metagRoot

F459735

General Info

Members	Datasets	Scaffolds	Average Seq Length
528	272	525	158

Family's Representative Sequence

Representative Sequence	3300049591\|Ga0501075_1324255\|Ga0501075_1324255_12_482
Length	156
Sequence	MGIIDQSKCPVRTGTIYPEPYASQMAGRSSLRLGDAGGLTQFGANLVILQPGARSSLRHWHANEDEFVMVMQGELVLVQDEGEYAMHPGECAAFPAGSTNGHTFINRTDEEARFLVVGTKAPREVCTHSDVDLVLKVEGRDVSFAYKDGEPWSGPR

Samples

	Sample ID	Description	Type	Environment
1	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
2	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
3	2989392574	Methylomonas rhizoryzae GJ1	Isolate	Unclassified
4	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
5	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
21	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
22	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
23	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
24	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
25	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
29	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
30	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
31	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
32	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
33	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
37	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
38	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
39	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
40	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
41	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
42	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
45	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
46	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
49	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
50	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
53	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
57	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
58	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
59	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
60	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
61	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
64	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
65	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
66	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
67	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
68	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
69	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
70	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
71	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
73	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
74	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
75	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
79	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
90	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
91	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
92	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
93	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
94	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
102	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
103	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
104	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
105	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
163	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
164	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
165	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
166	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
167	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
168	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
169	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
170	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
171	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
172	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
173	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
174	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
175	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
176	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
177	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
178	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
179	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
180	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
181	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
182	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
183	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
184	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
185	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
186	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
187	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
188	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
189	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
190	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
191	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
192	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
193	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
194	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
195	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
196	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
197	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
198	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
199	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
200	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
201	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
202	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
203	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
204	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
205	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
206	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
207	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
208	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
209	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
210	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
211	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
212	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
213	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
214	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
215	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
216	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
217	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
218	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
219	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
220	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
221	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
222	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
223	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
224	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
225	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
226	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
227	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
228	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
229	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
230	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
231	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
232	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
233	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
234	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
235	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
236	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
237	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
238	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
239	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
240	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
241	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
242	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
248	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
249	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
250	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
256	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
257	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
259	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
260	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
262	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
263	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
264	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
265	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
266	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
267	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
268	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
269	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
270	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
271	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
272	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.43
Metatranscriptomes	0
Isolates	0.57

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.57
Nodule	0
Rhizoplane	1.33
Rhizosphere	97.54
Stem	0
Stem Tuber	0
Unclassified	0.57

