
Rhizoplane 7.39
Rhizosphere 85.8
Stem 0
Stem Tuber 0.57
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0106625 3300048905 Bacteria 2608
2 MBSR1b_contig_6351538 2162886012 Unclassified 1114
3 JGI26129J50193_1001905 3300003349 Unclassified 1451
4 Ga0006562J51391_1054345 3300003578 Bacteria 5760
5 Ga0006562J51391_1054347 3300003578 Bacteria 9000
6 JGI25404J52841_10025162 3300003659 Bacteria 1282
7 Ga0055536_1025293 3300003781 Bacteria 1695
8 Ga0055530_10000280 3300003791 Bacteria 46300
9 Ga0055531_10000272 3300003794 Bacteria 53837
10 JGI25405J52794_10018288 3300003911 Bacteria 1398
11 Ga0065715_10766435 3300005293 Unclassified 592
12 Ga0070676_10350093 3300005328 Bacteria 1015
13 Ga0070683_100032711 3300005329 Bacteria 4738
14 Ga0070690_100011991 3300005330 Bacteria 5086
15 Ga0070690_100380155 3300005330 Bacteria 1032
16 Ga0070690_101588097 3300005330 Bacteria 530
17 Ga0070670_100120173 3300005331 Bacteria 2266
18 Ga0068869_100468805 3300005334 Bacteria 1047
19 Ga0070680_100002362 3300005336 Bacteria 13942
20 Ga0070680_100235256 3300005336 Bacteria 1547
21 Ga0070680_100396896 3300005336 Unclassified 1175
22 Ga0068868_100014188 3300005338 Bacteria 5867
23 Ga0070689_100000011 3300005340 Bacteria 218327
24 Ga0070689_100107570 3300005340 Bacteria 2214
25 Ga0070689_100200873 3300005340 Bacteria 1628
26 Ga0070689_101416228 3300005340 Bacteria 628
27 Ga0070691_10005070 3300005341 Bacteria 5986
28 Ga0070691_10006759 3300005341 Bacteria 5249
29 Ga0070691_10112410 3300005341 Bacteria 1364
30 Ga0070687_100059099 3300005343 Bacteria 2017
31 Ga0070692_10157318 3300005345 Bacteria 1299
32 Ga0070668_100648964 3300005347 Bacteria 927
33 Ga0070669_100388621 3300005353 Bacteria 1139
34 Ga0070675_100199744 3300005354 Bacteria 1735
35 Ga0070675_100338777 3300005354 Bacteria 1332
36 Ga0070671_100111835 3300005355 Bacteria 2294
37 Ga0070674_100402103 3300005356 Bacteria 1119
38 Ga0070673_100032086 3300005364 Bacteria 3950
39 Ga0070688_101320073 3300005365 Bacteria 583
40 Ga0070667_100083577 3300005367 Bacteria 2735
41 Ga0070703_10000733 3300005406 Bacteria 10968
42 Ga0070703_10014361 3300005406 Bacteria 2256
43 Ga0070709_10009350 3300005434 Bacteria 5404
44 Ga0070709_10021319 3300005434 Bacteria 3772
45 Ga0070714_100117083 3300005435 Bacteria 2366
46 Ga0070713_100017059 3300005436 Bacteria 5479
47 Ga0070713_100091569 3300005436 Bacteria 2616
48 Ga0070710_10030501 3300005437 Bacteria 2901
49 Ga0070701_10032368 3300005438 Bacteria 2603
50 Ga0070701_10470786 3300005438 Bacteria 810
51 Ga0070711_100009992 3300005439 Bacteria 5855
52 Ga0070711_100120916 3300005439 Bacteria 1937
53 Ga0070705_100000284 3300005440 Bacteria 30207
54 Ga0070700_100033576 3300005441 Bacteria 3091
55 Ga0070700_100048885 3300005441 Bacteria 2623
56 Ga0070700_100301653 3300005441 Bacteria 1169
57 Ga0070694_100036925 3300005444 Bacteria 3238
58 Ga0070694_100092843 3300005444 Bacteria 2121
59 Ga0070694_100484218 3300005444 Bacteria 982
60 Ga0070708_100018075 3300005445 Bacteria 5897
61 Ga0070708_100051172 3300005445 Bacteria 3659
62 Ga0070663_100005804 3300005455 Bacteria 7374
63 Ga0070663_100992992 3300005455 Unclassified 729
64 Ga0070678_100517354 3300005456 Bacteria 1055
65 Ga0070681_10063222 3300005458 Bacteria 3674
66 Ga0068867_100181206 3300005459 Bacteria 1675
67 Ga0070706_100296292 3300005467 Bacteria 1509
68 Ga0070706_100793944 3300005467 Bacteria 876
69 Ga0070707_100370675 3300005468 Bacteria 1391
70 Ga0070707_100548255 3300005468 Bacteria 1118
71 Ga0070698_100086413 3300005471 Bacteria 3122
72 Ga0070698_100149590 3300005471 Bacteria 2283
73 Ga0070699_100000768 3300005518 Bacteria 29617
74 Ga0070679_100482240 3300005530 Bacteria 1184
75 Ga0070697_100047248 3300005536 Bacteria 3491
76 Ga0068853_100177179 3300005539 Bacteria 1932
77 Ga0070695_100001812 3300005545 Bacteria 12065
78 Ga0070695_100010490 3300005545 Bacteria 5532
79 Ga0070695_100217039 3300005545 Bacteria 1376
80 Ga0070695_100366258 3300005545 Bacteria 1084
81 Ga0070696_100000069 3300005546 Bacteria 49879
82 Ga0070696_100709605 3300005546 Bacteria 821
83 Ga0070693_100005191 3300005547 Bacteria 6231
84 Ga0070693_100472286 3300005547 Bacteria 884
85 Ga0070665_100054884 3300005548 Bacteria 3995
86 Ga0070665_100875280 3300005548 Bacteria 911
87 Ga0070704_100000106 3300005549 Bacteria 29134
88 Ga0070704_100013495 3300005549 Bacteria 5070
89 Ga0070704_100082585 3300005549 Bacteria 2369
90 Ga0070704_100266865 3300005549 Bacteria 1412
91 Ga0070704_101046474 3300005549 Bacteria 740
92 Ga0068855_100000841 3300005563 Bacteria 38036
93 Ga0068855_101004420 3300005563 Bacteria 876
94 Ga0068857_100089742 3300005577 Bacteria 2750
95 Ga0068854_100516717 3300005578 Bacteria 1008
96 Ga0068856_100007946 3300005614 Bacteria 10358
97 Ga0068856_100564914 3300005614 Bacteria 1159
98 Ga0070702_100045769 3300005615 Bacteria 2477
99 Ga0070702_101242140 3300005615 Bacteria 602
