F459729

General Info

Members Datasets Scaffolds Average Seq Length
528 392 1056 397

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0043424|Ga0496126_0043424_2524_3942
Length 472
Sequence MRKDKSRTALSVKIGHTGMVIALLNFDPSCEWKDAISFQHWPSRRPLVTMQRSMKHKAGEPVDPSRQRDPSGRTAMQESVNRPAQSRAIPFDTAKLDRLMEQAGIDLLIATSKHNVQYLLDAERAIFFDYMDALGVSRYLPVFIYPKGAPEKAGYVGNPLEAHQRFIVPLWVSEVQNKSMGSVDAITRAVEIIKKSGAPAKRIGVEKAFLPMDAAEALAGALPGSEIKDALFVLERLRAVKSPAELAKLKKASELVTDSMLEVIARHGPGTTKRELFEALRIAEVQRGLTFEYCLLACGDSHNRAPSPQRWEQGDVLNLDSGGNYHGYIGDLARMAVLGEPDSELKDLLAEIEAVQQAAFAAVRAGAMGGDIYAAAEKRLAQTSQRDVSEFLAHGMGVVSHEAPRLTTTGPVPYDDYDAHRPLEAGMVVSIETTMKHPKRGFIKLEDTVAVTPDGYEIYGKNGRGWNIGGTA

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
56 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
129 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
259 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
260 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
261 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
262 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
263 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
264 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
265 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
266 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
267 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
268 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
269 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
270 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
271 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
272 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
273 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
274 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
275 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
276 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
277 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
278 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
279 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
280 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
281 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
282 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
283 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
284 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
285 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
286 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
287 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
288 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
289 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
290 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
291 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
292 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
293 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
294 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
295 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
296 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
297 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
298 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
299 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
300 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
301 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
302 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
303 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
304 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
305 2904699407
306 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
307 2906610324
308 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
309 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
310 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
311 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
312 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
313 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
314 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
315 2922425934
316 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
317 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
318 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
319 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
320 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
321 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
322 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
323 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
324 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
325 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
326 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
327 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
328 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
329 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
330 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
331 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
332 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
333 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
334 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
335 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
336 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
337 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
338 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
339 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
340 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
341 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
342 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
343 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
344 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