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065712_10001265	3300005290	Bacteria	10182
2	Ga0065712_10017350	3300005290	Bacteria	2004
3	Ga0065715_10017119	3300005293	Bacteria	1622
4	Ga0065715_10128278	3300005293	Bacteria	2064
5	Ga0070658_10042929	3300005327	Unclassified	3653
6	Ga0070690_100020607	3300005330	Bacteria	4018
7	Ga0070690_100021553	3300005330	Unclassified	3935
8	Ga0070690_100474764	3300005330	Bacteria	931
9	Ga0070670_100001720	3300005331	Bacteria	17831
10	Ga0070677_10013541	3300005333	Bacteria	2855
11	Ga0068869_100040509	3300005334	Bacteria	3331
12	Ga0068869_100387661	3300005334	Bacteria	1146
13	Ga0070666_10000383	3300005335	Bacteria	27824
14	Ga0070666_10065461	3300005335	Unclassified	2466
15	Ga0070680_100051739	3300005336	Bacteria	3352
16	Ga0070680_101242051	3300005336	Bacteria	645
17	Ga0070682_100026790	3300005337	Bacteria	3454
18	Ga0070682_100143120	3300005337	Bacteria	1632
19	Ga0070682_100700977	3300005337	Unclassified	812
20	Ga0068868_100065721	3300005338	Unclassified	2882
21	Ga0068868_100101210	3300005338	Unclassified	2332
22	Ga0070660_100552828	3300005339	Bacteria	960
23	Ga0070689_100218984	3300005340	Unclassified	1561
24	Ga0070689_100771589	3300005340	Bacteria	844
25	Ga0070691_10051067	3300005341	Bacteria	1973
26	Ga0070691_10096315	3300005341	Bacteria	1465
27	Ga0070687_100007751	3300005343	Bacteria	4502
28	Ga0070687_100184501	3300005343	Unclassified	1252
29	Ga0070661_100024766	3300005344	Bacteria	4306
30	Ga0070692_10022211	3300005345	Bacteria	3097
31	Ga0070692_10033898	3300005345	Unclassified	2575
32	Ga0070668_100001273	3300005347	Bacteria	18006
33	Ga0070668_100149812	3300005347	Unclassified	1886
34	Ga0070669_100002155	3300005353	Bacteria	14244
35	Ga0070669_100572397	3300005353	Bacteria	944
36	Ga0070675_100009479	3300005354	Bacteria	7577
37	Ga0070675_100139636	3300005354	Bacteria	2070
38	Ga0070671_100328031	3300005355	Unclassified	1304
39	Ga0070674_100005133	3300005356	Bacteria	7529
40	Ga0070674_100137589	3300005356	Unclassified	1829
41	Ga0070673_100647264	3300005364	Bacteria	967
42	Ga0070688_100044666	3300005365	Bacteria	2735
43	Ga0070688_100513091	3300005365	Bacteria	906
44	Ga0070659_100159098	3300005366	Bacteria	1846
45	Ga0070659_100223678	3300005366	Bacteria	1554
46	Ga0070667_100002701	3300005367	Bacteria	15360
47	Ga0070667_100016880	3300005367	Bacteria	6042
48	Ga0070709_10004037	3300005434	Bacteria	7918
49	Ga0070709_10987174	3300005434	Unclassified	669
50	Ga0070714_100331620	3300005435	Unclassified	1425
51	Ga0070701_10000729	3300005438	Bacteria	11644
52	Ga0070705_100160390	3300005440	Unclassified	1503
53	Ga0070705_100378162	3300005440	Bacteria	1041
54	Ga0070705_100444445	3300005440	Bacteria	971
55	Ga0070700_100012321	3300005441	Bacteria	4766
56	Ga0070694_100041668	3300005444	Unclassified	3064
57	Ga0070694_100436694	3300005444	Bacteria	1031
58	Ga0070678_100043163	3300005456	Bacteria	3210
59	Ga0070678_100312400	3300005456	Bacteria	1339
60	Ga0070678_100616939	3300005456	Unclassified	970
61	Ga0070662_100002002	3300005457	Bacteria	12492
62	Ga0070662_100416034	3300005457	Unclassified	1111
63	Ga0070662_100422071	3300005457	Bacteria	1103
64	Ga0070681_10024607	3300005458	Bacteria	6057
65	Ga0070681_10038386	3300005458	Bacteria	4802
66	Ga0068867_100006666	3300005459	Bacteria	8165
67	Ga0068867_100014633	3300005459	Bacteria	5559
68	Ga0068867_100018225	3300005459	Unclassified	4989
69	Ga0068867_101324801	3300005459	Bacteria	665
70	Ga0070685_10024815	3300005466	Bacteria	3295
71	Ga0070699_100018173	3300005518	Bacteria	6040
72	Ga0070679_100038000	3300005530	Unclassified	4784
73	Ga0070679_100137758	3300005530	Unclassified	2422
74	Ga0070679_100620805	3300005530	Bacteria	1024
75	Ga0070679_100691587	3300005530	Bacteria	962
76	Ga0070684_100037898	3300005535	Unclassified	4138
77	Ga0070684_100343819	3300005535	Unclassified	1372
78	Ga0070697_100811696	3300005536	Bacteria	828
79	Ga0068853_100002638	3300005539	Bacteria	13508
80	Ga0068853_100145114	3300005539	Unclassified	2132
81	Ga0068853_100615410	3300005539	Bacteria	1032
82	Ga0070672_100010069	3300005543	Bacteria	6545
83	Ga0070672_100033683	3300005543	Bacteria	3881
84	Ga0070672_100877657	3300005543	Bacteria	792
85	Ga0070686_100004547	3300005544	Bacteria	7652
86	Ga0070686_100032699	3300005544	Bacteria	3190
87	Ga0070686_100151536	3300005544	Bacteria	1624
88	Ga0070695_100004511	3300005545	Bacteria	8176
89	Ga0070695_100118833	3300005545	Bacteria	1805
90	Ga0070695_100137813	3300005545	Bacteria	1688
91	Ga0070695_100151849	3300005545	Bacteria	1617
92	Ga0070695_100177206	3300005545	Bacteria	1508
93	Ga0070695_100327365	3300005545	Bacteria	1141
94	Ga0070696_100000482	3300005546	Bacteria	25020
95	Ga0070696_100018042	3300005546	Bacteria	4766
96	Ga0070693_100057320	3300005547	Bacteria	2251
97	Ga0070665_100206133	3300005548	Bacteria	1967
98	Ga0070665_100938426	3300005548	Bacteria	878
99	Ga0070704_100042459	3300005549	Bacteria	3146
100	Ga0068855_100097295	3300005563	Bacteria	3390
101	Ga0068855_100313129	3300005563	Bacteria	1736
102	Ga0068855_100560177	3300005563	Bacteria	1236
103	Ga0068857_100803825	3300005577	Bacteria	898
104	Ga0068857_100991965	3300005577	Bacteria	808
105	Ga0068854_100021625	3300005578	Unclassified	4367
106	Ga0068856_100053611	3300005614	Unclassified	3976
107	Ga0068856_100160240	3300005614	Bacteria	2260
108	Ga0070702_100033171	3300005615	Bacteria	2837
109	Ga0070702_100080916	3300005615	Unclassified	1945
110	Ga0070702_100203538	3300005615	Bacteria	1312
111	Ga0068852_100022391	3300005616	Bacteria	5067
112	Ga0068852_100348581	3300005616	Bacteria	1445
113	Ga0068859_100151386	3300005617	Bacteria	2395
114	Ga0068859_100232643	3300005617	Bacteria	1931
115	Ga0068859_101165177	3300005617	Bacteria	848
116	Ga0068859_101763782	3300005617	Bacteria	684
117	Ga0068859_101809668	3300005617	Bacteria	674
118	Ga0068864_100029298	3300005618	Unclassified	4660
119	Ga0068866_10186597	3300005718	Bacteria	1229
120	Ga0068866_10839420	3300005718	Unclassified	642
121	Ga0068861_100001459	3300005719	Bacteria	14966
122	Ga0068861_100205909	3300005719	Bacteria	1654
123	Ga0068861_100618599	3300005719	Bacteria	996
124	Ga0068851_10359242	3300005834	Bacteria	849
125	Ga0068870_10322138	3300005840	Bacteria	982
126	Ga0068863_100001611	3300005841	Bacteria	22315
127	Ga0068863_100142776	3300005841	Bacteria	2289
128	Ga0068863_100254938	3300005841	Bacteria	1695
129	Ga0068858_100132782	3300005842	Bacteria	2335
130	Ga0068858_100301474	3300005842	Unclassified	1529
131	Ga0068860_100003919	3300005843	Bacteria	15290
132	Ga0068860_100045968	3300005843	Bacteria	4164
133	Ga0068860_100091393	3300005843	Unclassified	2900
134	Ga0068860_100774110	3300005843	Bacteria	972
135	Ga0068860_100858916	3300005843	Bacteria	922
136	Ga0068862_100002751	3300005844	Bacteria	15426
137	Ga0068862_100066497	3300005844	Bacteria	3107
138	Ga0068862_101657658	3300005844	Bacteria	647
139	Ga0075432_10074377	3300006058	Bacteria	1224
140	Ga0075366_10098218	3300006195	Bacteria	1757
141	Ga0097621_100008547	3300006237	Bacteria	7377
142	Ga0097621_100124392	3300006237	Bacteria	2190
143	Ga0097621_100171512	3300006237	Bacteria	1870
144	Ga0068871_100090341	3300006358	Bacteria	2550
145	Ga0075431_100738758	3300006847	Bacteria	960
146	Ga0075433_10253341	3300006852	Bacteria	1561
147	Ga0075434_100089159	3300006871	Bacteria	3086
148	Ga0075434_100120923	3300006871	Unclassified	2634
149	Ga0075434_100412640	3300006871	Bacteria	1371
150	Ga0068865_100002156	3300006881	Bacteria	11594
151	Ga0068865_100013692	3300006881	Bacteria	5136
152	Ga0097620_100151376	3300006931	Bacteria	2395
153	Ga0097620_100232633	3300006931	Bacteria	1931
154	Ga0097620_101165151	3300006931	Bacteria	848
155	Ga0097620_101763699	3300006931	Bacteria	684
156	Ga0097620_101809747	3300006931	Bacteria	674
157	Ga0075435_100015626	3300007076	Bacteria	5710
158	Ga0075435_100207893	3300007076	Unclassified	1659
159	Ga0111539_10185281	3300009094	Unclassified	2431
160	Ga0105245_10009167	3300009098	Bacteria	8627
161	Ga0105245_10090262	3300009098	Unclassified	2818
162	Ga0105245_10162056	3300009098	Bacteria	2123
163	Ga0105243_10036053	3300009148	Unclassified	3836
164	Ga0105241_10025981	3300009174	Bacteria	4355
165	Ga0105242_10003366	3300009176	Bacteria	12448
166	Ga0105242_10018744	3300009176	Bacteria	5413
167	Ga0105242_10084989	3300009176	Bacteria	2653
168	Ga0105242_10235648	3300009176	Unclassified	1643
169	Ga0105248_10002726	3300009177	Bacteria	19624
170	Ga0105248_10034506	3300009177	Bacteria	5658
171	Ga0105237_10011858	3300009545	Bacteria	9217
172	Ga0105237_10315691	3300009545	Bacteria	1566
173	Ga0105237_10633220	3300009545	Bacteria	1076
174	Ga0105237_12275368	3300009545	Bacteria	552
175	Ga0105238_10081693	3300009551	Bacteria	3221
176	Ga0105249_10008131	3300009553	Bacteria	9148
177	Ga0105249_10355470	3300009553	Bacteria	1485
178	Ga0105249_10759651	3300009553	Bacteria	1032
179	Ga0105239_10293226	3300010375	Unclassified	1832
180	Ga0105246_10006942	3300011119	Bacteria	6926
181	Ga0105246_10641768	3300011119	Bacteria	923
182	Ga0157373_10317752	3300013100	Unclassified	1107
183	Ga0157371_10048348	3300013102	Unclassified	3023
184	Ga0157370_10367882	3300013104	Bacteria	1325
185	Ga0157370_10478345	3300013104	Unclassified	1144
186	Ga0157370_10870963	3300013104	Bacteria	818
187	Ga0157369_10235932	3300013105	Bacteria	1911
188	Ga0157374_10028221	3300013296	Bacteria	5069
189	Ga0157374_11947582	3300013296	Bacteria	614
190	Ga0157374_12478328	3300013296	Bacteria	546
191	Ga0157378_10019937	3300013297	Bacteria	5897
192	Ga0157378_10084677	3300013297	Bacteria	2871
193	Ga0157378_10087696	3300013297	Unclassified	2823
194	Ga0163162_10784105	3300013306	Unclassified	1071
195	Ga0157372_10318150	3300013307	Bacteria	1812