100 Ga0068859_100006391 3300005617 Bacteria 11957
101 Ga0068859_100166573 3300005617 Bacteria 2284
102 Ga0068864_101080053 3300005618 Bacteria 798
103 Ga0068866_10006416 3300005718 Bacteria 4899
104 Ga0068861_100031033 3300005719 Bacteria 3921
105 Ga0068861_100056703 3300005719 Bacteria 2991
106 Ga0068861_100150729 3300005719 Bacteria 1908
107 Ga0068861_100495113 3300005719 Bacteria 1104
108 Ga0068851_10646043 3300005834 Bacteria 647
109 Ga0068863_100037461 3300005841 Bacteria 4618
110 Ga0068863_100787484 3300005841 Bacteria 948
111 Ga0068858_100006896 3300005842 Bacteria 11045
112 Ga0068858_100871162 3300005842 Unclassified 880
113 Ga0068860_100027650 3300005843 Bacteria 5461
114 Ga0068860_100121452 3300005843 Bacteria 2502
115 Ga0068862_100007239 3300005844 Bacteria 9213
116 Ga0068862_100055700 3300005844 Bacteria 3387
117 Ga0081455_10000073 3300005937 Bacteria 107386
118 Ga0081455_10249840 3300005937 Bacteria 1298
119 Ga0081455_10329614 3300005937 Bacteria 1084
120 Ga0081540_1000012 3300005983 Bacteria 189939
121 Ga0070717_10165908 3300006028 Bacteria 1918
122 Ga0070717_10773786 3300006028 Bacteria 873
123 Ga0070715_10003085 3300006163 Bacteria 5225
124 Ga0070716_100002028 3300006173 Bacteria 9253
125 Ga0070716_100018496 3300006173 Bacteria 3632
126 Ga0070716_100086486 3300006173 Bacteria 1886
127 Ga0070712_100131203 3300006175 Bacteria 1899
128 Ga0097621_100150981 3300006237 Bacteria 1992
129 Ga0075370_10105462 3300006353 Bacteria 1634
130 Ga0068871_100033343 3300006358 Bacteria 4077
131 Ga0075428_100025030 3300006844 Bacteria 6603
132 Ga0075428_100032484 3300006844 Bacteria 5765
133 Ga0075428_100034965 3300006844 Bacteria 5539
134 Ga0075430_100096586 3300006846 Bacteria 2469
135 Ga0075433_10002093 3300006852 Bacteria 15108
136 Ga0075433_10187301 3300006852 Bacteria 1841
137 Ga0075434_100010143 3300006871 Bacteria 8824
138 Ga0075429_100045458 3300006880 Bacteria 3820
139 Ga0075429_100074337 3300006880 Unclassified 2960
140 Ga0075429_100100565 3300006880 Bacteria 2524
141 Ga0068865_100002839 3300006881 Bacteria 10317
142 Ga0068865_100184968 3300006881 Bacteria 1607
143 Ga0075436_100399717 3300006914 Bacteria 995
144 Ga0075436_100862035 3300006914 Bacteria 676
145 Ga0097620_100006391 3300006931 Bacteria 11957
146 Ga0097620_100166582 3300006931 Bacteria 2284
147 Ga0075435_100067092 3300007076 Bacteria 2921
148 Ga0075435_101124345 3300007076 Bacteria 687
149 Ga0099795_10044358 3300007788 Bacteria 1594
150 Ga0105240_10002990 3300009093 Bacteria 26593
151 Ga0105240_10035330 3300009093 Bacteria 6442
152 Ga0105240_10148984 3300009093 Bacteria 2789
153 Ga0111539_10002283 3300009094 Bacteria 25507
154 Ga0111539_10034157 3300009094 Bacteria 6171
155 Ga0111539_10045732 3300009094 Bacteria 5239
156 Ga0111539_10116944 3300009094 Bacteria 3126
157 Ga0111539_10533926 3300009094 Unclassified 1367
158 Ga0111539_11501496 3300009094 Bacteria 781
159 Ga0105245_10180079 3300009098 Bacteria 2019
160 Ga0105245_11055753 3300009098 Unclassified 858
161 Ga0114129_10043906 3300009147 Bacteria 6289
162 Ga0114129_10294858 3300009147 Bacteria 2163
163 Ga0114129_10344904 3300009147 Bacteria 1974
164 Ga0105243_10348467 3300009148 Bacteria 1359
165 Ga0105241_10015195 3300009174 Bacteria 5638
166 Ga0105241_10550368 3300009174 Bacteria 1036
167 Ga0105242_10003054 3300009176 Bacteria 13084
168 Ga0105242_11217696 3300009176 Bacteria 773
169 Ga0105248_10068030 3300009177 Bacteria 3999
170 Ga0105248_10427077 3300009177 Bacteria 1492
171 Ga0105248_11691988 3300009177 Unclassified 717
172 Ga0105237_10015924 3300009545 Bacteria 7818
173 Ga0105237_10058478 3300009545 Bacteria 3858
174 Ga0105237_10192883 3300009545 Bacteria 2037
175 Ga0105237_10594966 3300009545 Bacteria 1113
176 Ga0105238_11047208 3300009551 Bacteria 838
177 Ga0105238_11107305 3300009551 Bacteria 815
178 Ga0105249_10006176 3300009553 Bacteria 10393
179 Ga0105249_11507958 3300009553 Unclassified 745
180 Ga0105239_10017734 3300010375 Bacteria 7877
181 Ga0105246_10082098 3300011119 Bacteria 2300
182 Ga0157371_10005714 3300013102 Bacteria 10429
183 Ga0157370_10025208 3300013104 Bacteria 5887
184 Ga0157370_10393895 3300013104 Bacteria 1275
185 Ga0157369_10028764 3300013105 Bacteria 6147
186 Ga0157369_11026174 3300013105 Bacteria 844
187 Ga0157374_10013397 3300013296 Bacteria 7159
188 Ga0157374_10165413 3300013296 Unclassified 2155
189 Ga0157374_11156383 3300013296 Unclassified 795
190 Ga0157378_10010285 3300013297 Bacteria 8169
191 Ga0157378_10063482 3300013297 Bacteria 3300
192 Ga0163162_10223584 3300013306 Bacteria 2012
193 Ga0163162_10585067 3300013306 Bacteria 1243
194 Ga0163162_10857573 3300013306 Bacteria 1023
195 Ga0157372_10148341 3300013307 Bacteria 2705
196 Ga0157372_10569764 3300013307 Bacteria 1320
197 Ga0157375_10010032 3300013308 Bacteria 8326
198 Ga0157375_10930122 3300013308 Bacteria 1012