345 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
346 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
347 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
348 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
349 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
350 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
351 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
352 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
353 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
354 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
355 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
356 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
357 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
358 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
359 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
360 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
361 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
362 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
363 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
364 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
365 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
366 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
367 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
368 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
369 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
370 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
371 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
372 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
373 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
374 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
375 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
376 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
377 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
378 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
379 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
380 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
381 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
382 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
383 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
384 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
385 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
386 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
387 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
388 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
389 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
390 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
391 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
392 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.76
Metatranscriptomes 1.71
Isolates 25.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 22.73
Rhizoplane 5.68
Rhizosphere 63.26
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0043424 3300048929 Bacteria 4147
2 Ga0070658_10012234 3300005327 Bacteria 6890
3 Ga0070683_100039525 3300005329 Bacteria 4331
4 Ga0070690_100087627 3300005330 Bacteria 2045
5 Ga0068869_100195019 3300005334 Bacteria 1594
6 Ga0068869_100213573 3300005334 Bacteria 1526
7 Ga0070666_10055254 3300005335 Bacteria 2680
8 Ga0070666_10125990 3300005335 Bacteria 1778
9 Ga0070680_100017498 3300005336 Bacteria 5652
10 Ga0070682_100048365 3300005337 Bacteria 2647
11 Ga0070682_100099257 3300005337 Bacteria 1919
12 Ga0070689_100020981 3300005340 Bacteria 4856
13 Ga0070687_100030450 3300005343 Bacteria 2638
14 Ga0070669_100006702 3300005353 Bacteria 8291
15 Ga0070669_100044328 3300005353 Bacteria 3241
16 Ga0070675_100202316 3300005354 Bacteria 1724
17 Ga0070673_100024556 3300005364 Bacteria 4422
18 Ga0070659_100085449 3300005366 Bacteria 2523
19 Ga0070709_10158736 3300005434 Bacteria 1570
20 Ga0070713_100023676 3300005436 Bacteria 4771
21 Ga0070713_100031008 3300005436 Bacteria 4252
22 Ga0070710_10003665 3300005437 Bacteria 7264
23 Ga0070710_10027276 3300005437 Bacteria 3044
24 Ga0070701_10032677 3300005438 Bacteria 2594
25 Ga0070705_100136660 3300005440 Bacteria 1607
26 Ga0070705_100161868 3300005440 Bacteria 1497
27 Ga0070662_100031178 3300005457 Bacteria 3739
28 Ga0070681_10014253 3300005458 Bacteria 7912
29 Ga0070681_10036786 3300005458 Bacteria 4915
30 Ga0070681_10046339 3300005458 Bacteria 4346
31 Ga0070685_10089816 3300005466 Bacteria 1858
32 Ga0070707_100070426 3300005468 Bacteria 3368
33 Ga0070698_100007079 3300005471 Bacteria 12149
34 Ga0070699_100019737 3300005518 Archaea 5810
35 Ga0070679_100011783 3300005530 Bacteria 8337
36 Ga0070679_100023003 3300005530 Bacteria 6096
37 Ga0070679_100048988 3300005530 Bacteria 4208
38 Ga0070684_100006096 3300005535 Bacteria 9286
39 Ga0070697_100093939 3300005536 Bacteria 2484
40 Ga0070672_100049971 3300005543 Bacteria 3256
41 Ga0068855_100065829 3300005563 Bacteria 4225
42 Ga0068857_100248670 3300005577 Bacteria 1630
43 Ga0068854_100141981 3300005578 Bacteria 1844
44 Ga0068854_100216123 3300005578 Bacteria 1514
45 Ga0068858_100056320 3300005842 Bacteria 3634
46 Ga0068862_100096724 3300005844 Bacteria 2577
47 Ga0081455_10001860 3300005937 Bacteria 25395
48 Ga0081455_10009744 3300005937 Bacteria 9841
49 Ga0081455_10031798 3300005937 Bacteria 4767
50 Ga0081538_10044624 3300005981 Bacteria 2762
51 Ga0081540_1003221 3300005983 Bacteria 13007
52 Ga0081540_1009789 3300005983 Bacteria 6562
53 Ga0081539_10070551 3300005985 Bacteria 1875
54 Ga0070717_10029594 3300006028 Bacteria 4394
55 Ga0070717_10056864 3300006028 Bacteria 3233
56 Ga0070717_10060335 3300006028 Bacteria 3141
57 Ga0070717_10146143 3300006028 Unclassified 2042
58 Ga0075365_10011942 3300006038 Bacteria 5131