196	Ga0157372_10367407	3300013307	Bacteria	1676
197	Ga0157372_10712875	3300013307	Bacteria	1167
198	Ga0157375_10055929	3300013308	Bacteria	3892
199	Ga0157375_10266792	3300013308	Unclassified	1874
200	Ga0157375_10288901	3300013308	Bacteria	1803
201	Ga0163163_10087616	3300014325	Unclassified	3124
202	Ga0157380_10019963	3300014326	Bacteria	5002
203	Ga0182008_10822603	3300014497	Bacteria	541
204	Ga0157379_10023479	3300014968	Bacteria	5473
205	Ga0157379_10345388	3300014968	Unclassified	1362
206	Ga0157379_10749166	3300014968	Unclassified	919
207	Ga0157376_10015202	3300014969	Bacteria	5806
208	Ga0157376_10023205	3300014969	Unclassified	4853
209	Ga0163161_10000551	3300017792	Bacteria	30373
210	Ga0163161_10555359	3300017792	Bacteria	942
211	Ga0207697_10006297	3300025315	Bacteria	5390
212	Ga0207697_10013464	3300025315	Unclassified	3412
213	Ga0207697_10044777	3300025315	Bacteria	1821
214	Ga0207682_10014703	3300025893	Bacteria	3050
215	Ga0207682_10025015	3300025893	Bacteria	2367
216	Ga0207642_10061541	3300025899	Unclassified	1746
217	Ga0207642_10128840	3300025899	Bacteria	1317
218	Ga0207688_10060009	3300025901	Bacteria	2142
219	Ga0207680_10012679	3300025903	Unclassified	4301
220	Ga0207699_10084545	3300025906	Bacteria	1976
221	Ga0207645_10000390	3300025907	Bacteria	36191
222	Ga0207645_10001381	3300025907	Bacteria	19927
223	Ga0207643_10278188	3300025908	Bacteria	1037
224	Ga0207705_10505149	3300025909	Unclassified	939
225	Ga0207654_10087678	3300025911	Bacteria	1889
226	Ga0207707_10006501	3300025912	Bacteria	10206
227	Ga0207707_10017308	3300025912	Bacteria	6282
228	Ga0207707_10048821	3300025912	Unclassified	3687
229	Ga0207707_10404723	3300025912	Bacteria	1171
230	Ga0207671_10009072	3300025914	Bacteria	8360
231	Ga0207663_10060702	3300025916	Bacteria	2397
232	Ga0207660_10078706	3300025917	Bacteria	2417
233	Ga0207660_11228251	3300025917	Unclassified	609
234	Ga0207662_10029049	3300025918	Unclassified	3201
235	Ga0207662_10043410	3300025918	Bacteria	2652
236	Ga0207657_10043140	3300025919	Unclassified	3975
237	Ga0207657_10506942	3300025919	Bacteria	945
238	Ga0207649_10035417	3300025920	Bacteria	3000
239	Ga0207652_10102958	3300025921	Unclassified	2524
240	Ga0207652_10192188	3300025921	Unclassified	1836
241	Ga0207652_10235879	3300025921	Bacteria	1649
242	Ga0207652_10901996	3300025921	Bacteria	781
243	Ga0207681_10001344	3300025923	Bacteria	15876
244	Ga0207681_10033370	3300025923	Unclassified	3374
245	Ga0207681_10915872	3300025923	Bacteria	734
246	Ga0207694_10045659	3300025924	Bacteria	3384
247	Ga0207694_10632268	3300025924	Bacteria	901
248	Ga0207650_10000851	3300025925	Bacteria	23132
249	Ga0207650_10088507	3300025925	Bacteria	2361
250	Ga0207650_10406926	3300025925	Bacteria	1127
251	Ga0207659_10007942	3300025926	Bacteria	6562
252	Ga0207687_10035466	3300025927	Unclassified	3393
253	Ga0207687_10799513	3300025927	Bacteria	804
254	Ga0207664_10760462	3300025929	Bacteria	871
255	Ga0207644_10125091	3300025931	Unclassified	1961
256	Ga0207644_10264149	3300025931	Bacteria	1377
257	Ga0207690_10005425	3300025932	Bacteria	7512
258	Ga0207690_10194121	3300025932	Bacteria	1537
259	Ga0207690_10533573	3300025932	Bacteria	952
260	Ga0207706_10011456	3300025933	Bacteria	8077
261	Ga0207706_10023930	3300025933	Bacteria	5479
262	Ga0207706_10411650	3300025933	Unclassified	1172
263	Ga0207686_10154187	3300025934	Unclassified	1603
264	Ga0207686_10188870	3300025934	Bacteria	1467
265	Ga0207686_11164451	3300025934	Unclassified	630
266	Ga0207686_11368315	3300025934	Unclassified	582
267	Ga0207709_10014395	3300025935	Bacteria	4367
268	Ga0207670_10053235	3300025936	Bacteria	2726
269	Ga0207670_10421850	3300025936	Bacteria	1070
270	Ga0207670_10784473	3300025936	Bacteria	793
271	Ga0207669_10005373	3300025937	Bacteria	5743
272	Ga0207704_10113239	3300025938	Unclassified	1839
273	Ga0207704_10161038	3300025938	Bacteria	1597
274	Ga0207691_10001079	3300025940	Bacteria	27155
275	Ga0207691_10025737	3300025940	Bacteria	5522
276	Ga0207691_10180696	3300025940	Bacteria	1844
277	Ga0207711_10092397	3300025941	Bacteria	2663
278	Ga0207689_10008976	3300025942	Bacteria	8662
279	Ga0207689_10486523	3300025942	Bacteria	1033
280	Ga0207679_10289203	3300025945	Bacteria	1408
281	Ga0207679_10311784	3300025945	Unclassified	1360
282	Ga0207667_10269537	3300025949	Bacteria	1740
283	Ga0207651_10695312	3300025960	Bacteria	895
284	Ga0207651_10729875	3300025960	Bacteria	874
285	Ga0207651_12087271	3300025960	Bacteria	509
286	Ga0207712_10000987	3300025961	Bacteria	20375
287	Ga0207712_10581419	3300025961	Unclassified	967
288	Ga0207668_10039113	3300025972	Unclassified	3189
289	Ga0207640_11205068	3300025981	Unclassified	673
290	Ga0207658_10051803	3300025986	Unclassified	3026
291	Ga0207677_10063329	3300026023	Bacteria	2570
292	Ga0207677_10080676	3300026023	Unclassified	2332
293	Ga0207703_10004869	3300026035	Bacteria	10920
294	Ga0207703_10083828	3300026035	Unclassified	2664
295	Ga0207703_10419348	3300026035	Unclassified	1245
296	Ga0207639_10004496	3300026041	Bacteria	9406
297	Ga0207639_10059042	3300026041	Unclassified	2953
298	Ga0207639_10280183	3300026041	Bacteria	1466
299	Ga0207639_11138380	3300026041	Unclassified	732
300	Ga0207678_10095923	3300026067	Bacteria	2534
301	Ga0207708_10003954	3300026075	Bacteria	10911
302	Ga0207708_10096225	3300026075	Bacteria	2288
303	Ga0207702_10057940	3300026078	Unclassified	3295
304	Ga0207702_10187291	3300026078	Bacteria	1910
305	Ga0207702_10194505	3300026078	Bacteria	1876
306	Ga0207641_10012611	3300026088	Bacteria	6931
307	Ga0207641_10039686	3300026088	Bacteria	3938
308	Ga0207641_10069627	3300026088	Bacteria	3022
309	Ga0207641_10116627	3300026088	Bacteria	2376
310	Ga0207641_10566942	3300026088	Bacteria	1109
311	Ga0207648_10001878	3300026089	Bacteria	22968
312	Ga0207648_10412635	3300026089	Bacteria	1225
313	Ga0207676_10103285	3300026095	Bacteria	2368
314	Ga0207676_11092288	3300026095	Bacteria	788
315	Ga0207675_100002444	3300026118	Bacteria	18401
316	Ga0207675_100005947	3300026118	Bacteria	11632
317	Ga0207675_100227213	3300026118	Unclassified	1800
318	Ga0207683_10000495	3300026121	Bacteria	36463
319	Ga0207683_10119216	3300026121	Bacteria	2368
320	Ga0207683_11580203	3300026121	Bacteria	605
321	Ga0207698_10366421	3300026142	Bacteria	1366
322	Ga0268266_10657728	3300028379	Bacteria	1009
323	Ga0268265_10006346	3300028380	Bacteria	8014
324	Ga0268265_10066470	3300028380	Bacteria	2787
325	Ga0268265_10438328	3300028380	Bacteria	1217
326	Ga0268264_10035210	3300028381	Bacteria	4121
327	Ga0268264_10177650	3300028381	Unclassified	1931
328	Ga0268264_10216311	3300028381	Unclassified	1762
329	Ga0268264_10907781	3300028381	Bacteria	884
330	Ga0268264_10976326	3300028381	Bacteria	853
331	Ga0265338_10528189	3300028800	Bacteria	828
332	Ga0265320_10008138	3300031240	Bacteria	6442
333	Ga0265327_10308734	3300031251	Bacteria	695
334	Ga0307408_100454200	3300031548	Bacteria	1112
335	Ga0265313_10040469	3300031595	Bacteria	2304
336	Ga0316575_10091489	3300031665	Bacteria	1232
337	Ga0265314_10007555	3300031711	Bacteria	9419
338	Ga0307405_11201408	3300031731	Bacteria	656
339	Ga0307413_10140573	3300031824	Bacteria	1668
340	Ga0307412_10143177	3300031911	Bacteria	1754
341	Ga0307414_11628705	3300032004	Bacteria	602
342	Ga0307411_10025058	3300032005	Bacteria	3567
343	Ga0373962_0297167	3300035242	Bacteria	572
344	Ga0373931_0068282	3300035691	Bacteria	1934
345	Ga0373925_1583960	3300037068	Unclassified	535
346	Ga0395905_0259698	3300037471	Unclassified	1622
347	Ga0439448_0063925	3300042005	Bacteria	1220
348	Ga0466965_0500776	3300044683	Bacteria	681
349	Ga0453684_1307333	3300044712	Unclassified	756
350	Ga0451576_0072330	3300045051	Bacteria	3589
351	Ga0451576_1603675	3300045051	Bacteria	675
352	Ga0495603_0087347	3300046455	Bacteria	1825
353	Ga0495603_0095455	3300046455	Bacteria	1737
354	Ga0495603_0200486	3300046455	Bacteria	1153
355	Ga0495629_0007035	3300046459	Bacteria	8290
356	Ga0495629_0013979	3300046459	Bacteria	5787
357	Ga0495653_0038106	3300046463	Bacteria	3773
358	Ga0495580_0106857	3300046472	Bacteria	1944
359	Ga0495580_0268383	3300046472	Bacteria	1166
360	Ga0495582_0065835	3300046473	Bacteria	2002
361	Ga0495582_0084337	3300046473	Bacteria	1766
362	Ga0495605_0418185	3300046474	Unclassified	555
363	Ga0495584_0002192	3300046491	Bacteria	11134
364	Ga0495585_0001087	3300046492	Bacteria	22389
365	Ga0495585_0010819	3300046492	Bacteria	5421
366	Ga0495585_0040774	3300046492	Bacteria	2606
367	Ga0495585_0049525	3300046492	Bacteria	2332
368	Ga0495585_0103548	3300046492	Bacteria	1520
369	Ga0495585_0108181	3300046492	Bacteria	1481
370	Ga0495594_0000446	3300046499	Bacteria	20938
371	Ga0495594_0019777	3300046499	Bacteria	3581
372	Ga0495594_0082692	3300046499	Bacteria	1794
373	Ga0495594_0170753	3300046499	Bacteria	1237
374	Ga0495596_0219022	3300046500	Bacteria	739
375	Ga0495607_0255373	3300046501	Bacteria	842
376	Ga0495606_0012998	3300046507	Bacteria	6621
377	Ga0495606_0050014	3300046507	Bacteria	2737
378	Ga0495606_0118775	3300046507	Bacteria	1585
379	Ga0495606_0125780	3300046507	Bacteria	1529
380	Ga0495630_0991410	3300046517	Unclassified	639
381	Ga0495631_0008257	3300046518	Bacteria	5248
382	Ga0495631_0010462	3300046518	Bacteria	4588
383	Ga0495631_0023168	3300046518	Unclassified	2880
384	Ga0495644_0036999	3300046523	Bacteria	1841
385	Ga0495663_0069722	3300046525	Bacteria	1117
386	Ga0495663_0214249	3300046525	Bacteria	675
387	Ga0495666_0019971	3300046526	Bacteria	3322
388	Ga0495666_0025871	3300046526	Bacteria	2896
389	Ga0495666_0050977	3300046526	Bacteria	1989
390	Ga0495666_0114985	3300046526	Bacteria	1262
391	Ga0495666_0212040	3300046526	Bacteria	888
392	Ga0495642_0012062	3300046528	Bacteria	3330
393	Ga0495642_0073296	3300046528	Bacteria	1434