199 Ga0163163_10022026 3300014325 Bacteria 6025
200 Ga0163163_10940511 3300014325 Bacteria 928
201 Ga0157380_10000142 3300014326 Bacteria 40538
202 Ga0157380_10003693 3300014326 Bacteria 10530
203 Ga0157380_10130561 3300014326 Bacteria 2142
204 Ga0157380_11278847 3300014326 Bacteria 780
205 Ga0157379_10021504 3300014968 Bacteria 5710
206 Ga0157376_11592602 3300014969 Unclassified 687
207 Ga0213872_10271585 3300021361 Bacteria 710
208 Ga0213874_10045308 3300021377 Bacteria 1331
209 Ga0213876_10399662 3300021384 Bacteria 731
210 Ga0209676_1003926 3300025292 Bacteria 8618
211 Ga0209676_1005157 3300025292 Bacteria 6948
212 Ga0209050_1000017 3300025298 Bacteria 728928
213 Ga0209257_1000104 3300025304 Bacteria 245648
214 Ga0207653_10001256 3300025885 Bacteria 8267
215 Ga0207692_10638421 3300025898 Bacteria 687
216 Ga0207642_10016203 3300025899 Bacteria 2801
217 Ga0207685_10004502 3300025905 Bacteria 3554
218 Ga0207685_10087978 3300025905 Bacteria 1301
219 Ga0207685_10241103 3300025905 Bacteria 870
220 Ga0207699_10004243 3300025906 Bacteria 6860
221 Ga0207699_10010634 3300025906 Bacteria 4627
222 Ga0207645_10737792 3300025907 Unclassified 670
223 Ga0207643_10472168 3300025908 Bacteria 800
224 Ga0207684_10164992 3300025910 Bacteria 1908
225 Ga0207654_10207002 3300025911 Bacteria 1295
226 Ga0207707_10035970 3300025912 Bacteria 4330
227 Ga0207695_10000337 3300025913 Bacteria 110325
228 Ga0207695_10008085 3300025913 Bacteria 13232
229 Ga0207695_10293343 3300025913 Bacteria 1518
230 Ga0207671_10010144 3300025914 Bacteria 7805
231 Ga0207671_10154662 3300025914 Bacteria 1773
232 Ga0207693_10000021 3300025915 Bacteria 128800
233 Ga0207693_10034274 3300025915 Bacteria 4005
234 Ga0207693_10258163 3300025915 Bacteria 1366
235 Ga0207663_10120603 3300025916 Bacteria 1795
236 Ga0207663_10942570 3300025916 Bacteria 691
237 Ga0207660_10012476 3300025917 Bacteria 5561
238 Ga0207660_10184384 3300025917 Bacteria 1622
239 Ga0207662_10111162 3300025918 Bacteria 1708
240 Ga0207652_10421141 3300025921 Bacteria 1204
241 Ga0207646_10123114 3300025922 Bacteria 2331
242 Ga0207646_10199377 3300025922 Bacteria 1808
243 Ga0207659_10293970 3300025926 Bacteria 1332
244 Ga0207687_10889820 3300025927 Bacteria 762
245 Ga0207700_10003126 3300025928 Bacteria 9560
246 Ga0207700_10176409 3300025928 Bacteria 1786
247 Ga0207700_10414223 3300025928 Bacteria 1183
248 Ga0207664_10118208 3300025929 Bacteria 2214
249 Ga0207706_10790118 3300025933 Bacteria 807
250 Ga0207686_10017032 3300025934 Bacteria 4086
251 Ga0207709_10150875 3300025935 Bacteria 1609
252 Ga0207670_10000005 3300025936 Bacteria 431451
253 Ga0207669_11957301 3300025937 Bacteria 501
254 Ga0207704_10070409 3300025938 Bacteria 2214
255 Ga0207704_10242607 3300025938 Bacteria 1347
256 Ga0207704_10421037 3300025938 Bacteria 1059
257 Ga0207665_10003946 3300025939 Bacteria 9930
258 Ga0207665_10007972 3300025939 Bacteria 6992
259 Ga0207665_10018176 3300025939 Bacteria 4620
260 Ga0207665_10455296 3300025939 Bacteria 983
261 Ga0207691_10910085 3300025940 Unclassified 736
262 Ga0207711_10080886 3300025941 Bacteria 2838
263 Ga0207689_10043467 3300025942 Bacteria 3714
264 Ga0207689_10088670 3300025942 Bacteria 2541
265 Ga0207689_10647758 3300025942 Unclassified 890
266 Ga0207667_10000839 3300025949 Bacteria 39670
267 Ga0207667_10157339 3300025949 Bacteria 2338
268 Ga0207712_10006325 3300025961 Bacteria 7469
269 Ga0207668_11420122 3300025972 Bacteria 626
270 Ga0207640_10613645 3300025981 Bacteria 922
271 Ga0207658_10206398 3300025986 Bacteria 1644
272 Ga0207677_10024915 3300026023 Bacteria 3725
273 Ga0207677_11523605 3300026023 Unclassified 618
274 Ga0207678_10009050 3300026067 Bacteria 8768
275 Ga0207678_10595335 3300026067 Unclassified 969
276 Ga0207708_10013400 3300026075 Bacteria 6127
277 Ga0207708_10044894 3300026075 Bacteria 3368
278 Ga0207708_10079688 3300026075 Bacteria 2516
279 Ga0207648_10226245 3300026089 Bacteria 1663
280 Ga0207676_10113299 3300026095 Bacteria 2273
281 Ga0207676_10425742 3300026095 Bacteria 1246
282 Ga0207674_10002834 3300026116 Bacteria 21561
283 Ga0207674_10030437 3300026116 Bacteria 5674
284 Ga0207675_100098480 3300026118 Bacteria 2754
285 Ga0207675_100222858 3300026118 Bacteria 1817
286 Ga0207675_100418937 3300026118 Bacteria 1322
287 Ga0209966_1028173 3300027695 Unclassified 1127
288 Ga0209974_10154688 3300027876 Bacteria 829
289 Ga0209974_10304664 3300027876 Bacteria 610
290 Ga0207428_10013153 3300027907 Bacteria 7245
291 Ga0207428_10026428 3300027907 Bacteria 4845
292 Ga0207428_10083959 3300027907 Unclassified 2483
293 Ga0268266_10813537 3300028379 Bacteria 903
294 Ga0268265_10507479 3300028380 Bacteria 1137
295 Ga0268264_10041465 3300028381 Bacteria 3808
296 Ga0268264_10053778 3300028381 Bacteria 3360
297 Ga0268264_10239157 3300028381 Bacteria 1681
298 Ga0265330_10089703 3300031235 Bacteria 1320
299 Ga0265330_10107961 3300031235 Bacteria 1190
