F459768

General Info

Members Datasets Scaffolds Average Seq Length
529 278 1058 434

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100002137|Ga0070674_1000021373
Length 496
Sequence MLYQLYESQRALLSPFSEFASASSKLYNHPLSPFTHTPLAHRVSAGLELMHRLAKEYEKPEFNIHSVRVDNVDVAVQQRIAMEKPFCRLLRFKRFTDDLPMLTKMKDQPTVLVVAPLSGHHSTLLRETVRELLRDHKVFVTDWTDARMVPLQAGPFHLKDYVAYVQEFIRHIGPDVNVISVCQPTVPVLAAVALMATNGEPTPLTMTMMGGPIDARKSPTAVNNLATNKSLGWFASNVIYRVPTNYPGAGRRVYPGFLQHSGFIAMNPDRHLKSHYDYFLNLVRGDGDNADFHREFYDEYNAVLDMPAEYYLDTIKVVFQDFALVNGTWDIDGQPVRPQDIKTTALLTIEGELDDISGAGQTKAAHALCTGVPASRQFHYDVAGAGHYGIFSGRRWREKVYPRMRDFIASHQADIREAKAVVRVKSAPNVKRKAKAPANHRALEMNGRVVAAAALNGAAGGKARRGANGIDHARAGQAADDAVRVGRTSARAAKRR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
184 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
185 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
231 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
240 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
241 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
242 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
245 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
246 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
263 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
264 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
265 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
266 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
267 2643221585 Pelomonas sp. Root662 Isolate Unclassified
268 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
269 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
270 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
271 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
272 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
273 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
274 2643221656 Pelomonas sp. Root405 Isolate Unclassified
275 2643221660 Methylibium sp. Root1272 Isolate Unclassified
276 2738541337 Pelomonas sp. BT06 Isolate Unclassified
277 2831864461 Roseateles noduli HZ7 Isolate Nodule
278 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 0.38
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.9
Nodule 0.95
Rhizoplane 3.59
Rhizosphere 67.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100002137 3300005356 Bacteria 10855
2 JGI25152J39213_1000849 3300002773 Bacteria 15165
3 JGI25153J46596_10002525 3300003215 Bacteria 10497
4 rootL2_10008667 3300003322 Bacteria 9480
5 Ga0055525_1000011 3300003759 Bacteria 503124
6 Ga0055526_1001549 3300003771 Bacteria 16265
7 Ga0055524_1000080 3300003775 Bacteria 120203
8 Ga0055524_1008226 3300003775 Bacteria 4352
9 Ga0055530_10007232 3300003791 Bacteria 4727
10 Ga0055540_1000002 3300003792 Bacteria 436954
11 Ga0055531_10000078 3300003794 Bacteria 105599
12 Ga0055531_10011352 3300003794 Bacteria 4310
13 Ga0055531_10011505 3300003794 Bacteria 4257
14 Ga0065165_1000613 3300005262 Bacteria 51836
15 Ga0065165_1000652 3300005262 Bacteria 50081
16 Ga0065165_1004114 3300005262 Bacteria 9364
17 Ga0065715_10106343 3300005293 Bacteria 2814
18 Ga0065707_10081939 3300005295 Bacteria 28637
19 Ga0070676_10003923 3300005328 Bacteria 7807
20 Ga0070676_10015489 3300005328 Bacteria 4206
21 Ga0070690_100005597 3300005330 Bacteria 7070
22 Ga0070670_100001125 3300005331 Bacteria 21269
23 Ga0070670_100050668 3300005331 Bacteria 3567
24 Ga0070670_100129638 3300005331 Bacteria 2177
25 Ga0070677_10001963 3300005333 Bacteria 6527
26 Ga0070677_10010175 3300005333 Bacteria 3211
27 Ga0068869_100001634 3300005334 Bacteria 13365
28 Ga0068869_100005104 3300005334 Bacteria 8234
29 Ga0068869_100011586 3300005334 Bacteria 5789
30 Ga0070666_10012274 3300005335 Bacteria 5398
31 Ga0070666_10034159 3300005335 Bacteria 3370
32 Ga0070680_100006075 3300005336 Bacteria 9146
33 Ga0068868_100003010 3300005338 Bacteria 11717
34 Ga0068868_100015324 3300005338 Bacteria 5667
35 Ga0068868_100036371 3300005338 Bacteria 3811