59 Ga0070715_10007706 3300006163 Bacteria 3719
60 Ga0070716_100155537 3300006173 Bacteria 1476
61 Ga0070712_100001591 3300006175 Bacteria 13875
62 Ga0070712_100108842 3300006175 Bacteria 2064
63 Ga0075367_10087022 3300006178 Bacteria 1897
64 Ga0097621_100019564 3300006237 Bacteria 5199
65 Ga0075370_10115960 3300006353 Bacteria 1557
66 Ga0075428_100000068 3300006844 Bacteria 83416
67 Ga0075428_100182226 3300006844 Bacteria 2273
68 Ga0075430_100000823 3300006846 Bacteria 24231
69 Ga0075430_100017024 3300006846 Bacteria 6191
70 Ga0075430_100063617 3300006846 Bacteria 3099
71 Ga0075431_100000217 3300006847 Bacteria 42647
72 Ga0075431_100063587 3300006847 Bacteria 3808
73 Ga0075433_10162284 3300006852 Bacteria 1989
74 Ga0075433_10254951 3300006852 Bacteria 1556
75 Ga0075434_100084600 3300006871 Bacteria 3171
76 Ga0075434_100123545 3300006871 Bacteria 2605
77 Ga0075434_100137885 3300006871 Bacteria 2459
78 Ga0075434_100146702 3300006871 Bacteria 2380
79 Ga0075429_100002468 3300006880 Bacteria 15555
80 Ga0075429_100017530 3300006880 Bacteria 6193
81 Ga0068865_100003957 3300006881 Bacteria 8888
82 Ga0075436_100014568 3300006914 Bacteria 5387
83 Ga0099824_1002679 3300006942 Bacteria 26119
84 Ga0099822_1000813 3300006943 Bacteria 32810
85 Ga0099795_10012236 3300007788 Bacteria 2595
86 Ga0105240_10045049 3300009093 Bacteria 5599
87 Ga0105240_10113944 3300009093 Bacteria 3267
88 Ga0111539_10025883 3300009094 Bacteria 7182
89 Ga0111539_10062101 3300009094 Bacteria 4424
90 Ga0111539_10111656 3300009094 Bacteria 3207
91 Ga0111539_10200789 3300009094 Bacteria 2325
92 Ga0114129_10000035 3300009147 Bacteria 110735
93 Ga0114129_10032630 3300009147 Bacteria 7358
94 Ga0114129_10064487 3300009147 Bacteria 5113
95 Ga0114129_10120613 3300009147 Bacteria 3610
96 Ga0105242_10093079 3300009176 Bacteria 2540
97 Ga0105237_10061316 3300009545 Bacteria 3761
98 Ga0105237_10070418 3300009545 Bacteria 3494
99 Ga0105237_10177634 3300009545 Bacteria 2129
100 Ga0105238_10095295 3300009551 Bacteria 2963
101 Ga0099796_10001880 3300010159 Bacteria 4433
102 Ga0099796_10023163 3300010159 Bacteria 1936
103 Ga0105239_10116220 3300010375 Bacteria 2968
104 Ga0105239_10118340 3300010375 Bacteria 2940
105 Ga0105239_10473018 3300010375 Bacteria 1423
106 Ga0105246_10020051 3300011119 Bacteria 4285
107 Ga0157370_10019242 3300013104 Bacteria 6857
108 Ga0157369_10005882 3300013105 Bacteria 14252
109 Ga0157372_10038895 3300013307 Bacteria 5250
110 Ga0157372_10277235 3300013307 Bacteria 1949
111 Ga0163163_10027715 3300014325 Bacteria 5431
112 Ga0157380_10067001 3300014326 Bacteria 2889
113 Ga0157379_10072004 3300014968 Bacteria 3092
114 Ga0163161_10082112 3300017792 Bacteria 2374
115 Ga0206356_11678587 3300020070 Bacteria 1748
116 Ga0206349_1677469 3300020075 Bacteria 1495
117 Ga0206355_1094359 3300020076 Bacteria 1433
118 Ga0206352_10593933 3300020078 Bacteria 1342
119 Ga0206350_10491525 3300020080 Bacteria 1694
120 Ga0213872_10040685 3300021361 Bacteria 2122
121 Ga0213871_10007805 3300021441 Bacteria 2331
122 Ga0224712_10021185 3300022467 Bacteria 2220
123 Ga0224712_10049867 3300022467 Bacteria 1624
124 Ga0224712_10070994 3300022467 Bacteria 1414
125 Ga0209233_1002510 3300025261 Bacteria 6708
126 Ga0207692_10008675 3300025898 Bacteria 4218
127 Ga0207692_10009348 3300025898 Bacteria 4090
128 Ga0207642_10091378 3300025899 Bacteria 1504
129 Ga0207710_10033081 3300025900 Bacteria 2267
130 Ga0207688_10031180 3300025901 Bacteria 2942
131 Ga0207699_10030298 3300025906 Bacteria 3026
132 Ga0207699_10099454 3300025906 Bacteria 1842
133 Ga0207699_10165323 3300025906 Bacteria 1476
134 Ga0207645_10023307 3300025907 Bacteria 4024
135 Ga0207643_10000872 3300025908 Bacteria 18178
136 Ga0207684_10059972 3300025910 Bacteria 3231
137 Ga0207654_10055548 3300025911 Bacteria 2293
138 Ga0207707_10000413 3300025912 Bacteria 44774
139 Ga0207707_10012785 3300025912 Bacteria 7303
140 Ga0207707_10020024 3300025912 Bacteria 5837
141 Ga0207707_10045829 3300025912 Bacteria 3809
142 Ga0207695_10019824 3300025913 Bacteria 7730
143 Ga0207695_10160390 3300025913 Bacteria 2181
144 Ga0207671_10109850 3300025914 Bacteria 2097
145 Ga0207671_10183210 3300025914 Bacteria 1630
146 Ga0207693_10084934 3300025915 Bacteria 2480
147 Ga0207693_10127264 3300025915 Bacteria 2002
148 Ga0207663_10038149 3300025916 Bacteria 2901
149 Ga0207663_10069549 3300025916 Bacteria 2265
150 Ga0207660_10048534 3300025917 Bacteria 3005
151 Ga0207662_10007580 3300025918 Bacteria 5912
152 Ga0207657_10030389 3300025919 Bacteria 4904
153 Ga0207649_10077238 3300025920 Bacteria 2145
154 Ga0207652_10011892 3300025921 Bacteria 7021
155 Ga0207652_10119904 3300025921 Bacteria 2339
156 Ga0207681_10298788 3300025923 Bacteria 1273
157 Ga0207650_10002222 3300025925 Bacteria 13558
158 Ga0207659_10129543 3300025926 Bacteria 1945
159 Ga0207700_10007882 3300025928 Bacteria 6551
160 Ga0207700_10214595 3300025928 Bacteria 1628
161 Ga0207664_10008866 3300025929 Bacteria 7038
162 Ga0207706_10006344 3300025933 Bacteria 10985
163 Ga0207704_10215944 3300025938 Bacteria 1415
164 Ga0207665_10006295 3300025939 Bacteria 7873
165 Ga0207691_10007735 3300025940 Bacteria 10345
166 Ga0207711_10115856 3300025941 Bacteria 2388
167 Ga0207689_10044726 3300025942 Bacteria 3661
168 Ga0207661_10006710 3300025944 Bacteria 8142
169 Ga0207661_10034410 3300025944 Bacteria 3940
170 Ga0207679_10052178 3300025945 Bacteria 2998
171 Ga0207667_10051385 3300025949 Bacteria 4346
172 Ga0207651_10185165 3300025960 Bacteria 1656
173 Ga0207712_10080231 3300025961 Bacteria 2373
174 Ga0207640_10049413 3300025981 Bacteria 2723
175 Ga0207677_10042728 3300026023 Bacteria 3007
176 Ga0207678_10005238 3300026067 Bacteria 11614
177 Ga0207708_10060105 3300026075 Bacteria 2901