300 Ga0265325_10025264 3300031241 Bacteria 3226
301 Ga0265325_10046926 3300031241 Bacteria 2238
302 Ga0265340_10006325 3300031247 Bacteria 6528
303 Ga0265327_10096175 3300031251 Bacteria 1436
304 Ga0307408_100218508 3300031548 Bacteria 1554
305 Ga0307408_100278591 3300031548 Bacteria 1392
306 Ga0307408_100610925 3300031548 Bacteria 970
307 Ga0307408_100784699 3300031548 Bacteria 863
308 Ga0307405_10001231 3300031731 Bacteria 10649
309 Ga0307405_10106559 3300031731 Unclassified 1891
310 Ga0307413_10451884 3300031824 Bacteria 1020
311 Ga0307410_10001551 3300031852 Bacteria 10471
312 Ga0307410_10064168 3300031852 Bacteria 2523
313 Ga0307410_10490010 3300031852 Bacteria 1010
314 Ga0307406_10110187 3300031901 Bacteria 1894
315 Ga0307406_10343599 3300031901 Bacteria 1163
316 Ga0307407_10001320 3300031903 Bacteria 8869
317 Ga0307407_10881685 3300031903 Unclassified 685
318 Ga0307407_10950548 3300031903 Bacteria 662
319 Ga0307412_10031627 3300031911 Bacteria 3344
320 Ga0307412_10221343 3300031911 Unclassified 1451
321 Ga0307412_10858719 3300031911 Bacteria 792
322 Ga0307409_100003494 3300031995 Bacteria 8552
323 Ga0307416_100004185 3300032002 Bacteria 8649
324 Ga0307416_100216071 3300032002 Bacteria 1834
325 Ga0307416_100609050 3300032002 Bacteria 1173
326 Ga0307414_10009925 3300032004 Bacteria 5493
327 Ga0307414_10018722 3300032004 Bacteria 4272
328 Ga0307414_10074417 3300032004 Bacteria 2461
329 Ga0307414_10402507 3300032004 Bacteria 1189
330 Ga0307414_11349426 3300032004 Bacteria 662
331 Ga0307411_10081123 3300032005 Bacteria 2233
332 Ga0307411_10245484 3300032005 Unclassified 1404
333 Ga0307411_10653185 3300032005 Bacteria 911
334 Ga0307415_100001394 3300032126 Bacteria 11528
335 Ga0307507_10036380 3300033179 Bacteria 5033
336 Ga0373950_0012372 3300034818 Bacteria 1408
337 Ga0373959_0012862 3300034820 Bacteria 1501
338 Ga0373959_0146225 3300034820 Bacteria 595
339 Ga0373938_0005277 3300034957 Bacteria 2194
340 Ga0373929_0009989 3300035085 Bacteria 1767
341 Ga0373940_0005921 3300035088 Bacteria 2681
342 Ga0373951_0028523 3300035091 Bacteria 1308
343 Ga0373952_0010720 3300035092 Bacteria 1776
344 Ga0373936_0128619 3300035113 Bacteria 1087
345 Ga0373939_0001557 3300035114 Bacteria 5572
346 Ga0373939_0036720 3300035114 Bacteria 1451
347 Ga0373941_0005359 3300035115 Bacteria 3013
348 Ga0373941_0014186 3300035115 Bacteria 2123
349 Ga0373941_0015541 3300035115 Bacteria 2055
350 Ga0373956_0348245 3300035119 Bacteria 706
351 Ga0373960_0032156 3300035121 Bacteria 1472
352 Ga0373943_0074331 3300035170 Bacteria 1728
353 Ga0373955_0089635 3300035172 Bacteria 1751
354 Ga0373942_0020729 3300035207 Bacteria 1653
355 Ga0373961_0200694 3300035241 Unclassified 703
356 Ga0373962_0016607 3300035242 Bacteria 1900
357 Ga0373962_0039955 3300035242 Bacteria 1318
358 Ga0373931_0001216 3300035691 Bacteria 11014
359 Ga0373931_0002067 3300035691 Bacteria 8832
360 Ga0373931_0006105 3300035691 Bacteria 5614
361 Ga0373935_0660690 3300035692 Bacteria 767
362 Ga0373927_0030590 3300035695 Bacteria 3512
363 Ga0373927_0045041 3300035695 Bacteria 2854
364 Ga0373933_0081009 3300035724 Bacteria 1991
365 Ga0373937_0240389 3300036401 Bacteria 1706
366 Ga0373937_1417663 3300036401 Bacteria 642
367 Ga0373937_1425481 3300036401 Unclassified 640
368 Ga0436365_0494227 3300039437 Bacteria 518
369 Ga0436365_1036200 3300039437 Bacteria 929
370 Ga0436360_1062673 3300039438 Bacteria 4036
371 Ga0436361_0176955 3300039447 Bacteria 812
372 Ga0436361_0333953 3300039447 Bacteria 2161
373 Ga0436361_0739818 3300039447 Bacteria 919
374 Ga0436363_0403659 3300039450 Bacteria 1023
375 Ga0436363_0802390 3300039450 Bacteria 3272
376 Ga0439461_0029971 3300041410 Bacteria 1129
377 Ga0451791_1874268 3300041451 Bacteria 581
378 Ga0451797_1101137 3300041453 Bacteria 725
379 Ga0451807_0883340 3300041486 Bacteria 569
380 Ga0451837_0505302 3300041494 Bacteria 683
381 Ga0439431_0074536 3300041997 Bacteria 908
382 Ga0439434_0154205 3300042435 Bacteria 761
383 Ga0451577_0012825 3300042876 Bacteria 7867
384 Ga0466972_0048368 3300044658 Bacteria 2055
385 Ga0466972_0165246 3300044658 Bacteria 1039
386 Ga0466957_0007291 3300044842 Bacteria 6249
387 Ga0495638_0174870 3300046460 Bacteria 1229
388 Ga0495653_0554111 3300046463 Unclassified 711
389 Ga0495580_0009170 3300046472 Bacteria 7800
390 Ga0495580_0022039 3300046472 Bacteria 4694
391 Ga0495580_0175013 3300046472 Bacteria 1483
392 Ga0495582_0006568 3300046473 Bacteria 6454
393 Ga0495662_0213897 3300046476 Bacteria 950
394 Ga0495584_0136507 3300046491 Bacteria 1245
395 Ga0495630_0071504 3300046517 Bacteria 2611
396 Ga0495656_0216134 3300046615 Bacteria 957
397 Ga0495659_0148464 3300046664 Bacteria 940
398 Ga0495647_0197783 3300046681 Bacteria 881
399 Ga0495649_0004033 3300046694 Bacteria 9668
400 Ga0495581_0369673 3300047315 Bacteria 837
401 Ga0495602_0215192 3300048088 Bacteria 1455