394	Ga0495642_0158007	3300046528	Bacteria	982
395	Ga0495652_0086509	3300046529	Bacteria	2573
396	Ga0495665_0006374	3300046531	Bacteria	6366
397	Ga0495665_0147969	3300046531	Bacteria	1226
398	Ga0495665_0175187	3300046531	Bacteria	1115
399	Ga0495640_0205412	3300046533	Bacteria	1247
400	Ga0495586_0000889	3300046535	Bacteria	17093
401	Ga0495587_0587535	3300046536	Bacteria	613
402	Ga0495621_0024866	3300046539	Unclassified	2005
403	Ga0495597_0001100	3300046542	Bacteria	20478
404	Ga0495597_0008939	3300046542	Bacteria	4995
405	Ga0495597_0121810	3300046542	Bacteria	1087
406	Ga0495622_0018444	3300046557	Bacteria	3249
407	Ga0495622_0029152	3300046557	Bacteria	2578
408	Ga0495622_0081588	3300046557	Bacteria	1488
409	Ga0495622_0135440	3300046557	Unclassified	1120
410	Ga0495633_0043247	3300046558	Bacteria	2137
411	Ga0495633_0058388	3300046558	Bacteria	1811
412	Ga0495633_0160861	3300046558	Bacteria	1036
413	Ga0495667_0228999	3300046559	Bacteria	1185
414	Ga0495656_0056652	3300046615	Bacteria	1694
415	Ga0495668_0004272	3300046616	Bacteria	10253
416	Ga0495668_0044335	3300046616	Bacteria	2472
417	Ga0495611_0484908	3300046648	Bacteria	562
418	Ga0495625_0243682	3300046660	Bacteria	1169
419	Ga0495661_0034545	3300046665	Bacteria	3180
420	Ga0495661_0038608	3300046665	Unclassified	2972
421	Ga0495661_0050653	3300046665	Bacteria	2513
422	Ga0495661_0064381	3300046665	Bacteria	2163
423	Ga0495661_0074555	3300046665	Bacteria	1974
424	Ga0495661_0076130	3300046665	Bacteria	1948
425	Ga0495588_0043524	3300046674	Bacteria	2298
426	Ga0495588_0073123	3300046674	Bacteria	1784
427	Ga0495588_0100270	3300046674	Bacteria	1521
428	Ga0495588_0100931	3300046674	Bacteria	1516
429	Ga0495588_0207184	3300046674	Bacteria	1035
430	Ga0495588_0267143	3300046674	Unclassified	901
431	Ga0495588_0317677	3300046674	Bacteria	819
432	Ga0495623_0021479	3300046679	Bacteria	4167
433	Ga0495623_0180117	3300046679	Bacteria	1228
434	Ga0495623_0491970	3300046679	Unclassified	648
435	Ga0495646_0342637	3300046680	Bacteria	784
436	Ga0495669_0565556	3300046684	Bacteria	553
437	Ga0495613_0111843	3300046689	Bacteria	1967
438	Ga0495613_0161488	3300046689	Bacteria	1594
439	Ga0495613_0266932	3300046689	Bacteria	1191
440	Ga0495624_0067585	3300046690	Bacteria	2229
441	Ga0495624_0085977	3300046690	Bacteria	1942
442	Ga0495670_0005381	3300046691	Bacteria	6292
443	Ga0495670_0141551	3300046691	Bacteria	1258
444	Ga0495670_0172775	3300046691	Bacteria	1138
445	Ga0495671_0031779	3300046692	Bacteria	2697
446	Ga0495671_0034093	3300046692	Bacteria	2590
447	Ga0495589_0032771	3300046794	Bacteria	2612
448	Ga0495589_0054320	3300046794	Bacteria	1975
449	Ga0495581_0088730	3300047315	Bacteria	1793
450	Ga0495581_0091448	3300047315	Bacteria	1765
451	Ga0495581_0375052	3300047315	Unclassified	830
452	Ga0495604_0162366	3300047317	Bacteria	1577
453	Ga0495604_0196659	3300047317	Bacteria	1401
454	Ga0495604_0446402	3300047317	Bacteria	845
455	Ga0495636_0004347	3300047318	Bacteria	5560
456	Ga0495674_0002353	3300047319	Bacteria	18542
457	Ga0495676_0669193	3300047321	Bacteria	673
458	Ga0495680_0786158	3300047322	Unclassified	623
459	Ga0495683_0157369	3300047323	Bacteria	1053
460	Ga0495683_0277077	3300047323	Unclassified	727
461	Ga0495675_0018492	3300047444	Bacteria	4423
462	Ga0495675_0213143	3300047444	Bacteria	1171
463	Ga0495677_0006749	3300047445	Bacteria	4318
464	Ga0495677_0020917	3300047445	Bacteria	2372
465	Ga0495677_0052692	3300047445	Bacteria	1500
466	Ga0495677_0060663	3300047445	Bacteria	1402
467	Ga0495681_0027084	3300047470	Bacteria	2971
468	Ga0495681_0033148	3300047470	Bacteria	2591
469	Ga0495593_0018300	3300047673	Bacteria	3938
470	Ga0495593_0046284	3300047673	Bacteria	2318
471	Ga0495626_0001520	3300048091	Bacteria	18229
472	Ga0495626_0417741	3300048091	Bacteria	517
473	Ga0496107_0067620	3300048910	Bacteria	2593
474	Ga0496108_1096267	3300048911	Unclassified	677
475	Ga0496112_0010461	3300048915	Bacteria	8415
476	Ga0496113_0415109	3300048916	Bacteria	1081
477	Ga0496114_0453238	3300048917	Bacteria	1136
478	Ga0496115_0313072	3300048918	Bacteria	1285
479	Ga0496115_0403280	3300048918	Bacteria	1109
480	Ga0501036_0167926	3300049572	Bacteria	1849
481	Ga0501036_0607035	3300049572	Bacteria	907
482	Ga0501037_0134609	3300049573	Bacteria	1771
483	Ga0501039_0461537	3300049575	Bacteria	997
484	Ga0501041_0504950	3300049577	Bacteria	769
485	Ga0501042_0798585	3300049578	Bacteria	687
486	Ga0501043_0502370	3300049579	Bacteria	906
487	Ga0501043_0762040	3300049579	Bacteria	703
488	Ga0501047_0021158	3300049581	Bacteria	6246
489	Ga0501047_0475476	3300049581	Bacteria	1077
490	Ga0501047_0505394	3300049581	Bacteria	1035
491	Ga0501048_0236956	3300049582	Bacteria	1295
492	Ga0501067_0028701	3300049583	Bacteria	3083
493	Ga0501067_0542160	3300049583	Bacteria	651
494	Ga0501068_0057955	3300049584	Bacteria	2349
495	Ga0501069_0001252	3300049585	Bacteria	12431
496	Ga0501070_0000975	3300049586	Bacteria	25701
497	Ga0501071_0051581	3300049587	Bacteria	2965
498	Ga0501072_0108564	3300049588	Bacteria	2208
499	Ga0501073_0002142	3300049589	Bacteria	14774
500	Ga0501074_0001937	3300049590	Bacteria	14220
501	Ga0501075_0020404	3300049591	Bacteria	4821
502	Ga0501075_1324255	3300049591	Bacteria	546
503	Ga0501076_0092730	3300049592	Bacteria	2430
504	Ga0501076_0620652	3300049592	Bacteria	892
505	Ga0501079_0035476	3300049741	Bacteria	3839
506	Ga0501080_0022112	3300049742	Bacteria	5891
507	Ga0501080_0117900	3300049742	Bacteria	2461
508	Ga0501081_0038131	3300049743	Bacteria	3281
509	Ga0501083_0002623	3300049744	Bacteria	12390
510	Ga0501083_0091513	3300049744	Bacteria	2008
511	Ga0501044_0480717	3300049823	Bacteria	1145
512	nmdc:mga0k408_345616_c1	3300050493	Bacteria	887
513	nmdc:mga0n895_298960_c1	3300050512	Bacteria	1632
514	nmdc:mga0n895_32645_c1	3300050512	Bacteria	4998
515	nmdc:mga0n895_332211_c1	3300050512	Unclassified	1540
516	nmdc:mga0rr50_161442_c1	3300050513	Unclassified	1819
517	nmdc:mga0rr50_190866_c1	3300050513	Bacteria	1679
518	nmdc:mga0rr50_72917_c1	3300050513	Unclassified	2623
519	nmdc:mga0a205_671158_c1	3300050515	Bacteria	887
520	nmdc:mga0a205_736180_c1	3300050515	Bacteria	835
521	Ga0500593_000245	3300053117	Bacteria	22241
522	Ga0501084_0045302	3300054114	Bacteria	3683
523	Ga0501082_0064720	3300060353	Bacteria	3149
524	Ga0501082_0120585	3300060353	Bacteria	2273
525	Ga0530510_0082233	3300061734	Bacteria	2345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046455	Ga0495603_0087347	Ga0495603_0087347_1372_1812	144
2	iso_pu_bacteria	2870068957	2870073106	145
3	iso_pu_bacteria	2885374607	2885374715	145
4	3300046492	Ga0495585_0010819	Ga0495585_0010819_1365_1826	147
5	3300046507	Ga0495606_0118775	Ga0495606_0118775_155_616	147
6	3300046523	Ga0495644_0036999	Ga0495644_0036999_502_963	147
7	3300046525	Ga0495663_0069722	Ga0495663_0069722_396_857	147
8	3300046615	Ga0495656_0056652	Ga0495656_0056652_1112_1573	147
9	3300046616	Ga0495668_0004272	Ga0495668_0004272_7310_7771	147
10	3300046648	Ga0495611_0484908	Ga0495611_0484908_90_551	147
11	3300046665	Ga0495661_0050653	Ga0495661_0050653_1327_1806	147
12	3300046665	Ga0495661_0064381	Ga0495661_0064381_1313_1774	147
13	3300046691	Ga0495670_0141551	Ga0495670_0141551_385_864	147
14	3300046691	Ga0495670_0172775	Ga0495670_0172775_10_471	147
15	3300046794	Ga0495589_0032771	Ga0495589_0032771_1312_1773	147
16	3300047445	Ga0495677_0006749	Ga0495677_0006749_842_1303	147
17	3300047445	Ga0495677_0052692	Ga0495677_0052692_1008_1487	147
18	3300047470	Ga0495681_0027084	Ga0495681_0027084_138_599	147
19	3300005434	Ga0070709_10004037	Ga0070709_100040377	148
20	3300005435	Ga0070714_100331620	Ga0070714_1003316202	148
21	3300005518	Ga0070699_100018173	Ga0070699_1000181736	148
22	3300005545	Ga0070695_100004511	Ga0070695_1000045114	148
23	3300005841	Ga0068863_100142776	Ga0068863_1001427762	148
24	3300005844	Ga0068862_100066497	Ga0068862_1000664974	148
25	3300025906	Ga0207699_10084545	Ga0207699_100845452	148
26	3300025929	Ga0207664_10760462	Ga0207664_107604621	148
27	3300026088	Ga0207641_10069627	Ga0207641_100696272	148
28	3300028380	Ga0268265_10438328	Ga0268265_104383282	148
29	3300031548	Ga0307408_100454200	Ga0307408_1004542002	148
30	3300031665	Ga0316575_10091489	Ga0316575_100914892	148
31	3300031731	Ga0307405_11201408	Ga0307405_112014081	148
32	3300046455	Ga0495603_0095455	Ga0495603_0095455_34_489	148
33	3300046455	Ga0495603_0200486	Ga0495603_0200486_68_523	148
34	3300046459	Ga0495629_0007035	Ga0495629_0007035_1232_1690	148
35	3300046463	Ga0495653_0038106	Ga0495653_0038106_2635_3090	148
36	3300046472	Ga0495580_0106857	Ga0495580_0106857_191_646	148
37	3300046472	Ga0495580_0268383	Ga0495580_0268383_514_969	148
38	3300046473	Ga0495582_0065835	Ga0495582_0065835_119_574	148
39	3300046473	Ga0495582_0084337	Ga0495582_0084337_282_737	148
40	3300046474	Ga0495605_0418185	Ga0495605_0418185_76_531	148
41	3300046491	Ga0495584_0002192	Ga0495584_0002192_4370_4825	148
42	3300046492	Ga0495585_0001087	Ga0495585_0001087_13312_13776	148
43	3300046492	Ga0495585_0040774	Ga0495585_0040774_2072_2527	148
44	3300046492	Ga0495585_0049525	Ga0495585_0049525_696_1151	148
45	3300046492	Ga0495585_0103548	Ga0495585_0103548_634_1089	148
46	3300046492	Ga0495585_0108181	Ga0495585_0108181_37_492	148
47	3300046499	Ga0495594_0000446	Ga0495594_0000446_13744_14199	148
48	3300046499	Ga0495594_0019777	Ga0495594_0019777_2568_3023	148
49	3300046499	Ga0495594_0082692	Ga0495594_0082692_974_1429	148
50	3300046499	Ga0495594_0170753	Ga0495594_0170753_491_946	148
51	3300046500	Ga0495596_0219022	Ga0495596_0219022_60_515	148
52	3300046501	Ga0495607_0255373	Ga0495607_0255373_216_671	148
53	3300046507	Ga0495606_0012998	Ga0495606_0012998_2344_2811	148