178 Ga0207641_10038901 3300026088 Bacteria 3977
179 Ga0207648_10026444 3300026089 Bacteria 5156
180 Ga0207674_10058822 3300026116 Bacteria 3892
181 Ga0207683_10141608 3300026121 Bacteria 2167
182 Ga0207698_10207182 3300026142 Bacteria 1761
183 Ga0209589_1000001 3300027357 Bacteria 794224
184 Ga0209489_100001 3300027361 Bacteria 794224
185 Ga0209700_100001 3300027363 Bacteria 794224
186 Ga0207428_10047726 3300027907 Bacteria 3438
187 Ga0265337_1000963 3300028556 Bacteria 15083
188 Ga0265760_10028467 3300031090 Bacteria 1640
189 Ga0265320_10030232 3300031240 Bacteria 2795
190 Ga0265325_10000352 3300031241 Bacteria 32405
191 Ga0265329_10006817 3300031242 Bacteria 4488
192 Ga0265340_10056112 3300031247 Bacteria 1895
193 Ga0265339_10064324 3300031249 Bacteria 1968
194 Ga0265331_10013877 3300031250 Bacteria 4311
195 Ga0265316_10055458 3300031344 Bacteria 3099
196 Ga0265314_10027152 3300031711 Bacteria 4290
197 Ga0315911_1000007 3300033442 Bacteria 413725
198 Ga0373936_0000283 3300035113 Bacteria 17009
199 Ga0373945_0006933 3300035116 Bacteria 3663
200 Ga0373953_0008260 3300035117 Bacteria 3528
201 Ga0373953_0009993 3300035117 Bacteria 3289
202 Ga0373954_0027592 3300035118 Bacteria 2607
203 Ga0373957_0006271 3300035120 Bacteria 3738
204 Ga0373943_0002565 3300035170 Bacteria 8263
205 Ga0373946_0013826 3300035171 Bacteria 3038
206 Ga0373946_0020062 3300035171 Bacteria 2580
207 Ga0373955_0000334 3300035172 Bacteria 19669
208 Ga0373961_0005771 3300035241 Bacteria 2972
209 Ga0373924_0000358 3300035410 Bacteria 14065
210 Ga0373924_0010933 3300035410 Bacteria 3360
211 Ga0373935_0001324 3300035692 Bacteria 13718
212 Ga0373927_0087379 3300035695 Bacteria 2024
213 Ga0373933_0001162 3300035724 Bacteria 15600
214 Ga0373933_0003120 3300035724 Bacteria 9238
215 Ga0373933_0022723 3300035724 Bacteria 3575
216 Ga0373947_0002784 3300035725 Bacteria 10457
217 Ga0373937_0001118 3300036401 Bacteria 22628
218 Ga0373937_0064851 3300036401 Bacteria 3361
219 Ga0373925_0000084 3300037068 Bacteria 100945
220 Ga0373925_0017236 3300037068 Bacteria 5232
221 Ga0373925_0089746 3300037068 Bacteria 2348
222 Ga0395900_0001080 3300037418 Bacteria 34679
223 Ga0395900_0216603 3300037418 Bacteria 1932
224 Ga0436364_0034478 3300037853 Bacteria 3715
225 Ga0436364_1206346 3300037853 Bacteria 6697
226 Ga0395901_0104954 3300038443 Bacteria 2966
227 Ga0436365_0298239 3300039437 Bacteria 2652
228 Ga0436365_0684655 3300039437 Bacteria 2356
229 Ga0436365_0750972 3300039437 Bacteria 2652
230 Ga0436365_0913975 3300039437 Bacteria 3818
231 Ga0436360_0932560 3300039438 Bacteria 3293
232 Ga0436360_1344078 3300039438 Bacteria 2411
233 Ga0436361_0085290 3300039447 Bacteria 7105
234 Ga0436361_0287699 3300039447 Bacteria 5705
235 Ga0436361_0360709 3300039447 Bacteria 8068
236 Ga0436363_0105492 3300039450 Bacteria 1960
237 Ga0436363_0547370 3300039450 Bacteria 2694
238 Ga0466957_0116592 3300044842 Bacteria 1699
239 Ga0466959_0113121 3300045049 Bacteria 1935
240 Ga0466967_0092088 3300045976 Bacteria 2756
241 Ga0466967_0209021 3300045976 Bacteria 1850
242 Ga0495592_0000026 3300046454 Bacteria 136204
243 Ga0495592_0131820 3300046454 Bacteria 1747
244 Ga0495629_0116784 3300046459 Bacteria 1859
245 Ga0495651_0000790 3300046462 Bacteria 24562
246 Ga0495651_0049385 3300046462 Bacteria 3247
247 Ga0495653_0000155 3300046463 Bacteria 56764
248 Ga0495580_0110916 3300046472 Bacteria 1905
249 Ga0495662_0022694 3300046476 Bacteria 3030
250 Ga0495664_0000001 3300046477 Bacteria 757730
251 Ga0495664_0143351 3300046477 Bacteria 1448
252 Ga0495584_0066260 3300046491 Bacteria 1816
253 Ga0495584_0109824 3300046491 Bacteria 1395
254 Ga0495585_0013489 3300046492 Bacteria 4780
255 Ga0495594_0041919 3300046499 Bacteria 2506
256 Ga0495607_0107321 3300046501 Bacteria 1485
257 Ga0495608_0000012 3300046511 Bacteria 242758
258 Ga0495616_0032340 3300046513 Bacteria 2734
259 Ga0495618_0000041 3300046514 Bacteria 96631
260 Ga0495628_0000033 3300046516 Bacteria 118203
261 Ga0495632_0065439 3300046519 Bacteria 1756
262 Ga0495652_0000001 3300046529 Bacteria 1045081
263 Ga0495652_0034412 3300046529 Bacteria 4415
264 Ga0495665_0012454 3300046531 Bacteria 4602
265 Ga0495640_0000010 3300046533 Bacteria 214167
266 Ga0495587_0000003 3300046536 Bacteria 424188
267 Ga0495587_0024692 3300046536 Bacteria 3681
268 Ga0495587_0060481 3300046536 Bacteria 2221
269 Ga0495598_0001482 3300046537 Bacteria 4673
270 Ga0495645_0000026 3300046543 Bacteria 118737
271 Ga0495645_0009267 3300046543 Bacteria 6884
272 Ga0495645_0020641 3300046543 Bacteria 4756
273 Ga0495667_0003292 3300046559 Bacteria 10828
274 Ga0495667_0013683 3300046559 Bacteria 5483
275 Ga0495667_0019291 3300046559 Bacteria 4601
276 Ga0495667_0086644 3300046559 Bacteria 2031
277 Ga0495634_0000285 3300046642 Bacteria 48349
278 Ga0495635_0000113 3300046663 Bacteria 48231
279 Ga0495635_0016843 3300046663 Bacteria 5105
280 Ga0495659_0006461 3300046664 Bacteria 3702
281 Ga0495657_0000258 3300046675 Bacteria 48270
282 Ga0495657_0045424 3300046675 Bacteria 2981
283 Ga0495599_0000070 3300046678 Bacteria 71413
284 Ga0495623_0000003 3300046679 Bacteria 147316
285 Ga0495623_0042563 3300046679 Bacteria 2893
286 Ga0495646_0000070 3300046680 Bacteria 47494
287 Ga0495647_0029236 3300046681 Bacteria 2037
288 Ga0495658_0007523 3300046683 Bacteria 5395
289 Ga0495669_0081035 3300046684 Bacteria 1489
290 Ga0495613_0035774 3300046689 Bacteria 3684
291 Ga0495624_0037521 3300046690 Bacteria 3116
292 Ga0495600_0000007 3300046809 Bacteria 150995
293 Ga0495581_0008314 3300047315 Bacteria 6016
294 Ga0495581_0112407 3300047315 Bacteria 1584
295 Ga0495604_0000010 3300047317 Bacteria 312236
296 Ga0495604_0031950 3300047317 Bacteria 4174
297 Ga0495674_0000013 3300047319 Bacteria 248475