402 Ga0496100_0506089 3300048903 Unclassified 931
403 Ga0496101_0011397 3300048904 Bacteria 5898
404 Ga0496101_0086578 3300048904 Bacteria 2324
405 Ga0496101_0735837 3300048904 Unclassified 778
406 Ga0496102_0014004 3300048905 Bacteria 6964
407 Ga0496102_0620374 3300048905 Bacteria 1004
408 Ga0496103_0424819 3300048906 Bacteria 853
409 Ga0496104_0018714 3300048907 Bacteria 6321
410 Ga0496104_0032194 3300048907 Bacteria 4880
411 Ga0496104_0059634 3300048907 Bacteria 3613
412 Ga0496104_0178089 3300048907 Bacteria 2036
413 Ga0496104_0284878 3300048907 Bacteria 1565
414 Ga0496105_0024718 3300048908 Bacteria 4883
415 Ga0496105_0349177 3300048908 Bacteria 1182
416 Ga0496105_0793399 3300048908 Bacteria 720
417 Ga0496105_0799478 3300048908 Unclassified 717
418 Ga0496106_0001137 3300048909 Bacteria 19705
419 Ga0496106_0123669 3300048909 Bacteria 2024
420 Ga0496106_0243973 3300048909 Bacteria 1435
421 Ga0496107_0018741 3300048910 Bacteria 4877
422 Ga0496107_0077559 3300048910 Bacteria 2420
423 Ga0496107_0159965 3300048910 Bacteria 1669
424 Ga0496107_0408659 3300048910 Bacteria 1009
425 Ga0496108_0002792 3300048911 Bacteria 13997
426 Ga0496108_0586159 3300048911 Bacteria 972
427 Ga0496109_0105411 3300048912 Bacteria 2618
428 Ga0496110_0005157 3300048913 Bacteria 10214
429 Ga0496111_0026019 3300048914 Bacteria 4129
430 Ga0496112_0071456 3300048915 Bacteria 3430
431 Ga0496112_0197717 3300048915 Bacteria 1971
432 Ga0496113_1069157 3300048916 Bacteria 634
433 Ga0496114_0002917 3300048917 Bacteria 13111
434 Ga0496115_0300110 3300048918 Bacteria 1316
435 Ga0496115_0493534 3300048918 Bacteria 985
436 Ga0496115_0786594 3300048918 Bacteria 741
437 Ga0496116_0028102 3300048919 Bacteria 4081
438 Ga0496120_0101350 3300048923 Bacteria 1520
439 Ga0496122_0002203 3300048925 Bacteria 28462
440 Ga0496123_0001896 3300048926 Bacteria 27281
441 Ga0496125_0000334 3300048928 Bacteria 90058
442 Ga0501031_0007671 3300049568 Bacteria 7022
443 Ga0501031_0762173 3300049568 Bacteria 621
444 Ga0501032_0018113 3300049569 Unclassified 4938
445 Ga0501034_0354991 3300049571 Bacteria 1394
446 Ga0501036_0169692 3300049572 Unclassified 1838
447 Ga0501037_0058527 3300049573 Unclassified 2812
448 Ga0501037_0656436 3300049573 Bacteria 701
449 Ga0501038_0012702 3300049574 Bacteria 7697
450 Ga0501039_0011370 3300049575 Bacteria 6777
451 Ga0501039_0111877 3300049575 Bacteria 2135
452 Ga0501039_1050420 3300049575 Bacteria 632
453 Ga0501040_0085206 3300049576 Unclassified 2193
454 Ga0501040_0391215 3300049576 Bacteria 998
455 Ga0501041_0000980 3300049577 Bacteria 15584
456 Ga0501041_0416631 3300049577 Unclassified 852
457 Ga0501042_0003599 3300049578 Bacteria 9772
458 Ga0501042_0220561 3300049578 Bacteria 1368
459 Ga0501042_0373089 3300049578 Bacteria 1033
460 Ga0501046_0012783 3300049580 Bacteria 7141
461 Ga0501046_0298183 3300049580 Bacteria 1178
462 Ga0501048_0017654 3300049582 Bacteria 5252
463 Ga0501067_0004605 3300049583 Bacteria 7634
464 Ga0501067_0366250 3300049583 Unclassified 803
465 Ga0501068_0773284 3300049584 Unclassified 629
466 Ga0501069_0074469 3300049585 Unclassified 1905
467 Ga0501071_0164598 3300049587 Bacteria 1659
468 Ga0501072_0006568 3300049588 Bacteria 8855
469 Ga0501072_0109473 3300049588 Bacteria 2199
470 Ga0501073_1271411 3300049589 Unclassified 505
471 Ga0501074_0161174 3300049590 Unclassified 1602
472 Ga0501075_0246793 3300049591 Bacteria 1361
473 Ga0501075_0650702 3300049591 Bacteria 803
474 Ga0501075_0665850 3300049591 Bacteria 793
475 Ga0501076_0019941 3300049592 Bacteria 5130
476 Ga0501077_0008045 3300049593 Bacteria 6517
477 Ga0501077_0127496 3300049593 Bacteria 1613
478 Ga0501077_0241410 3300049593 Bacteria 1148
479 Ga0501077_0703136 3300049593 Bacteria 650
480 Ga0501079_0022509 3300049741 Bacteria 4833
481 Ga0501079_0212515 3300049741 Bacteria 1511
482 Ga0501079_0911597 3300049741 Bacteria 692
483 Ga0501081_0042469 3300049743 Unclassified 3116
484 Ga0501081_0137691 3300049743 Bacteria 1748
485 Ga0501081_1258667 3300049743 Unclassified 561
486 Ga0501035_0004444 3300049822 Bacteria 13307
487 Ga0501044_0220148 3300049823 Bacteria 1849
488 Ga0501044_0379164 3300049823 Bacteria 1329
489 Ga0501044_1024764 3300049823 Unclassified 696
490 Ga0501044_1505839 3300049823 Bacteria 538
491 Ga0501045_0153272 3300049824 Bacteria 1715
492 Ga0501045_0233249 3300049824 Bacteria 1370
493 nmdc:mga07m45_770616_c1 3300050496 Bacteria 552
494 nmdc:mga05p37_194392_c1 3300050507 Bacteria 2461
495 nmdc:mga05p37_37700_c1 3300050507 Bacteria 5928
496 nmdc:mga09592_191170_c1 3300050508 Bacteria 1772
497 nmdc:mga0qj67_172172_c1 3300050509 Bacteria 1758
498 nmdc:mga06r32_460025_c1 3300050510 Bacteria 1251
499 nmdc:mga08y16_1023985_c1 3300050511 Bacteria 805
500 nmdc:mga08y16_134749_c1 3300050511 Bacteria 2567
501 nmdc:mga08y16_144400_c1 3300050511 Bacteria 2474
502 nmdc:mga08y16_33758_c1 3300050511 Bacteria 5374