54	3300046507	Ga0495606_0050014	Ga0495606_0050014_415_870	148
55	3300046507	Ga0495606_0125780	Ga0495606_0125780_221_676	148
56	3300046517	Ga0495630_0991410	Ga0495630_0991410_89_544	148
57	3300046518	Ga0495631_0008257	Ga0495631_0008257_237_692	148
58	3300046518	Ga0495631_0010462	Ga0495631_0010462_1743_2198	148
59	3300046518	Ga0495631_0023168	Ga0495631_0023168_1747_2214	148
60	3300046525	Ga0495663_0214249	Ga0495663_0214249_125_592	148
61	3300046526	Ga0495666_0019971	Ga0495666_0019971_309_764	148
62	3300046526	Ga0495666_0025871	Ga0495666_0025871_431_886	148
63	3300046526	Ga0495666_0050977	Ga0495666_0050977_1049_1504	148
64	3300046526	Ga0495666_0114985	Ga0495666_0114985_307_762	148
65	3300046526	Ga0495666_0212040	Ga0495666_0212040_330_785	148
66	3300046528	Ga0495642_0012062	Ga0495642_0012062_787_1242	148
67	3300046528	Ga0495642_0073296	Ga0495642_0073296_646_1101	148
68	3300046528	Ga0495642_0158007	Ga0495642_0158007_169_624	148
69	3300046529	Ga0495652_0086509	Ga0495652_0086509_2096_2551	148
70	3300046531	Ga0495665_0006374	Ga0495665_0006374_4151_4606	148
71	3300046531	Ga0495665_0147969	Ga0495665_0147969_51_506	148
72	3300046531	Ga0495665_0175187	Ga0495665_0175187_439_894	148
73	3300046533	Ga0495640_0205412	Ga0495640_0205412_653_1108	148
74	3300046535	Ga0495586_0000889	Ga0495586_0000889_448_903	148
75	3300046536	Ga0495587_0587535	Ga0495587_0587535_120_575	148
76	3300046542	Ga0495597_0001100	Ga0495597_0001100_4480_4935	148
77	3300046542	Ga0495597_0008939	Ga0495597_0008939_287_742	148
78	3300046542	Ga0495597_0121810	Ga0495597_0121810_301_756	148
79	3300046557	Ga0495622_0018444	Ga0495622_0018444_2372_2827	148
80	3300046557	Ga0495622_0029152	Ga0495622_0029152_155_610	148
81	3300046557	Ga0495622_0135440	Ga0495622_0135440_473_928	148
82	3300046558	Ga0495633_0043247	Ga0495633_0043247_1195_1650	148
83	3300046558	Ga0495633_0058388	Ga0495633_0058388_889_1356	148
84	3300046558	Ga0495633_0160861	Ga0495633_0160861_292_756	148
85	3300046559	Ga0495667_0228999	Ga0495667_0228999_279_734	148
86	3300046616	Ga0495668_0044335	Ga0495668_0044335_1776_2231	148
87	3300046660	Ga0495625_0243682	Ga0495625_0243682_39_494	148
88	3300046665	Ga0495661_0034545	Ga0495661_0034545_1056_1511	148
89	3300046665	Ga0495661_0038608	Ga0495661_0038608_832_1299	148
90	3300046665	Ga0495661_0074555	Ga0495661_0074555_828_1283	148
91	3300046665	Ga0495661_0076130	Ga0495661_0076130_386_841	148
92	3300046674	Ga0495588_0043524	Ga0495588_0043524_33_488	148
93	3300046674	Ga0495588_0073123	Ga0495588_0073123_321_776	148
94	3300046674	Ga0495588_0100270	Ga0495588_0100270_948_1403	148
95	3300046674	Ga0495588_0100931	Ga0495588_0100931_270_725	148
96	3300046674	Ga0495588_0207184	Ga0495588_0207184_322_777	148
97	3300046674	Ga0495588_0267143	Ga0495588_0267143_107_562	148
98	3300046679	Ga0495623_0021479	Ga0495623_0021479_589_1044	148
99	3300046679	Ga0495623_0180117	Ga0495623_0180117_100_555	148
100	3300046679	Ga0495623_0491970	Ga0495623_0491970_77_544	148
101	3300046680	Ga0495646_0342637	Ga0495646_0342637_311_766	148
102	3300046684	Ga0495669_0565556	Ga0495669_0565556_52_507	148
103	3300046689	Ga0495613_0111843	Ga0495613_0111843_1114_1569	148
104	3300046689	Ga0495613_0266932	Ga0495613_0266932_538_993	148
105	3300046690	Ga0495624_0067585	Ga0495624_0067585_1439_1894	148
106	3300046690	Ga0495624_0085977	Ga0495624_0085977_1212_1667	148
107	3300046691	Ga0495670_0005381	Ga0495670_0005381_1010_1465	148
108	3300046692	Ga0495671_0031779	Ga0495671_0031779_1342_1797	148
109	3300046692	Ga0495671_0034093	Ga0495671_0034093_273_728	148
110	3300046794	Ga0495589_0054320	Ga0495589_0054320_1081_1536	148
111	3300047315	Ga0495581_0088730	Ga0495581_0088730_648_1103	148
112	3300047315	Ga0495581_0091448	Ga0495581_0091448_1011_1466	148
113	3300047315	Ga0495581_0375052	Ga0495581_0375052_149_604	148
114	3300047317	Ga0495604_0162366	Ga0495604_0162366_905_1360	148
115	3300047317	Ga0495604_0196659	Ga0495604_0196659_393_848	148
116	3300047317	Ga0495604_0446402	Ga0495604_0446402_120_575	148
117	3300047318	Ga0495636_0004347	Ga0495636_0004347_4181_4636	148
118	3300047319	Ga0495674_0002353	Ga0495674_0002353_10691_11149	148
119	3300047321	Ga0495676_0669193	Ga0495676_0669193_205_660	148
120	3300047323	Ga0495683_0157369	Ga0495683_0157369_10_465	148
121	3300047323	Ga0495683_0277077	Ga0495683_0277077_174_629	148
122	3300047444	Ga0495675_0018492	Ga0495675_0018492_3291_3746	148
123	3300047444	Ga0495675_0213143	Ga0495675_0213143_494_949	148
124	3300047445	Ga0495677_0020917	Ga0495677_0020917_1784_2239	148
125	3300047445	Ga0495677_0060663	Ga0495677_0060663_257_712	148
126	3300047470	Ga0495681_0033148	Ga0495681_0033148_133_588	148
127	3300047673	Ga0495593_0018300	Ga0495593_0018300_3069_3524	148
128	3300047673	Ga0495593_0046284	Ga0495593_0046284_1279_1734	148
129	3300048091	Ga0495626_0001520	Ga0495626_0001520_1032_1487	148
130	3300048091	Ga0495626_0417741	Ga0495626_0417741_35_502	148
131	3300048918	Ga0496115_0313072	Ga0496115_0313072_26_481	148
132	3300048918	Ga0496115_0403280	Ga0496115_0403280_294_749	148
133	3300049578	Ga0501042_0798585	Ga0501042_0798585_85_546	148
134	3300049581	Ga0501047_0475476	Ga0501047_0475476_89_562	148
135	3300049581	Ga0501047_0505394	Ga0501047_0505394_548_1000	148
136	3300049583	Ga0501067_0542160	Ga0501067_0542160_90_563	148
137	3300054114	Ga0501084_0045302	Ga0501084_0045302_2955_3428	148
138	3300037068	Ga0373925_1583960	Ga0373925_1583960_68_520	149
139	3300009176	Ga0105242_10235648	Ga0105242_102356481	150
140	3300025934	Ga0207686_10154187	Ga0207686_101541871	150
141	3300035242	Ga0373962_0297167	Ga0373962_0297167_48_500	150
142	3300049572	Ga0501036_0167926	Ga0501036_0167926_860_1351	150
143	3300049591	Ga0501075_1324255	Ga0501075_1324255_12_482	150
144	3300049592	Ga0501076_0620652	Ga0501076_0620652_197_673	151
145	3300006871	Ga0075434_100412640	Ga0075434_1004126403	154
146	3300046459	Ga0495629_0013979	Ga0495629_0013979_2104_2658	154
147	3300046674	Ga0495588_0317677	Ga0495588_0317677_244_798	154
148	3300050515	nmdc:mga0a205_736180_c1	nmdc:mga0a205_736180_c1_155_622	154
149	iso_pu_bacteria	2989392574	2989394564	155
150	3300005545	Ga0070695_100151849	Ga0070695_1001518492	156
151	3300025912	Ga0207707_10017308	Ga0207707_100173085	156
152	3300025921	Ga0207652_10235879	Ga0207652_102358792	156
153	3300005440	Ga0070705_100444445	Ga0070705_1004444452	157
154	3300005444	Ga0070694_100436694	Ga0070694_1004366942	157
155	3300005530	Ga0070679_100137758	Ga0070679_1001377581	157
156	3300005536	Ga0070697_100811696	Ga0070697_1008116962	157
157	3300005546	Ga0070696_100000482	Ga0070696_1000004825	157
158	3300025921	Ga0207652_10102958	Ga0207652_101029585	157
159	3300028800	Ga0265338_10528189	Ga0265338_105281892	157
160	3300044683	Ga0466965_0500776	Ga0466965_0500776_106_591	157
161	3300005290	Ga0065712_10001265	Ga0065712_100012654	158
162	3300005290	Ga0065712_10017350	Ga0065712_100173502	158
163	3300005293	Ga0065715_10017119	Ga0065715_100171192	158
164	3300005293	Ga0065715_10128278	Ga0065715_101282782	158
165	3300005327	Ga0070658_10042929	Ga0070658_100429293	158
166	3300005330	Ga0070690_100020607	Ga0070690_1000206073	158
167	3300005330	Ga0070690_100021553	Ga0070690_1000215533	158
168	3300005330	Ga0070690_100474764	Ga0070690_1004747642	158
169	3300005331	Ga0070670_100001720	Ga0070670_10000172016	158
170	3300005333	Ga0070677_10013541	Ga0070677_100135415	158
171	3300005334	Ga0068869_100040509	Ga0068869_1000405091	158
172	3300005334	Ga0068869_100387661	Ga0068869_1003876612	158
173	3300005335	Ga0070666_10000383	Ga0070666_1000038325	158
174	3300005335	Ga0070666_10065461	Ga0070666_100654612	158
175	3300005336	Ga0070680_100051739	Ga0070680_1000517391	158
176	3300005336	Ga0070680_101242051	Ga0070680_1012420511	158
177	3300005337	Ga0070682_100026790	Ga0070682_1000267903	158
178	3300005337	Ga0070682_100143120	Ga0070682_1001431202	158
179	3300005337	Ga0070682_100700977	Ga0070682_1007009771	158
180	3300005338	Ga0068868_100065721	Ga0068868_1000657212	158
181	3300005338	Ga0068868_100101210	Ga0068868_1001012104	158
182	3300005339	Ga0070660_100552828	Ga0070660_1005528282	158
183	3300005340	Ga0070689_100218984	Ga0070689_1002189842	158
184	3300005340	Ga0070689_100771589	Ga0070689_1007715892	158
185	3300005341	Ga0070691_10051067	Ga0070691_100510672	158
186	3300005341	Ga0070691_10096315	Ga0070691_100963151	158
187	3300005343	Ga0070687_100007751	Ga0070687_1000077517	158
188	3300005343	Ga0070687_100184501	Ga0070687_1001845011	158
189	3300005344	Ga0070661_100024766	Ga0070661_1000247664	158
190	3300005345	Ga0070692_10022211	Ga0070692_100222114	158
191	3300005345	Ga0070692_10033898	Ga0070692_100338982	158
192	3300005347	Ga0070668_100001273	Ga0070668_1000012736	158
193	3300005347	Ga0070668_100149812	Ga0070668_1001498122	158
194	3300005353	Ga0070669_100002155	Ga0070669_10000215518	158
195	3300005353	Ga0070669_100572397	Ga0070669_1005723972	158
196	3300005354	Ga0070675_100009479	Ga0070675_10000947912	158
197	3300005354	Ga0070675_100139636	Ga0070675_1001396363	158
198	3300005355	Ga0070671_100328031	Ga0070671_1003280312	158
199	3300005356	Ga0070674_100005133	Ga0070674_1000051332	158
200	3300005356	Ga0070674_100137589	Ga0070674_1001375891	158
201	3300005364	Ga0070673_100647264	Ga0070673_1006472641	158
202	3300005365	Ga0070688_100044666	Ga0070688_1000446662	158
203	3300005365	Ga0070688_100513091	Ga0070688_1005130911	158
204	3300005366	Ga0070659_100159098	Ga0070659_1001590984	158
205	3300005366	Ga0070659_100223678	Ga0070659_1002236782	158
206	3300005367	Ga0070667_100002701	Ga0070667_1000027012	158
207	3300005367	Ga0070667_100016880	Ga0070667_1000168805	158
208	3300005434	Ga0070709_10987174	Ga0070709_109871741	158
209	3300005438	Ga0070701_10000729	Ga0070701_100007291	158