298 Ga0495674_0201245 3300047319 Unclassified 1652
299 Ga0495676_0054191 3300047321 Unclassified 3189
300 Ga0495675_0000567 3300047444 Bacteria 23900
301 Ga0495684_0000008 3300047471 Bacteria 201370
302 Ga0495684_0186254 3300047471 Bacteria 1537
303 Ga0495684_0223792 3300047471 Bacteria 1379
304 Ga0495686_0080559 3300047472 Bacteria 1990
305 Ga0495593_0021395 3300047673 Bacteria 3614
306 Ga0495602_0000264 3300048088 Bacteria 48258
307 Ga0495602_0036787 3300048088 Bacteria 4551
308 Ga0495602_0051663 3300048088 Bacteria 3659
309 Ga0495602_0158886 3300048088 Bacteria 1767
310 Ga0495615_0007392 3300048090 Bacteria 2084
311 Ga0496100_0046805 3300048903 Bacteria 2784
312 Ga0496100_0072902 3300048903 Bacteria 2296
313 Ga0496100_0136555 3300048903 Bacteria 1733
314 Ga0496101_0075080 3300048904 Bacteria 2488
315 Ga0496102_0147786 3300048905 Bacteria 2206
316 Ga0496103_0089365 3300048906 Bacteria 1943
317 Ga0496103_0093330 3300048906 Bacteria 1900
318 Ga0496104_0000116 3300048907 Bacteria 74423
319 Ga0496104_0049441 3300048907 Bacteria 3965
320 Ga0496105_0000550 3300048908 Bacteria 24744
321 Ga0496105_0001322 3300048908 Bacteria 17343
322 Ga0496105_0062196 3300048908 Bacteria 3080
323 Ga0496106_0140025 3300048909 Bacteria 1902
324 Ga0496106_0159806 3300048909 Bacteria 1782
325 Ga0496107_0002458 3300048910 Bacteria 12020
326 Ga0496107_0075869 3300048910 Bacteria 2448
327 Ga0496108_0009174 3300048911 Bacteria 8006
328 Ga0496109_0002809 3300048912 Bacteria 14583
329 Ga0496109_0031863 3300048912 Bacteria 4735
330 Ga0496109_0212865 3300048912 Bacteria 1818
331 Ga0496110_0024415 3300048913 Bacteria 5152
332 Ga0496110_0059229 3300048913 Bacteria 3375
333 Ga0496110_0065317 3300048913 Bacteria 3216
334 Ga0496110_0124781 3300048913 Bacteria 2322
335 Ga0496113_0059870 3300048916 Bacteria 2869
336 Ga0496114_0238525 3300048917 Bacteria 1598
337 Ga0496115_0022583 3300048918 Bacteria 4877
338 Ga0496115_0025523 3300048918 Bacteria 4601
339 Ga0496115_0202672 3300048918 Bacteria 1639
340 Ga0496125_0000223 3300048928 Bacteria 115921
341 Ga0496126_0008577 3300048929 Bacteria 11008
342 Ga0496126_0221551 3300048929 Bacteria 1589
343 Ga0496126_0271888 3300048929 Bacteria 1406
344 Ga0501034_0278885 3300049571 Bacteria 1611
345 Ga0501039_0229972 3300049575 Bacteria 1458
346 Ga0501047_0044216 3300049581 Bacteria 4303
347 Ga0501068_0178944 3300049584 Bacteria 1341
348 Ga0501074_0014947 3300049590 Bacteria 5649
349 Ga0501076_0110136 3300049592 Bacteria 2226
350 Ga0501077_0046578 3300049593 Bacteria 2755
351 Ga0501077_0108334 3300049593 Bacteria 1760
352 Ga0501079_0109439 3300049741 Bacteria 2146
353 Ga0501080_0204021 3300049742 Bacteria 1814
354 Ga0501083_0054274 3300049744 Bacteria 2689
355 Ga0501044_0013759 3300049823 Bacteria 8743
356 nmdc:mga0yw44_30075_c1 3300050492 Bacteria 3143
357 nmdc:mga0yw44_918_c1 3300050492 Bacteria 11147
358 nmdc:mga05p37_25897_c1 3300050507 Bacteria 7131
359 nmdc:mga05p37_293535_c1 3300050507 Bacteria 1934
360 nmdc:mga0qj67_22351_c1 3300050509 Bacteria 4860
361 nmdc:mga0qj67_35_c1 3300050509 Bacteria 93990
362 nmdc:mga0qj67_42590_c1 3300050509 Bacteria 3574
363 nmdc:mga06r32_25454_c1 3300050510 Bacteria 4782
364 nmdc:mga08y16_61368_c1 3300050511 Bacteria 3926
365 nmdc:mga0n895_135077_c1 3300050512 Bacteria 2493
366 nmdc:mga0n895_19697_c1 3300050512 Bacteria 6274
367 nmdc:mga0n895_29192_c1 3300050512 Bacteria 5257
368 nmdc:mga08x19_40712_c1 3300050514 Bacteria 2958
369 nmdc:mga0a205_142856_c1 3300050515 Bacteria 2293
370 nmdc:mga0a205_178178_c1 3300050515 Bacteria 2020
371 Ga0495601_0000003 3300053077 Bacteria 493642
372 Ga0495601_0008245 3300053077 Bacteria 6148
373 Ga0495601_0038853 3300053077 Bacteria 2977
374 Ga0495601_0056310 3300053077 Bacteria 2490
375 Ga0495601_0080644 3300053077 Bacteria 2088
376 Ga0495612_0000009 3300053078 Bacteria 229858
377 Ga0495612_0048340 3300053078 Bacteria 1744
378 Ga0495595_0000075 3300053084 Bacteria 48300
379 Ga0495595_0010868 3300053084 Bacteria 3797
380 Ga0495619_0000039 3300053085 Bacteria 118681
381 Ga0495619_0012687 3300053085 Bacteria 5304
382 Ga0495619_0026700 3300053085 Bacteria 3716
383 Ga0495619_0087988 3300053085 Bacteria 2101
384 Ga0495619_0095326 3300053085 Bacteria 2019
385 Ga0500643_000085 3300053087 Bacteria 98026
386 Ga0500595_008034 3300053119 Bacteria 4331
387 Ga0500642_0009093 3300053130 Bacteria 3432
388 Ga0501084_0039068 3300054114 Bacteria 3969
389 Ga0501084_0146373 3300054114 Bacteria 1990
390 Ga0501082_0171478 3300060353 Bacteria 1886
391 Ga0466962_0098293 3300061719 Bacteria 1405
392 2507508995 2507262055 Bacteria 8048963
393 2508691215 2508501042 Bacteria 8719808
394 2509146500 2508501128 Bacteria 8613869
395 2513624358 2513237092 Bacteria 8341956
396 2513642000 2513237094 Bacteria 8789602
397 2513650208 2513237095 Bacteria 8976980
398 2513658650 2513237096 Bacteria 8722461
399 2513692204 2513237101 Bacteria 7952346
400 2513717948 2513237104 Bacteria 10034502
401 2513892449 2513237141 Bacteria 8496279
402 2513920786 2513237145 Bacteria 8979722
403 2515626414 2515154112 Bacteria 8294334
404 2517895051 2517572143 Bacteria 9484767
405 2524540412 2524023228 Bacteria 10118060
406 2528849717 2528768022 Bacteria 10457665
407 2671123107 2667528175 Bacteria 7532676
408 2723845422 2721755755 Bacteria 8322773
409 2728748840 2728368998 Bacteria 8720350
410 2793073505 2791355197 Bacteria 8420563
411 2818241268 2816332527 Bacteria 8933356
412 2824665644 2824661429 Bacteria 9877870
413 2824708788 2824704595 Bacteria 9667483
414 2824757167 2824753945 Bacteria 9787441
415 2824766765 2824763712 Bacteria 9792355
416 2842039394 2842038055 Bacteria 8002051
417 2842047660 2842045827 Bacteria 8006841
418 2874592677 2874590934 Bacteria 8299676