503 nmdc:mga08y16_497361_c1 3300050511 Bacteria 1239
504 nmdc:mga08y16_702339_c1 3300050511 Unclassified 1011
505 nmdc:mga08y16_971242_c1 3300050511 Bacteria 831
506 nmdc:mga0n895_20730_c1 3300050512 Bacteria 6136
507 nmdc:mga0rr50_11164_c1 3300050513 Bacteria 5731
508 nmdc:mga08x19_793967_c1 3300050514 Bacteria 672
509 nmdc:mga0a205_4542_c1 3300050515 Bacteria 12457
510 Ga0495612_0358425 3300053078 Bacteria 659
511 Ga0500562_080202 3300053108 Bacteria 883
512 Ga0500595_013733 3300053119 Bacteria 3097
513 Ga0500652_087326 3300053131 Bacteria 1301
514 Ga0500573_0040362 3300053140 Bacteria 2696
515 Ga0500573_0073385 3300053140 Bacteria 1950
516 Ga0500573_0079463 3300053140 Bacteria 1865
517 Ga0500645_008548 3300053730 Bacteria 3489
518 Ga0500645_034886 3300053730 Bacteria 1501
519 Ga0501082_0000593 3300060353 Bacteria 31985
520 Ga0501082_0222094 3300060353 Bacteria 1644
521 Ga0501082_0236133 3300060353 Bacteria 1591
522 Ga0530510_0014053 3300061734 Bacteria 5645
523 2855198932 2855195626 Bacteria 4927512
524 2871274366 2871272651 Bacteria 5042015
525 2900052506 2900051742 Bacteria 4985156
526 2928974587 2928972540 Bacteria 3058286
527 2941487971 2941485952 Bacteria 3591484
528 2977243510 2977240413 Bacteria 3191065
529 Ga0496102_0106625
530 MBSR1b_contig_6351538
531 JGI26129J50193_1001905
532 Ga0006562J51391_1054345
533 Ga0006562J51391_1054347
534 JGI25404J52841_10025162
535 Ga0055536_1025293
536 Ga0055530_10000280
537 Ga0055531_10000272
538 JGI25405J52794_10018288
539 Ga0065715_10766435
540 Ga0070676_10350093
541 Ga0070683_100032711
542 Ga0070690_100011991
543 Ga0070690_100380155
544 Ga0070690_101588097
545 Ga0070670_100120173
546 Ga0068869_100468805
547 Ga0070680_100002362
548 Ga0070680_100235256
549 Ga0070680_100396896
550 Ga0068868_100014188
551 Ga0070689_100000011
552 Ga0070689_100107570
553 Ga0070689_100200873
554 Ga0070689_101416228
555 Ga0070691_10005070
556 Ga0070691_10006759
557 Ga0070691_10112410
558 Ga0070687_100059099
559 Ga0070692_10157318
560 Ga0070668_100648964
561 Ga0070669_100388621
562 Ga0070675_100199744
563 Ga0070675_100338777
564 Ga0070671_100111835
565 Ga0070674_100402103
566 Ga0070673_100032086
567 Ga0070688_101320073
568 Ga0070667_100083577
569 Ga0070703_10000733
570 Ga0070703_10014361
571 Ga0070709_10009350
572 Ga0070709_10021319
573 Ga0070714_100117083
574 Ga0070713_100017059
575 Ga0070713_100091569
576 Ga0070710_10030501
577 Ga0070701_10032368
578 Ga0070701_10470786
579 Ga0070711_100009992
580 Ga0070711_100120916
581 Ga0070705_100000284
582 Ga0070700_100033576
583 Ga0070700_100048885
584 Ga0070700_100301653
585 Ga0070694_100036925
586 Ga0070694_100092843
587 Ga0070694_100484218
588 Ga0070708_100018075
589 Ga0070708_100051172
590 Ga0070663_100005804
591 Ga0070663_100992992
592 Ga0070678_100517354
593 Ga0070681_10063222
594 Ga0068867_100181206
595 Ga0070706_100296292
596 Ga0070706_100793944
597 Ga0070707_100370675
598 Ga0070707_100548255
599 Ga0070698_100086413
600 Ga0070698_100149590
601 Ga0070699_100000768
602 Ga0070679_100482240
603 Ga0070697_100047248
604 Ga0068853_100177179
605 Ga0070695_100001812
606 Ga0070695_100010490
607 Ga0070695_100217039
608 Ga0070695_100366258
609 Ga0070696_100000069
610 Ga0070696_100709605
611 Ga0070693_100005191
612 Ga0070693_100472286
613 Ga0070665_100054884
614 Ga0070665_100875280
615 Ga0070704_100000106
616 Ga0070704_100013495
617 Ga0070704_100082585
618 Ga0070704_100266865
619 Ga0070704_101046474
620 Ga0068855_100000841
621 Ga0068855_101004420
622 Ga0068857_100089742
623 Ga0068854_100516717
624 Ga0068856_100007946
625 Ga0068856_100564914
626 Ga0070702_100045769
627 Ga0070702_101242140
628 Ga0068859_100006391
629 Ga0068859_100166573
630 Ga0068864_101080053
631 Ga0068866_10006416
632 Ga0068861_100031033
633 Ga0068861_100056703
634 Ga0068861_100150729
635 Ga0068861_100495113
636 Ga0068851_10646043
637 Ga0068863_100037461
638 Ga0068863_100787484
639 Ga0068858_100006896
640 Ga0068858_100871162
641 Ga0068860_100027650
642 Ga0068860_100121452
643 Ga0068862_100007239
644 Ga0068862_100055700
645 Ga0081455_10000073
646 Ga0081455_10249840
647 Ga0081455_10329614
648 Ga0081540_1000012
649 Ga0070717_10165908
650 Ga0070717_10773786
651 Ga0070715_10003085
652 Ga0070716_100002028
653 Ga0070716_100018496
654 Ga0070716_100086486
655 Ga0070712_100131203
656 Ga0097621_100150981
657 Ga0075370_10105462
658 Ga0068871_100033343
659 Ga0075428_100025030
660 Ga0075428_100032484
661 Ga0075428_100034965
662 Ga0075430_100096586
663 Ga0075433_10002093
664 Ga0075433_10187301
665 Ga0075434_100010143
666 Ga0075429_100045458
667 Ga0075429_100074337
668 Ga0075429_100100565
669 Ga0068865_100002839
670 Ga0068865_100184968
671 Ga0075436_100399717
672 Ga0075436_100862035
673 Ga0097620_100006391
674 Ga0097620_100166582
675 Ga0075435_100067092
676 Ga0075435_101124345
677 Ga0099795_10044358
678 Ga0105240_10002990