210	3300005440	Ga0070705_100160390	Ga0070705_1001603902	158
211	3300005440	Ga0070705_100378162	Ga0070705_1003781622	158
212	3300005441	Ga0070700_100012321	Ga0070700_1000123213	158
213	3300005444	Ga0070694_100041668	Ga0070694_1000416684	158
214	3300005456	Ga0070678_100043163	Ga0070678_1000431633	158
215	3300005456	Ga0070678_100312400	Ga0070678_1003124003	158
216	3300005456	Ga0070678_100616939	Ga0070678_1006169391	158
217	3300005457	Ga0070662_100002002	Ga0070662_10000200213	158
218	3300005457	Ga0070662_100416034	Ga0070662_1004160341	158
219	3300005457	Ga0070662_100422071	Ga0070662_1004220711	158
220	3300005458	Ga0070681_10024607	Ga0070681_100246073	158
221	3300005458	Ga0070681_10038386	Ga0070681_100383864	158
222	3300005459	Ga0068867_100006666	Ga0068867_10000666612	158
223	3300005459	Ga0068867_100014633	Ga0068867_10001463310	158
224	3300005459	Ga0068867_100018225	Ga0068867_1000182254	158
225	3300005459	Ga0068867_101324801	Ga0068867_1013248011	158
226	3300005466	Ga0070685_10024815	Ga0070685_100248155	158
227	3300005530	Ga0070679_100038000	Ga0070679_1000380004	158
228	3300005530	Ga0070679_100620805	Ga0070679_1006208052	158
229	3300005530	Ga0070679_100691587	Ga0070679_1006915871	158
230	3300005535	Ga0070684_100037898	Ga0070684_1000378984	158
231	3300005535	Ga0070684_100343819	Ga0070684_1003438192	158
232	3300005539	Ga0068853_100002638	Ga0068853_10000263811	158
233	3300005539	Ga0068853_100145114	Ga0068853_1001451142	158
234	3300005539	Ga0068853_100615410	Ga0068853_1006154102	158
235	3300005543	Ga0070672_100010069	Ga0070672_1000100697	158
236	3300005543	Ga0070672_100033683	Ga0070672_1000336834	158
237	3300005543	Ga0070672_100877657	Ga0070672_1008776572	158
238	3300005544	Ga0070686_100004547	Ga0070686_1000045472	158
239	3300005544	Ga0070686_100032699	Ga0070686_1000326994	158
240	3300005544	Ga0070686_100151536	Ga0070686_1001515362	158
241	3300005545	Ga0070695_100118833	Ga0070695_1001188332	158
242	3300005545	Ga0070695_100137813	Ga0070695_1001378132	158
243	3300005545	Ga0070695_100177206	Ga0070695_1001772063	158
244	3300005545	Ga0070695_100327365	Ga0070695_1003273652	158
245	3300005546	Ga0070696_100018042	Ga0070696_1000180425	158
246	3300005547	Ga0070693_100057320	Ga0070693_1000573202	158
247	3300005548	Ga0070665_100206133	Ga0070665_1002061331	158
248	3300005548	Ga0070665_100938426	Ga0070665_1009384262	158
249	3300005549	Ga0070704_100042459	Ga0070704_1000424593	158
250	3300005563	Ga0068855_100097295	Ga0068855_1000972953	158
251	3300005563	Ga0068855_100313129	Ga0068855_1003131293	158
252	3300005563	Ga0068855_100560177	Ga0068855_1005601772	158
253	3300005577	Ga0068857_100803825	Ga0068857_1008038252	158
254	3300005577	Ga0068857_100991965	Ga0068857_1009919651	158
255	3300005578	Ga0068854_100021625	Ga0068854_1000216253	158
256	3300005614	Ga0068856_100053611	Ga0068856_1000536114	158
257	3300005614	Ga0068856_100160240	Ga0068856_1001602404	158
258	3300005615	Ga0070702_100033171	Ga0070702_1000331712	158
259	3300005615	Ga0070702_100080916	Ga0070702_1000809162	158
260	3300005615	Ga0070702_100203538	Ga0070702_1002035382	158
261	3300005616	Ga0068852_100022391	Ga0068852_1000223912	158
262	3300005616	Ga0068852_100348581	Ga0068852_1003485812	158
263	3300005617	Ga0068859_100151386	Ga0068859_1001513864	158
264	3300005617	Ga0068859_100232643	Ga0068859_1002326432	158
265	3300005617	Ga0068859_101165177	Ga0068859_1011651772	158
266	3300005617	Ga0068859_101763782	Ga0068859_1017637822	158
267	3300005617	Ga0068859_101809668	Ga0068859_1018096681	158
268	3300005618	Ga0068864_100029298	Ga0068864_1000292984	158
269	3300005718	Ga0068866_10186597	Ga0068866_101865972	158
270	3300005718	Ga0068866_10839420	Ga0068866_108394201	158
271	3300005719	Ga0068861_100001459	Ga0068861_1000014598	158
272	3300005719	Ga0068861_100205909	Ga0068861_1002059094	158
273	3300005719	Ga0068861_100618599	Ga0068861_1006185992	158
274	3300005834	Ga0068851_10359242	Ga0068851_103592422	158
275	3300005840	Ga0068870_10322138	Ga0068870_103221381	158
276	3300005841	Ga0068863_100001611	Ga0068863_10000161137	158
277	3300005841	Ga0068863_100254938	Ga0068863_1002549382	158
278	3300005842	Ga0068858_100132782	Ga0068858_1001327824	158
279	3300005842	Ga0068858_100301474	Ga0068858_1003014742	158
280	3300005843	Ga0068860_100003919	Ga0068860_1000039196	158
281	3300005843	Ga0068860_100045968	Ga0068860_1000459683	158
282	3300005843	Ga0068860_100091393	Ga0068860_1000913933	158
283	3300005843	Ga0068860_100774110	Ga0068860_1007741101	158
284	3300005843	Ga0068860_100858916	Ga0068860_1008589161	158
285	3300005844	Ga0068862_100002751	Ga0068862_1000027518	158
286	3300005844	Ga0068862_101657658	Ga0068862_1016576581	158
287	3300006058	Ga0075432_10074377	Ga0075432_100743771	158
288	3300006195	Ga0075366_10098218	Ga0075366_100982181	158
289	3300006237	Ga0097621_100008547	Ga0097621_10000854711	158
290	3300006237	Ga0097621_100124392	Ga0097621_1001243922	158
291	3300006237	Ga0097621_100171512	Ga0097621_1001715124	158
292	3300006358	Ga0068871_100090341	Ga0068871_1000903412	158
293	3300006847	Ga0075431_100738758	Ga0075431_1007387582	158
294	3300006852	Ga0075433_10253341	Ga0075433_102533412	158
295	3300006871	Ga0075434_100089159	Ga0075434_1000891593	158
296	3300006871	Ga0075434_100120923	Ga0075434_1001209232	158
297	3300006881	Ga0068865_100002156	Ga0068865_1000021566	158
298	3300006881	Ga0068865_100013692	Ga0068865_1000136922	158
299	3300006931	Ga0097620_100151376	Ga0097620_1001513762	158
300	3300006931	Ga0097620_100232633	Ga0097620_1002326332	158
301	3300006931	Ga0097620_101165151	Ga0097620_1011651512	158
302	3300006931	Ga0097620_101763699	Ga0097620_1017636992	158
303	3300006931	Ga0097620_101809747	Ga0097620_1018097471	158
304	3300007076	Ga0075435_100015626	Ga0075435_1000156264	158
305	3300007076	Ga0075435_100207893	Ga0075435_1002078931	158
306	3300009094	Ga0111539_10185281	Ga0111539_101852812	158
307	3300009098	Ga0105245_10009167	Ga0105245_1000916714	158
308	3300009098	Ga0105245_10090262	Ga0105245_100902623	158
309	3300009098	Ga0105245_10162056	Ga0105245_101620561	158
310	3300009148	Ga0105243_10036053	Ga0105243_100360534	158
311	3300009174	Ga0105241_10025981	Ga0105241_100259812	158
312	3300009176	Ga0105242_10003366	Ga0105242_1000336624	158
313	3300009176	Ga0105242_10018744	Ga0105242_100187442	158
314	3300009176	Ga0105242_10084989	Ga0105242_100849892	158
315	3300009177	Ga0105248_10002726	Ga0105248_1000272614	158
316	3300009177	Ga0105248_10034506	Ga0105248_100345063	158
317	3300009545	Ga0105237_10011858	Ga0105237_100118582	158
318	3300009545	Ga0105237_10315691	Ga0105237_103156912	158
319	3300009545	Ga0105237_10633220	Ga0105237_106332201	158
320	3300009545	Ga0105237_12275368	Ga0105237_122753681	158
321	3300009551	Ga0105238_10081693	Ga0105238_100816932	158
322	3300009553	Ga0105249_10008131	Ga0105249_100081311	158
323	3300009553	Ga0105249_10355470	Ga0105249_103554702	158
324	3300009553	Ga0105249_10759651	Ga0105249_107596512	158
325	3300010375	Ga0105239_10293226	Ga0105239_102932263	158
326	3300011119	Ga0105246_10006942	Ga0105246_100069426	158
327	3300011119	Ga0105246_10641768	Ga0105246_106417682	158
328	3300013100	Ga0157373_10317752	Ga0157373_103177522	158
329	3300013102	Ga0157371_10048348	Ga0157371_100483482	158
330	3300013104	Ga0157370_10367882	Ga0157370_103678822	158
331	3300013104	Ga0157370_10478345	Ga0157370_104783451	158
332	3300013104	Ga0157370_10870963	Ga0157370_108709631	158
333	3300013105	Ga0157369_10235932	Ga0157369_102359322	158
334	3300013296	Ga0157374_10028221	Ga0157374_100282216	158
335	3300013296	Ga0157374_11947582	Ga0157374_119475821	158
336	3300013296	Ga0157374_12478328	Ga0157374_124783281	158
337	3300013297	Ga0157378_10019937	Ga0157378_100199377	158
338	3300013297	Ga0157378_10084677	Ga0157378_100846773	158
339	3300013297	Ga0157378_10087696	Ga0157378_100876966	158
340	3300013306	Ga0163162_10784105	Ga0163162_107841052	158
341	3300013307	Ga0157372_10318150	Ga0157372_103181502	158
342	3300013307	Ga0157372_10367407	Ga0157372_103674072	158
343	3300013307	Ga0157372_10712875	Ga0157372_107128752	158
344	3300013308	Ga0157375_10055929	Ga0157375_100559292	158
345	3300013308	Ga0157375_10266792	Ga0157375_102667923	158
346	3300013308	Ga0157375_10288901	Ga0157375_102889013	158
347	3300014325	Ga0163163_10087616	Ga0163163_100876162	158
348	3300014326	Ga0157380_10019963	Ga0157380_100199636	158
349	3300014497	Ga0182008_10822603	Ga0182008_108226031	158
350	3300014968	Ga0157379_10023479	Ga0157379_100234792	158
351	3300014968	Ga0157379_10345388	Ga0157379_103453881	158
352	3300014968	Ga0157379_10749166	Ga0157379_107491662	158
353	3300014969	Ga0157376_10015202	Ga0157376_100152022	158
354	3300014969	Ga0157376_10023205	Ga0157376_100232055	158
355	3300017792	Ga0163161_10000551	Ga0163161_1000055159	158
356	3300017792	Ga0163161_10555359	Ga0163161_105553592	158
357	3300025315	Ga0207697_10006297	Ga0207697_100062978	158
358	3300025315	Ga0207697_10013464	Ga0207697_100134643	158
359	3300025315	Ga0207697_10044777	Ga0207697_100447772	158
360	3300025893	Ga0207682_10014703	Ga0207682_100147033	158
361	3300025893	Ga0207682_10025015	Ga0207682_100250153	158
362	3300025899	Ga0207642_10061541	Ga0207642_100615412	158
363	3300025899	Ga0207642_10128840	Ga0207642_101288402	158
364	3300025901	Ga0207688_10060009	Ga0207688_100600094	158
365	3300025903	Ga0207680_10012679	Ga0207680_100126794	158
366	3300025907	Ga0207645_10000390	Ga0207645_1000039033	158
367	3300025907	Ga0207645_10001381	Ga0207645_1000138114	158
368	3300025908	Ga0207643_10278188	Ga0207643_102781882	158
369	3300025909	Ga0207705_10505149	Ga0207705_105051492	158
370	3300025911	Ga0207654_10087678	Ga0207654_100876782	158
371	3300025912	Ga0207707_10006501	Ga0207707_100065014	158