419 2874607685 2874604998 Bacteria 7834745
420 2874627445 2874620515 Bacteria 8290088
421 2874629800 2874628541 Bacteria 8630250
422 2874648286 2874645413 Bacteria 8214782
423 2876767286 2876761206 Bacteria 10111113
424 2876772890 2876771140 Bacteria 8287509
425 2876820218 2876818435 Bacteria 8274608
426 2879076721 2879074833 Bacteria 8279565
427 2879085228 2879083081 Bacteria 8587928
428 2879103866 2879099564 Bacteria 10442239
429 2879131668 2879127579 Bacteria 8294491
430 2879148039 2879142872 Bacteria 8267021
431 2885372178 2885366525 Bacteria 8326213
432 2885381447 2885374607 Bacteria 8927485
433 2885384159 2885383462 Bacteria 9473874
434 2888383734 2888378607 Bacteria 9652610
435 2889040171 2889033259 Bacteria 9099371
436 2903758363 2903748898 Bacteria 9972761
437 2904671037 2904666416 Bacteria 8226587
438 2904695022 2904690495 Bacteria 9412302
439 2904700113
440 2904720884 2904711408 Bacteria 9771557
441 2906611738
442 2906630023 2906626472 Bacteria 8826946
443 2906639708 2906635258 Bacteria 8601019
444 2906648731 2906643746 Bacteria 8722424
445 2906660549 2906660503 Bacteria 8595048
446 2908745294 2908739725 Bacteria 8628932
447 2922368069 2922361189 Bacteria 7436256
448 2922390672 2922386360 Bacteria 7017218
449 2922427625
450 2932788515 2932784394 Bacteria 9704911
451 2932798559 2932794094 Bacteria 7915132
452 2932801878 2932801729 Bacteria 7987968
453 2932803133 2932801729 Bacteria 7987968
454 2932816343 2932809354 Bacteria 9135765
455 2932821513 2932818245 Bacteria 9955613
456 2932831598 2932828146 Bacteria 9745859
457 2935612158 2935608549 Bacteria 8203142
458 2935622356 2935616580 Bacteria 9032984
459 2935632415 2935630451 Bacteria 8169952
460 2935645216 2935638405 Bacteria 10015038
461 2935649737 2935648319 Bacteria 8801166
462 2935658748 2935656913 Bacteria 8965014
463 2935671756 2935665750 Bacteria 9571747
464 2935678844 2935675223 Bacteria 9928132
465 2935688837 2935684952 Bacteria 9590419
466 2935696212 2935694250 Bacteria 9291695
467 2935706957 2935703347 Bacteria 10242284
468 2935715856 2935713505 Bacteria 9608509
469 2935725580 2935722832 Bacteria 9608746
470 2935738141 2935732158 Bacteria 9706831
471 2935747516 2935741537 Bacteria 9707219
472 2935753909 2935750917 Bacteria 9590372
473 2935762914 2935760218 Bacteria 9817913
474 2935774995 2935769743 Bacteria 7878163
475 2935782654 2935777560 Bacteria 8077691
476 2935791760 2935785616 Bacteria 7962367
477 2935800008 2935793552 Bacteria 8012592
478 2935807695 2935801545 Bacteria 9301974
479 2935817037 2935810662 Bacteria 9401221
480 2935821628 2935819856 Bacteria 8261050
481 2935834683 2935827899 Bacteria 10038562
482 2935840365 2935837841 Bacteria 9454360
483 2935847229 2935847175 Bacteria 8228321
484 2935860576 2935855204 Bacteria 9035059
485 2935865386 2935864058 Bacteria 9784707
486 2935877982 2935873716 Bacteria 9632195
487 2935885471 2935883170 Bacteria 7964738
488 2935924866 2935916978 Bacteria 9113783
489 2935977321 2935975950 Bacteria 8347125
490 2935988510 2935984226 Bacteria 8302647
491 2935996069 2935992306 Bacteria 9802711
492 2936006203 2936002035 Bacteria 9362176
493 2936012781 2936011229 Bacteria 8801034
494 2936021345 2936019824 Bacteria 8804134
495 2936030074 2936028420 Bacteria 8965941
496 2936043416 2936037263 Bacteria 9446081
497 2936047539 2936046547 Bacteria 8903709
498 2936057303 2936055302 Bacteria 8785755
499 2940560715 2940556831 Bacteria 9590747
500 2941508362 2941507105 Bacteria 8166816
501 2941515132 2941515067 Bacteria 8166720
502 2941530057 2941523033 Bacteria 8169134
503 2941541504 2941538514 Bacteria 9402094
504 3005477286 3005474847 Bacteria 9259049
505 8006938501 8006933436 Bacteria 10410654
506 8006969889 8006964411 Bacteria 8966052
507 8006970188 8006964411 Bacteria 8966052
508 8006978576 8006973647 Bacteria 10679141
509 8016562067 8016557553 Bacteria 8154380
510 8016573574 8016566248 Bacteria 8158151
511 8016577700 8016575299 Bacteria 8154085
512 8016592257 8016583857 Bacteria 10421953
513 8016599889 8016595262 Bacteria 8149947
514 8016610923 8016603502 Bacteria 8731218
515 8016627014 8016622563 Bacteria 7999408
516 8016640711 8016630954 Bacteria 9217207
517 8017062770 8017057580 Bacteria 10023680
518 8019544482 8019538911 Bacteria 7872763
519 8019559834 8019555841 Bacteria 9642137
520 8019569939 8019565922 Bacteria 9639779
521 8019582205 8019576017 Bacteria 10049540
522 8019589896 8019586578 Bacteria 10212056
523 8019601373 8019597564 Bacteria 10041141
524 8019617180 8019608314 Bacteria 10042931
525 8019627706 8019619141 Bacteria 9218857
526 8019634800 8019629233 Bacteria 8687553
527 8019658045 8019648815 Bacteria 10014479
528 8019683898 8019678201 Bacteria 8863603
529 Ga0496126_0043424
530 Ga0070658_10012234
531 Ga0070683_100039525
532 Ga0070690_100087627
533 Ga0068869_100195019
534 Ga0068869_100213573
535 Ga0070666_10055254
536 Ga0070666_10125990
537 Ga0070680_100017498
538 Ga0070682_100048365
539 Ga0070682_100099257
540 Ga0070689_100020981
541 Ga0070687_100030450
542 Ga0070669_100006702
543 Ga0070669_100044328
544 Ga0070675_100202316
545 Ga0070673_100024556
546 Ga0070659_100085449
547 Ga0070709_10158736
548 Ga0070713_100023676
549 Ga0070713_100031008
550 Ga0070710_10003665
551 Ga0070710_10027276
552 Ga0070701_10032677
553 Ga0070705_100136660
554 Ga0070705_100161868
555 Ga0070662_100031178
556 Ga0070681_10014253
557 Ga0070681_10036786
558 Ga0070681_10046339
559 Ga0070685_10089816
560 Ga0070707_100070426
561 Ga0070698_100007079
562 Ga0070699_100019737
563 Ga0070679_100011783
564 Ga0070679_100023003
565 Ga0070679_100048988
566 Ga0070684_100006096
567 Ga0070697_100093939
568 Ga0070672_100049971
569 Ga0068855_100065829
570 Ga0068857_100248670
571 Ga0068854_100141981
572 Ga0068854_100216123
573 Ga0068858_100056320