679 Ga0105240_10035330
680 Ga0105240_10148984
681 Ga0111539_10002283
682 Ga0111539_10034157
683 Ga0111539_10045732
684 Ga0111539_10116944
685 Ga0111539_10533926
686 Ga0111539_11501496
687 Ga0105245_10180079
688 Ga0105245_11055753
689 Ga0114129_10043906
690 Ga0114129_10294858
691 Ga0114129_10344904
692 Ga0105243_10348467
693 Ga0105241_10015195
694 Ga0105241_10550368
695 Ga0105242_10003054
696 Ga0105242_11217696
697 Ga0105248_10068030
698 Ga0105248_10427077
699 Ga0105248_11691988
700 Ga0105237_10015924
701 Ga0105237_10058478
702 Ga0105237_10192883
703 Ga0105237_10594966
704 Ga0105238_11047208
705 Ga0105238_11107305
706 Ga0105249_10006176
707 Ga0105249_11507958
708 Ga0105239_10017734
709 Ga0105246_10082098
710 Ga0157371_10005714
711 Ga0157370_10025208
712 Ga0157370_10393895
713 Ga0157369_10028764
714 Ga0157369_11026174
715 Ga0157374_10013397
716 Ga0157374_10165413
717 Ga0157374_11156383
718 Ga0157378_10010285
719 Ga0157378_10063482
720 Ga0163162_10223584
721 Ga0163162_10585067
722 Ga0163162_10857573
723 Ga0157372_10148341
724 Ga0157372_10569764
725 Ga0157375_10010032
726 Ga0157375_10930122
727 Ga0163163_10022026
728 Ga0163163_10940511
729 Ga0157380_10000142
730 Ga0157380_10003693
731 Ga0157380_10130561
732 Ga0157380_11278847
733 Ga0157379_10021504
734 Ga0157376_11592602
735 Ga0213872_10271585
736 Ga0213874_10045308
737 Ga0213876_10399662
738 Ga0209676_1003926
739 Ga0209676_1005157
740 Ga0209050_1000017
741 Ga0209257_1000104
742 Ga0207653_10001256
743 Ga0207692_10638421
744 Ga0207642_10016203
745 Ga0207685_10004502
746 Ga0207685_10087978
747 Ga0207685_10241103
748 Ga0207699_10004243
749 Ga0207699_10010634
750 Ga0207645_10737792
751 Ga0207643_10472168
752 Ga0207684_10164992
753 Ga0207654_10207002
754 Ga0207707_10035970
755 Ga0207695_10000337
756 Ga0207695_10008085
757 Ga0207695_10293343
758 Ga0207671_10010144
759 Ga0207671_10154662
760 Ga0207693_10000021
761 Ga0207693_10034274
762 Ga0207693_10258163
763 Ga0207663_10120603
764 Ga0207663_10942570
765 Ga0207660_10012476
766 Ga0207660_10184384
767 Ga0207662_10111162
768 Ga0207652_10421141
769 Ga0207646_10123114
770 Ga0207646_10199377
771 Ga0207659_10293970
772 Ga0207687_10889820
773 Ga0207700_10003126
774 Ga0207700_10176409
775 Ga0207700_10414223
776 Ga0207664_10118208
777 Ga0207706_10790118
778 Ga0207686_10017032
779 Ga0207709_10150875
780 Ga0207670_10000005
781 Ga0207669_11957301
782 Ga0207704_10070409
783 Ga0207704_10242607
784 Ga0207704_10421037
785 Ga0207665_10003946
786 Ga0207665_10007972
787 Ga0207665_10018176
788 Ga0207665_10455296
789 Ga0207691_10910085
790 Ga0207711_10080886
791 Ga0207689_10043467
792 Ga0207689_10088670
793 Ga0207689_10647758
794 Ga0207667_10000839
795 Ga0207667_10157339
796 Ga0207712_10006325
797 Ga0207668_11420122
798 Ga0207640_10613645
799 Ga0207658_10206398
800 Ga0207677_10024915
801 Ga0207677_11523605
802 Ga0207678_10009050
803 Ga0207678_10595335
804 Ga0207708_10013400
805 Ga0207708_10044894
806 Ga0207708_10079688
807 Ga0207648_10226245
808 Ga0207676_10113299
809 Ga0207676_10425742
810 Ga0207674_10002834
811 Ga0207674_10030437
812 Ga0207675_100098480
813 Ga0207675_100222858
814 Ga0207675_100418937
815 Ga0209966_1028173
816 Ga0209974_10154688
817 Ga0209974_10304664
818 Ga0207428_10013153
819 Ga0207428_10026428
820 Ga0207428_10083959
821 Ga0268266_10813537
822 Ga0268265_10507479
823 Ga0268264_10041465
824 Ga0268264_10053778
825 Ga0268264_10239157
826 Ga0265330_10089703
827 Ga0265330_10107961
828 Ga0265325_10025264
829 Ga0265325_10046926
830 Ga0265340_10006325
831 Ga0265327_10096175
832 Ga0307408_100218508
833 Ga0307408_100278591
834 Ga0307408_100610925
835 Ga0307408_100784699
836 Ga0307405_10001231
837 Ga0307405_10106559
838 Ga0307413_10451884
839 Ga0307410_10001551
840 Ga0307410_10064168
841 Ga0307410_10490010
842 Ga0307406_10110187
843 Ga0307406_10343599
844 Ga0307407_10001320
845 Ga0307407_10881685
846 Ga0307407_10950548
847 Ga0307412_10031627
848 Ga0307412_10221343
849 Ga0307412_10858719
850 Ga0307409_100003494
851 Ga0307416_100004185
852 Ga0307416_100216071
853 Ga0307416_100609050
854 Ga0307414_10009925
855 Ga0307414_10018722
856 Ga0307414_10074417
857 Ga0307414_10402507
858 Ga0307414_11349426
859 Ga0307411_10081123
860 Ga0307411_10245484
861 Ga0307411_10653185
862 Ga0307415_100001394
863 Ga0307507_10036380
864 Ga0373950_0012372
865 Ga0373959_0012862
866 Ga0373959_0146225
867 Ga0373938_0005277
868 Ga0373929_0009989
869 Ga0373940_0005921
870 Ga0373951_0028523
871 Ga0373952_0010720
872 Ga0373936_0128619
873 Ga0373939_0001557
874 Ga0373939_0036720
875 Ga0373941_0005359
876 Ga0373941_0014186
877 Ga0373941_0015541
878 Ga0373956_0348245
879 Ga0373960_0032156
880 Ga0373943_0074331
881 Ga0373955_0089635
882 Ga0373942_0020729
883 Ga0373961_0200694
884 Ga0373962_0016607
885 Ga0373962_0039955
886 Ga0373931_0001216
887 Ga0373931_0002067
888 Ga0373931_0006105
889 Ga0373935_0660690
890 Ga0373927_0030590