372	3300025912	Ga0207707_10048821	Ga0207707_100488212	158
373	3300025912	Ga0207707_10404723	Ga0207707_104047232	158
374	3300025914	Ga0207671_10009072	Ga0207671_100090722	158
375	3300025916	Ga0207663_10060702	Ga0207663_100607022	158
376	3300025917	Ga0207660_10078706	Ga0207660_100787063	158
377	3300025917	Ga0207660_11228251	Ga0207660_112282511	158
378	3300025918	Ga0207662_10029049	Ga0207662_100290491	158
379	3300025918	Ga0207662_10043410	Ga0207662_100434104	158
380	3300025919	Ga0207657_10043140	Ga0207657_100431403	158
381	3300025919	Ga0207657_10506942	Ga0207657_105069422	158
382	3300025920	Ga0207649_10035417	Ga0207649_100354175	158
383	3300025921	Ga0207652_10192188	Ga0207652_101921882	158
384	3300025921	Ga0207652_10901996	Ga0207652_109019961	158
385	3300025923	Ga0207681_10001344	Ga0207681_100013442	158
386	3300025923	Ga0207681_10033370	Ga0207681_100333703	158
387	3300025923	Ga0207681_10915872	Ga0207681_109158722	158
388	3300025924	Ga0207694_10045659	Ga0207694_100456592	158
389	3300025924	Ga0207694_10632268	Ga0207694_106322681	158
390	3300025925	Ga0207650_10000851	Ga0207650_100008515	158
391	3300025925	Ga0207650_10088507	Ga0207650_100885072	158
392	3300025925	Ga0207650_10406926	Ga0207650_104069262	158
393	3300025926	Ga0207659_10007942	Ga0207659_100079422	158
394	3300025927	Ga0207687_10035466	Ga0207687_100354665	158
395	3300025927	Ga0207687_10799513	Ga0207687_107995132	158
396	3300025931	Ga0207644_10125091	Ga0207644_101250912	158
397	3300025931	Ga0207644_10264149	Ga0207644_102641492	158
398	3300025932	Ga0207690_10005425	Ga0207690_100054252	158
399	3300025932	Ga0207690_10194121	Ga0207690_101941212	158
400	3300025932	Ga0207690_10533573	Ga0207690_105335731	158
401	3300025933	Ga0207706_10011456	Ga0207706_1001145611	158
402	3300025933	Ga0207706_10023930	Ga0207706_100239302	158
403	3300025933	Ga0207706_10411650	Ga0207706_104116501	158
404	3300025934	Ga0207686_10188870	Ga0207686_101888702	158
405	3300025934	Ga0207686_11164451	Ga0207686_111644511	158
406	3300025934	Ga0207686_11368315	Ga0207686_113683151	158
407	3300025935	Ga0207709_10014395	Ga0207709_100143953	158
408	3300025936	Ga0207670_10053235	Ga0207670_100532355	158
409	3300025936	Ga0207670_10421850	Ga0207670_104218501	158
410	3300025936	Ga0207670_10784473	Ga0207670_107844732	158
411	3300025937	Ga0207669_10005373	Ga0207669_1000537310	158
412	3300025938	Ga0207704_10113239	Ga0207704_101132393	158
413	3300025938	Ga0207704_10161038	Ga0207704_101610382	158
414	3300025940	Ga0207691_10001079	Ga0207691_100010798	158
415	3300025940	Ga0207691_10025737	Ga0207691_100257372	158
416	3300025940	Ga0207691_10180696	Ga0207691_101806962	158
417	3300025941	Ga0207711_10092397	Ga0207711_100923972	158
418	3300025942	Ga0207689_10008976	Ga0207689_1000897612	158
419	3300025942	Ga0207689_10486523	Ga0207689_104865232	158
420	3300025945	Ga0207679_10289203	Ga0207679_102892032	158
421	3300025945	Ga0207679_10311784	Ga0207679_103117842	158
422	3300025949	Ga0207667_10269537	Ga0207667_102695372	158
423	3300025960	Ga0207651_10695312	Ga0207651_106953122	158
424	3300025960	Ga0207651_10729875	Ga0207651_107298751	158
425	3300025960	Ga0207651_12087271	Ga0207651_120872711	158
426	3300025961	Ga0207712_10000987	Ga0207712_1000098733	158
427	3300025961	Ga0207712_10581419	Ga0207712_105814191	158
428	3300025972	Ga0207668_10039113	Ga0207668_100391136	158
429	3300025981	Ga0207640_11205068	Ga0207640_112050681	158
430	3300025986	Ga0207658_10051803	Ga0207658_100518032	158
431	3300026023	Ga0207677_10063329	Ga0207677_100633292	158
432	3300026023	Ga0207677_10080676	Ga0207677_100806762	158
433	3300026035	Ga0207703_10004869	Ga0207703_100048694	158
434	3300026035	Ga0207703_10083828	Ga0207703_100838284	158
435	3300026035	Ga0207703_10419348	Ga0207703_104193482	158
436	3300026041	Ga0207639_10004496	Ga0207639_100044967	158
437	3300026041	Ga0207639_10059042	Ga0207639_100590423	158
438	3300026041	Ga0207639_10280183	Ga0207639_102801831	158
439	3300026041	Ga0207639_11138380	Ga0207639_111383802	158
440	3300026067	Ga0207678_10095923	Ga0207678_100959234	158
441	3300026075	Ga0207708_10003954	Ga0207708_1000395418	158
442	3300026075	Ga0207708_10096225	Ga0207708_100962252	158
443	3300026078	Ga0207702_10057940	Ga0207702_100579404	158
444	3300026078	Ga0207702_10187291	Ga0207702_101872912	158
445	3300026078	Ga0207702_10194505	Ga0207702_101945052	158
446	3300026088	Ga0207641_10012611	Ga0207641_100126119	158
447	3300026088	Ga0207641_10039686	Ga0207641_100396861	158
448	3300026088	Ga0207641_10116627	Ga0207641_101166272	158
449	3300026088	Ga0207641_10566942	Ga0207641_105669422	158
450	3300026089	Ga0207648_10001878	Ga0207648_1000187824	158
451	3300026089	Ga0207648_10412635	Ga0207648_104126352	158
452	3300026095	Ga0207676_10103285	Ga0207676_101032852	158
453	3300026095	Ga0207676_11092288	Ga0207676_110922882	158
454	3300026118	Ga0207675_100002444	Ga0207675_10000244424	158
455	3300026118	Ga0207675_100005947	Ga0207675_10000594721	158
456	3300026118	Ga0207675_100227213	Ga0207675_1002272132	158
457	3300026121	Ga0207683_10000495	Ga0207683_100004956	158
458	3300026121	Ga0207683_10119216	Ga0207683_101192162	158
459	3300026121	Ga0207683_11580203	Ga0207683_115802031	158
460	3300026142	Ga0207698_10366421	Ga0207698_103664212	158
461	3300028379	Ga0268266_10657728	Ga0268266_106577282	158
462	3300028380	Ga0268265_10006346	Ga0268265_1000634614	158
463	3300028380	Ga0268265_10066470	Ga0268265_100664706	158
464	3300028381	Ga0268264_10035210	Ga0268264_100352104	158
465	3300028381	Ga0268264_10177650	Ga0268264_101776502	158
466	3300028381	Ga0268264_10216311	Ga0268264_102163112	158
467	3300028381	Ga0268264_10907781	Ga0268264_109077812	158
468	3300028381	Ga0268264_10976326	Ga0268264_109763261	158
469	3300031240	Ga0265320_10008138	Ga0265320_100081382	158
470	3300031251	Ga0265327_10308734	Ga0265327_103087341	158
471	3300031595	Ga0265313_10040469	Ga0265313_100404694	158
472	3300031711	Ga0265314_10007555	Ga0265314_100075552	158
473	3300031824	Ga0307413_10140573	Ga0307413_101405732	158
474	3300031911	Ga0307412_10143177	Ga0307412_101431772	158
475	3300032004	Ga0307414_11628705	Ga0307414_116287051	158
476	3300032005	Ga0307411_10025058	Ga0307411_100250584	158
477	3300035691	Ga0373931_0068282	Ga0373931_0068282_1022_1501	158
478	3300037471	Ga0395905_0259698	Ga0395905_0259698_821_1378	158
479	3300042005	Ga0439448_0063925	Ga0439448_0063925_161_640	158
480	3300044712	Ga0453684_1307333	Ga0453684_1307333_189_668	158
481	3300045051	Ga0451576_0072330	Ga0451576_0072330_1321_1800	158
482	3300045051	Ga0451576_1603675	Ga0451576_1603675_83_562	158
483	3300046539	Ga0495621_0024866	Ga0495621_0024866_480_1259	158
484	3300046557	Ga0495622_0081588	Ga0495622_0081588_31_513	158
485	3300046689	Ga0495613_0161488	Ga0495613_0161488_114_593	158
486	3300047322	Ga0495680_0786158	Ga0495680_0786158_73_552	158
487	3300048910	Ga0496107_0067620	Ga0496107_0067620_1105_1584	158
488	3300048911	Ga0496108_1096267	Ga0496108_1096267_32_511	158
489	3300048915	Ga0496112_0010461	Ga0496112_0010461_4481_4960	158
490	3300048916	Ga0496113_0415109	Ga0496113_0415109_346_825	158
491	3300048917	Ga0496114_0453238	Ga0496114_0453238_49_528	158
492	3300049572	Ga0501036_0607035	Ga0501036_0607035_225_704	158
493	3300049573	Ga0501037_0134609	Ga0501037_0134609_404_883	158
494	3300049575	Ga0501039_0461537	Ga0501039_0461537_299_778	158
495	3300049577	Ga0501041_0504950	Ga0501041_0504950_124_603	158
496	3300049579	Ga0501043_0502370	Ga0501043_0502370_248_727	158
497	3300049579	Ga0501043_0762040	Ga0501043_0762040_29_508	158
498	3300049581	Ga0501047_0021158	Ga0501047_0021158_633_1112	158
499	3300049582	Ga0501048_0236956	Ga0501048_0236956_742_1221	158
500	3300049583	Ga0501067_0028701	Ga0501067_0028701_1056_1535	158
501	3300049584	Ga0501068_0057955	Ga0501068_0057955_1694_2173	158
502	3300049585	Ga0501069_0001252	Ga0501069_0001252_9010_9489	158
503	3300049586	Ga0501070_0000975	Ga0501070_0000975_18535_19014	158
504	3300049587	Ga0501071_0051581	Ga0501071_0051581_537_1016	158
505	3300049588	Ga0501072_0108564	Ga0501072_0108564_1534_2013	158
506	3300049589	Ga0501073_0002142	Ga0501073_0002142_628_1107	158
507	3300049590	Ga0501074_0001937	Ga0501074_0001937_6822_7301	158
508	3300049591	Ga0501075_0020404	Ga0501075_0020404_1829_2308	158
509	3300049592	Ga0501076_0092730	Ga0501076_0092730_1491_1970	158
510	3300049741	Ga0501079_0035476	Ga0501079_0035476_1640_2119	158
511	3300049742	Ga0501080_0022112	Ga0501080_0022112_634_1113	158
512	3300049742	Ga0501080_0117900	Ga0501080_0117900_810_1289	158
513	3300049743	Ga0501081_0038131	Ga0501081_0038131_1435_1914	158
514	3300049744	Ga0501083_0002623	Ga0501083_0002623_6801_7280	158
515	3300049744	Ga0501083_0091513	Ga0501083_0091513_1441_1923	158
516	3300049823	Ga0501044_0480717	Ga0501044_0480717_26_505	158
517	3300050493	nmdc:mga0k408_345616_c1	nmdc:mga0k408_345616_c1_143_622	158
518	3300050512	nmdc:mga0n895_298960_c1	nmdc:mga0n895_298960_c1_859_1338	158
519	3300050512	nmdc:mga0n895_32645_c1	nmdc:mga0n895_32645_c1_4250_4729	158
520	3300050512	nmdc:mga0n895_332211_c1	nmdc:mga0n895_332211_c1_189_668	158
521	3300050513	nmdc:mga0rr50_161442_c1	nmdc:mga0rr50_161442_c1_1070_1549	158
522	3300050513	nmdc:mga0rr50_190866_c1	nmdc:mga0rr50_190866_c1_370_849	158
523	3300050513	nmdc:mga0rr50_72917_c1	nmdc:mga0rr50_72917_c1_497_976	158
524	3300050515	nmdc:mga0a205_671158_c1	nmdc:mga0a205_671158_c1_362_841	158
525	3300053117	Ga0500593_000245	Ga0500593_000245_8323_8826	158
526	3300060353	Ga0501082_0064720	Ga0501082_0064720_1920_2399	158
527	3300060353	Ga0501082_0120585	Ga0501082_0120585_1582_2061	158
528	3300061734	Ga0530510_0082233	Ga0530510_0082233_149_628	158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