574 Ga0068862_100096724
575 Ga0081455_10001860
576 Ga0081455_10009744
577 Ga0081455_10031798
578 Ga0081538_10044624
579 Ga0081540_1003221
580 Ga0081540_1009789
581 Ga0081539_10070551
582 Ga0070717_10029594
583 Ga0070717_10056864
584 Ga0070717_10060335
585 Ga0070717_10146143
586 Ga0075365_10011942
587 Ga0070715_10007706
588 Ga0070716_100155537
589 Ga0070712_100001591
590 Ga0070712_100108842
591 Ga0075367_10087022
592 Ga0097621_100019564
593 Ga0075370_10115960
594 Ga0075428_100000068
595 Ga0075428_100182226
596 Ga0075430_100000823
597 Ga0075430_100017024
598 Ga0075430_100063617
599 Ga0075431_100000217
600 Ga0075431_100063587
601 Ga0075433_10162284
602 Ga0075433_10254951
603 Ga0075434_100084600
604 Ga0075434_100123545
605 Ga0075434_100137885
606 Ga0075434_100146702
607 Ga0075429_100002468
608 Ga0075429_100017530
609 Ga0068865_100003957
610 Ga0075436_100014568
611 Ga0099824_1002679
612 Ga0099822_1000813
613 Ga0099795_10012236
614 Ga0105240_10045049
615 Ga0105240_10113944
616 Ga0111539_10025883
617 Ga0111539_10062101
618 Ga0111539_10111656
619 Ga0111539_10200789
620 Ga0114129_10000035
621 Ga0114129_10032630
622 Ga0114129_10064487
623 Ga0114129_10120613
624 Ga0105242_10093079
625 Ga0105237_10061316
626 Ga0105237_10070418
627 Ga0105237_10177634
628 Ga0105238_10095295
629 Ga0099796_10001880
630 Ga0099796_10023163
631 Ga0105239_10116220
632 Ga0105239_10118340
633 Ga0105239_10473018
634 Ga0105246_10020051
635 Ga0157370_10019242
636 Ga0157369_10005882
637 Ga0157372_10038895
638 Ga0157372_10277235
639 Ga0163163_10027715
640 Ga0157380_10067001
641 Ga0157379_10072004
642 Ga0163161_10082112
643 Ga0206356_11678587
644 Ga0206349_1677469
645 Ga0206355_1094359
646 Ga0206352_10593933
647 Ga0206350_10491525
648 Ga0213872_10040685
649 Ga0213871_10007805
650 Ga0224712_10021185
651 Ga0224712_10049867
652 Ga0224712_10070994
653 Ga0209233_1002510
654 Ga0207692_10008675
655 Ga0207692_10009348
656 Ga0207642_10091378
657 Ga0207710_10033081
658 Ga0207688_10031180
659 Ga0207699_10030298
660 Ga0207699_10099454
661 Ga0207699_10165323
662 Ga0207645_10023307
663 Ga0207643_10000872
664 Ga0207684_10059972
665 Ga0207654_10055548
666 Ga0207707_10000413
667 Ga0207707_10012785
668 Ga0207707_10020024
669 Ga0207707_10045829
670 Ga0207695_10019824
671 Ga0207695_10160390
672 Ga0207671_10109850
673 Ga0207671_10183210
674 Ga0207693_10084934
675 Ga0207693_10127264
676 Ga0207663_10038149
677 Ga0207663_10069549
678 Ga0207660_10048534
679 Ga0207662_10007580
680 Ga0207657_10030389
681 Ga0207649_10077238
682 Ga0207652_10011892
683 Ga0207652_10119904
684 Ga0207681_10298788
685 Ga0207650_10002222
686 Ga0207659_10129543
687 Ga0207700_10007882
688 Ga0207700_10214595
689 Ga0207664_10008866
690 Ga0207706_10006344
691 Ga0207704_10215944
692 Ga0207665_10006295
693 Ga0207691_10007735
694 Ga0207711_10115856
695 Ga0207689_10044726
696 Ga0207661_10006710
697 Ga0207661_10034410
698 Ga0207679_10052178
699 Ga0207667_10051385
700 Ga0207651_10185165
701 Ga0207712_10080231
702 Ga0207640_10049413
703 Ga0207677_10042728
704 Ga0207678_10005238
705 Ga0207708_10060105
706 Ga0207641_10038901
707 Ga0207648_10026444
708 Ga0207674_10058822
709 Ga0207683_10141608
710 Ga0207698_10207182
711 Ga0209589_1000001
712 Ga0209489_100001
713 Ga0209700_100001
714 Ga0207428_10047726
715 Ga0265337_1000963
716 Ga0265760_10028467
717 Ga0265320_10030232
718 Ga0265325_10000352
719 Ga0265329_10006817
720 Ga0265340_10056112
721 Ga0265339_10064324
722 Ga0265331_10013877
723 Ga0265316_10055458
724 Ga0265314_10027152
725 Ga0315911_1000007
726 Ga0373936_0000283
727 Ga0373945_0006933
728 Ga0373953_0008260
729 Ga0373953_0009993
730 Ga0373954_0027592
731 Ga0373957_0006271
732 Ga0373943_0002565
733 Ga0373946_0013826
734 Ga0373946_0020062
735 Ga0373955_0000334
736 Ga0373961_0005771
737 Ga0373924_0000358
738 Ga0373924_0010933
739 Ga0373935_0001324
740 Ga0373927_0087379
741 Ga0373933_0001162
742 Ga0373933_0003120
743 Ga0373933_0022723
744 Ga0373947_0002784
745 Ga0373937_0001118
746 Ga0373937_0064851
747 Ga0373925_0000084
748 Ga0373925_0017236
749 Ga0373925_0089746
750 Ga0395900_0001080
751 Ga0395900_0216603
752 Ga0436364_0034478
753 Ga0436364_1206346
754 Ga0395901_0104954
755 Ga0436365_0298239
756 Ga0436365_0684655
757 Ga0436365_0750972
758 Ga0436365_0913975
759 Ga0436360_0932560
760 Ga0436360_1344078
761 Ga0436361_0085290
762 Ga0436361_0287699
763 Ga0436361_0360709
764 Ga0436363_0105492
765 Ga0436363_0547370
766 Ga0466957_0116592
767 Ga0466959_0113121
768 Ga0466967_0092088
769 Ga0466967_0209021
770 Ga0495592_0000026
771 Ga0495592_0131820
772 Ga0495629_0116784
773 Ga0495651_0000790
774 Ga0495651_0049385
775 Ga0495653_0000155
776 Ga0495580_0110916
777 Ga0495662_0022694
778 Ga0495664_0000001
779 Ga0495664_0143351
780 Ga0495584_0066260
781 Ga0495584_0109824
782 Ga0495585_0013489
783 Ga0495594_0041919
784 Ga0495607_0107321
785 Ga0495608_0000012
786 Ga0495616_0032340
787 Ga0495618_0000041
788 Ga0495628_0000033
789 Ga0495632_0065439
790 Ga0495652_0000001
791 Ga0495652_0034412
792 Ga0495665_0012454
793 Ga0495640_0000010
794 Ga0495587_0000003
795 Ga0495587_0024692
796 Ga0495587_0060481
797 Ga0495598_0001482
798 Ga0495645_0000026
799 Ga0495645_0009267
800 Ga0495645_0020641
801 Ga0495667_0003292
802 Ga0495667_0013683
803 Ga0495667_0019291
804 Ga0495667_0086644
805 Ga0495634_0000285
806 Ga0495635_0000113
807 Ga0495635_0016843
808 Ga0495659_0006461
809 Ga0495657_0000258
810 Ga0495657_0045424
811 Ga0495599_0000070
812 Ga0495623_0000003
813 Ga0495623_0042563
814 Ga0495646_0000070
815 Ga0495647_0029236
816 Ga0495658_0007523
817 Ga0495669_0081035
818 Ga0495613_0035774
819 Ga0495624_0037521
820 Ga0495600_0000007
821 Ga0495581_0008314
822 Ga0495581_0112407
823 Ga0495604_0000010
824 Ga0495604_0031950
825 Ga0495674_0000013