891 Ga0373927_0045041
892 Ga0373933_0081009
893 Ga0373937_0240389
894 Ga0373937_1417663
895 Ga0373937_1425481
896 Ga0436365_0494227
897 Ga0436365_1036200
898 Ga0436360_1062673
899 Ga0436361_0176955
900 Ga0436361_0333953
901 Ga0436361_0739818
902 Ga0436363_0403659
903 Ga0436363_0802390
904 Ga0439461_0029971
905 Ga0451791_1874268
906 Ga0451797_1101137
907 Ga0451807_0883340
908 Ga0451837_0505302
909 Ga0439431_0074536
910 Ga0439434_0154205
911 Ga0451577_0012825
912 Ga0466972_0048368
913 Ga0466972_0165246
914 Ga0466957_0007291
915 Ga0495638_0174870
916 Ga0495653_0554111
917 Ga0495580_0009170
918 Ga0495580_0022039
919 Ga0495580_0175013
920 Ga0495582_0006568
921 Ga0495662_0213897
922 Ga0495584_0136507
923 Ga0495630_0071504
924 Ga0495656_0216134
925 Ga0495659_0148464
926 Ga0495647_0197783
927 Ga0495649_0004033
928 Ga0495581_0369673
929 Ga0495602_0215192
930 Ga0496100_0506089
931 Ga0496101_0011397
932 Ga0496101_0086578
933 Ga0496101_0735837
934 Ga0496102_0014004
935 Ga0496102_0620374
936 Ga0496103_0424819
937 Ga0496104_0018714
938 Ga0496104_0032194
939 Ga0496104_0059634
940 Ga0496104_0178089
941 Ga0496104_0284878
942 Ga0496105_0024718
943 Ga0496105_0349177
944 Ga0496105_0793399
945 Ga0496105_0799478
946 Ga0496106_0001137
947 Ga0496106_0123669
948 Ga0496106_0243973
949 Ga0496107_0018741
950 Ga0496107_0077559
951 Ga0496107_0159965
952 Ga0496107_0408659
953 Ga0496108_0002792
954 Ga0496108_0586159
955 Ga0496109_0105411
956 Ga0496110_0005157
957 Ga0496111_0026019
958 Ga0496112_0071456
959 Ga0496112_0197717
960 Ga0496113_1069157
961 Ga0496114_0002917
962 Ga0496115_0300110
963 Ga0496115_0493534
964 Ga0496115_0786594
965 Ga0496116_0028102
966 Ga0496120_0101350
967 Ga0496122_0002203
968 Ga0496123_0001896
969 Ga0496125_0000334
970 Ga0501031_0007671
971 Ga0501031_0762173
972 Ga0501032_0018113
973 Ga0501034_0354991
974 Ga0501036_0169692
975 Ga0501037_0058527
976 Ga0501037_0656436
977 Ga0501038_0012702
978 Ga0501039_0011370
979 Ga0501039_0111877
980 Ga0501039_1050420
981 Ga0501040_0085206
982 Ga0501040_0391215
983 Ga0501041_0000980
984 Ga0501041_0416631
985 Ga0501042_0003599
986 Ga0501042_0220561
987 Ga0501042_0373089
988 Ga0501046_0012783
989 Ga0501046_0298183
990 Ga0501048_0017654
991 Ga0501067_0004605
992 Ga0501067_0366250
993 Ga0501068_0773284
994 Ga0501069_0074469
995 Ga0501071_0164598
996 Ga0501072_0006568
997 Ga0501072_0109473
998 Ga0501073_1271411
999 Ga0501074_0161174
1000 Ga0501075_0246793
1001 Ga0501075_0650702
1002 Ga0501075_0665850
1003 Ga0501076_0019941
1004 Ga0501077_0008045
1005 Ga0501077_0127496
1006 Ga0501077_0241410
1007 Ga0501077_0703136
1008 Ga0501079_0022509
1009 Ga0501079_0212515
1010 Ga0501079_0911597
1011 Ga0501081_0042469
1012 Ga0501081_0137691
1013 Ga0501081_1258667
1014 Ga0501035_0004444
1015 Ga0501044_0220148
1016 Ga0501044_0379164
1017 Ga0501044_1024764
1018 Ga0501044_1505839
1019 Ga0501045_0153272
1020 Ga0501045_0233249
1021 nmdc:mga07m45_770616_c1
1022 nmdc:mga05p37_194392_c1
1023 nmdc:mga05p37_37700_c1
1024 nmdc:mga09592_191170_c1
1025 nmdc:mga0qj67_172172_c1
1026 nmdc:mga06r32_460025_c1
1027 nmdc:mga08y16_1023985_c1
1028 nmdc:mga08y16_134749_c1
1029 nmdc:mga08y16_144400_c1
1030 nmdc:mga08y16_33758_c1
1031 nmdc:mga08y16_497361_c1
1032 nmdc:mga08y16_702339_c1
1033 nmdc:mga08y16_971242_c1
1034 nmdc:mga0n895_20730_c1
1035 nmdc:mga0rr50_11164_c1
1036 nmdc:mga08x19_793967_c1
1037 nmdc:mga0a205_4542_c1
1038 Ga0495612_0358425
1039 Ga0500562_080202
1040 Ga0500595_013733
1041 Ga0500652_087326
1042 Ga0500573_0040362
1043 Ga0500573_0073385
1044 Ga0500573_0079463
1045 Ga0500645_008548
1046 Ga0500645_034886
1047 Ga0501082_0000593
1048 Ga0501082_0222094
1049 Ga0501082_0236133
1050 Ga0530510_0014053
1051 2855198932
1052 2871274366
1053 2900052506
1054 2928974587
1055 2941487971
1056 2977243510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

68

171

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9708 2 122
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9478 2 122
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9023 23 122
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9014 23 121
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.8985 23 122
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.948 2 122 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9257 2 122 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9039 23 122 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8888 20 121 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8714 20 123 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A0J1GHH4-F1-model_v4 Peroxiredoxin 0.9926 22 123
AF-A0A534GYJ0-F1-model_v4 OsmC family peroxiredoxin 0.9904 24 123
AF-A0A850STB2-F1-model_v4 OsmC family protein 0.9875 24 120
AF-A0A3C0PGU9-F1-model_v4 Osmotically inducible protein OsmC 0.9874 6 123
AF-A0A1F2TUU2-F1-model_v4 OsmC family protein 0.9864 39 122

Map