118

0.97 PF00190

Cupin_1

Cupin

36

137

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3i7d-assembly1.cif.gz_A	crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution	0.9411	8	158
4rd7-assembly1.cif.gz_A-2	the crystal structure of a cupin 2 conserved barrel domain protein from salinispora arenicola cns-205	0.9044	46	127
3l2h-assembly1.cif.gz_D	crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution	0.8976	34	158
3i7d-assembly1.cif.gz_A	crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution	0.895	8	158
2d40-assembly1.cif.gz_D	crystal structure of z3393 from escherichia coli o157:h7	0.888	47	125

ID	Description	Score	Start	End	Superfamily
af_P24174_373_472_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9247	47	125	2.60.120.10
3i7dB00	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9236	8	158	2.60.120.10
3l2hD01	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9227	34	151	2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9045	47	127	2.60.120.10
af_Q03188_852_942_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.9006	47	126	2.60.120.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0P6V9N3-F1-model_v4	Cupin	0.9962	8	129	GO:0046872
AF-A0A1K2HRM8-F1-model_v4	Cupin domain-containing protein	0.9954	34	137	GO:0046872
AF-A0A2T6KQ38-F1-model_v4	Cupin domain-containing protein	0.9884	50	128	GO:0046872
AF-A0A4Q1TH26-F1-model_v4	deleted	0.9851	34	140
AF-A0A2D5HBH3-F1-model_v4	Transcriptional regulator	0.9834	39	136	GO:0046872

Feature Viewer

pLDDT	pTM	Quality
93.27	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459735

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07883

Cupin_2

Cupin domain

45

118

0.97

PF00190

Cupin_1

Cupin

36

137

0.73

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map