826 Ga0495674_0201245
827 Ga0495676_0054191
828 Ga0495675_0000567
829 Ga0495684_0000008
830 Ga0495684_0186254
831 Ga0495684_0223792
832 Ga0495686_0080559
833 Ga0495593_0021395
834 Ga0495602_0000264
835 Ga0495602_0036787
836 Ga0495602_0051663
837 Ga0495602_0158886
838 Ga0495615_0007392
839 Ga0496100_0046805
840 Ga0496100_0072902
841 Ga0496100_0136555
842 Ga0496101_0075080
843 Ga0496102_0147786
844 Ga0496103_0089365
845 Ga0496103_0093330
846 Ga0496104_0000116
847 Ga0496104_0049441
848 Ga0496105_0000550
849 Ga0496105_0001322
850 Ga0496105_0062196
851 Ga0496106_0140025
852 Ga0496106_0159806
853 Ga0496107_0002458
854 Ga0496107_0075869
855 Ga0496108_0009174
856 Ga0496109_0002809
857 Ga0496109_0031863
858 Ga0496109_0212865
859 Ga0496110_0024415
860 Ga0496110_0059229
861 Ga0496110_0065317
862 Ga0496110_0124781
863 Ga0496113_0059870
864 Ga0496114_0238525
865 Ga0496115_0022583
866 Ga0496115_0025523
867 Ga0496115_0202672
868 Ga0496125_0000223
869 Ga0496126_0008577
870 Ga0496126_0221551
871 Ga0496126_0271888
872 Ga0501034_0278885
873 Ga0501039_0229972
874 Ga0501047_0044216
875 Ga0501068_0178944
876 Ga0501074_0014947
877 Ga0501076_0110136
878 Ga0501077_0046578
879 Ga0501077_0108334
880 Ga0501079_0109439
881 Ga0501080_0204021
882 Ga0501083_0054274
883 Ga0501044_0013759
884 nmdc:mga0yw44_30075_c1
885 nmdc:mga0yw44_918_c1
886 nmdc:mga05p37_25897_c1
887 nmdc:mga05p37_293535_c1
888 nmdc:mga0qj67_22351_c1
889 nmdc:mga0qj67_35_c1
890 nmdc:mga0qj67_42590_c1
891 nmdc:mga06r32_25454_c1
892 nmdc:mga08y16_61368_c1
893 nmdc:mga0n895_135077_c1
894 nmdc:mga0n895_19697_c1
895 nmdc:mga0n895_29192_c1
896 nmdc:mga08x19_40712_c1
897 nmdc:mga0a205_142856_c1
898 nmdc:mga0a205_178178_c1
899 Ga0495601_0000003
900 Ga0495601_0008245
901 Ga0495601_0038853
902 Ga0495601_0056310
903 Ga0495601_0080644
904 Ga0495612_0000009
905 Ga0495612_0048340
906 Ga0495595_0000075
907 Ga0495595_0010868
908 Ga0495619_0000039
909 Ga0495619_0012687
910 Ga0495619_0026700
911 Ga0495619_0087988
912 Ga0495619_0095326
913 Ga0500643_000085
914 Ga0500595_008034
915 Ga0500642_0009093
916 Ga0501084_0039068
917 Ga0501084_0146373
918 Ga0501082_0171478
919 Ga0466962_0098293
920 2507508995
921 2508691215
922 2509146500
923 2513624358
924 2513642000
925 2513650208
926 2513658650
927 2513692204
928 2513717948
929 2513892449
930 2513920786
931 2515626414
932 2517895051
933 2524540412
934 2528849717
935 2671123107
936 2723845422
937 2728748840
938 2793073505
939 2818241268
940 2824665644
941 2824708788
942 2824757167
943 2824766765
944 2842039394
945 2842047660
946 2874592677
947 2874607685
948 2874627445
949 2874629800
950 2874648286
951 2876767286
952 2876772890
953 2876820218
954 2879076721
955 2879085228
956 2879103866
957 2879131668
958 2879148039
959 2885372178
960 2885381447
961 2885384159
962 2888383734
963 2889040171
964 2903758363
965 2904671037
966 2904695022
967 2904700113
968 2904720884
969 2906611738
970 2906630023
971 2906639708
972 2906648731
973 2906660549
974 2908745294
975 2922368069
976 2922390672
977 2922427625
978 2932788515
979 2932798559
980 2932801878
981 2932803133
982 2932816343
983 2932821513
984 2932831598
985 2935612158
986 2935622356
987 2935632415
988 2935645216
989 2935649737
990 2935658748
991 2935671756
992 2935678844
993 2935688837
994 2935696212
995 2935706957
996 2935715856
997 2935725580
998 2935738141
999 2935747516
1000 2935753909
1001 2935762914
1002 2935774995
1003 2935782654
1004 2935791760
1005 2935800008
1006 2935807695
1007 2935817037
1008 2935821628
1009 2935834683
1010 2935840365
1011 2935847229
1012 2935860576
1013 2935865386
1014 2935877982
1015 2935885471
1016 2935924866
1017 2935977321
1018 2935988510
1019 2935996069
1020 2936006203
1021 2936012781
1022 2936021345
1023 2936030074
1024 2936043416
1025 2936047539
1026 2936057303
1027 2940560715
1028 2941508362
1029 2941515132
1030 2941530057
1031 2941541504
1032 3005477286
1033 8006938501
1034 8006969889
1035 8006970188
1036 8006978576
1037 8016562067
1038 8016573574
1039 8016577700
1040 8016592257
1041 8016599889
1042 8016610923
1043 8016627014
1044 8016640711
1045 8017062770
1046 8019544482
1047 8019559834
1048 8019569939
1049 8019582205
1050 8019589896
1051 8019601373
1052 8019617180
1053 8019627706
1054 8019634800
1055 8019658045
1056 8019683898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

247

453

0.88

PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

93

240

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pv9-assembly1.cif.gz_B prolidase from pyrococcus furiosus 0.8641 15 383
3q6d-assembly1.cif.gz_A xaa-pro dipeptidase from bacillus anthracis. 0.8613 15 383
1pv9-assembly1.cif.gz_A prolidase from pyrococcus furiosus 0.8557 20 383
1pv9-assembly1.cif.gz_B prolidase from pyrococcus furiosus 0.854 15 383
5giu-assembly1.cif.gz_A-2 crystal structure of xaa-pro peptidase from deinococcus radiodurans, metal-free active site 0.8523 16 382
ID Description Score Start End Superfamily
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8941 160 390 3.90.230.10
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8795 160 390 3.90.230.10
5cdlA02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8736 161 382 3.90.230.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8708 162 383 3.90.230.10
af_I6YDN6_135_371_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8696 163 382 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A849I9G4-F1-model_v4 Aminopeptidase P family protein 0.9691 10 390 GO:0004177
AF-A0A529TU98-F1-model_v4 deleted 0.9636 100 390
AF-A0A529T2T5-F1-model_v4 M24 family metallopeptidase 0.9586 278 389
AF-A0A531MAB7-F1-model_v4 Aminopeptidase P family protein 0.9555 104 305 GO:0004177
AF-A0A529TU98-F1-model_v4 deleted 0.954 100 390

Map