36 Ga0070660_100139159 3300005339 Bacteria 1946
37 Ga0070661_100052423 3300005344 Bacteria 2986
38 Ga0070668_100038093 3300005347 Bacteria 3673
39 Ga0070669_100001839 3300005353 Bacteria 15305
40 Ga0070669_100022631 3300005353 Bacteria 4494
41 Ga0070669_100043541 3300005353 Bacteria 3270
42 Ga0070675_100000735 3300005354 Bacteria 22835
43 Ga0070675_100001277 3300005354 Bacteria 18401
44 Ga0070675_100050288 3300005354 Bacteria 3422
45 Ga0070671_100061141 3300005355 Bacteria 3137
46 Ga0070671_100061288 3300005355 Bacteria 3133
47 Ga0070671_100092653 3300005355 Bacteria 2532
48 Ga0070674_100027566 3300005356 Bacteria 3724
49 Ga0070674_100066179 3300005356 Bacteria 2538
50 Ga0070674_100110614 3300005356 Bacteria 2016
51 Ga0070673_100001843 3300005364 Bacteria 12677
52 Ga0070673_100025175 3300005364 Bacteria 4375
53 Ga0070659_100001486 3300005366 Bacteria 16875
54 Ga0070667_100006821 3300005367 Bacteria 9485
55 Ga0070667_100007382 3300005367 Bacteria 9129
56 Ga0070667_100031167 3300005367 Bacteria 4445
57 Ga0070667_100045593 3300005367 Bacteria 3687
58 Ga0070663_100000131 3300005455 Bacteria 35664
59 Ga0070663_100039977 3300005455 Bacteria 3281
60 Ga0070663_100054226 3300005455 Bacteria 2865
61 Ga0070678_100002726 3300005456 Bacteria 9747
62 Ga0070678_100009020 3300005456 Bacteria 6009
63 Ga0070678_100011743 3300005456 Bacteria 5416
64 Ga0070678_100052302 3300005456 Bacteria 2965
65 Ga0070662_100003017 3300005457 Bacteria 10471
66 Ga0070662_100004955 3300005457 Bacteria 8457
67 Ga0070662_100007720 3300005457 Bacteria 6982
68 Ga0070662_100031821 3300005457 Bacteria 3705
69 Ga0070662_100131056 3300005457 Bacteria 1933
70 Ga0070662_100131400 3300005457 Bacteria 1931
71 Ga0068867_100000085 3300005459 Bacteria 58473
72 Ga0068867_100002069 3300005459 Bacteria 14069
73 Ga0068867_100002456 3300005459 Bacteria 13025
74 Ga0068867_100010602 3300005459 Bacteria 6501
75 Ga0068867_100017291 3300005459 Bacteria 5121
76 Ga0068867_100033462 3300005459 Bacteria 3723
77 Ga0068867_100036779 3300005459 Bacteria 3556
78 Ga0070679_100006077 3300005530 Bacteria 11233
79 Ga0070684_100012112 3300005535 Bacteria 6898
80 Ga0068853_100047115 3300005539 Bacteria 3699
81 Ga0070672_100012049 3300005543 Bacteria 6051
82 Ga0070672_100019914 3300005543 Bacteria 4882
83 Ga0070672_100021781 3300005543 Bacteria 4694
84 Ga0070672_100031886 3300005543 Bacteria 3971
85 Ga0070672_100076002 3300005543 Bacteria 2682
86 Ga0070665_100070051 3300005548 Bacteria 3513
87 Ga0070665_100137024 3300005548 Bacteria 2451
88 Ga0070665_100207776 3300005548 Bacteria 1958
89 Ga0070664_100002283 3300005564 Bacteria 15409
90 Ga0070664_100011471 3300005564 Bacteria 7193
91 Ga0070664_100034357 3300005564 Bacteria 4253
92 Ga0070664_100053655 3300005564 Bacteria 3418
93 Ga0070664_100250332 3300005564 Bacteria 1593
94 Ga0068856_100079423 3300005614 Bacteria 3253
95 Ga0068852_100024044 3300005616 Bacteria 4917
96 Ga0068852_100074839 3300005616 Bacteria 2984
97 Ga0068852_100150393 3300005616 Bacteria 2164
98 Ga0068859_100027187 3300005617 Bacteria 5740
99 Ga0068864_100004588 3300005618 Bacteria 11333
100 Ga0068864_100019471 3300005618 Bacteria 5675
101 Ga0068864_100087450 3300005618 Bacteria 2743
102 Ga0068864_100122424 3300005618 Bacteria 2327
103 Ga0068861_100000582 3300005719 Bacteria 21639
104 Ga0068861_100000677 3300005719 Bacteria 20324
105 Ga0068851_10075514 3300005834 Bacteria 1751
106 Ga0068858_100006635 3300005842 Bacteria 11254
107 Ga0068858_100045840 3300005842 Bacteria 4053
108 Ga0068860_100001910 3300005843 Bacteria 22116
109 Ga0068860_100015787 3300005843 Bacteria 7373
110 Ga0068860_100039151 3300005843 Bacteria 4535
111 Ga0068860_100042020 3300005843 Bacteria 4368
112 Ga0068860_100167938 3300005843 Bacteria 2119
113 Ga0068862_100096083 3300005844 Bacteria 2586
114 Ga0081455_10052449 3300005937 Bacteria 3491
115 Ga0075363_100005882 3300006048 Bacteria 5520
116 Ga0075363_100019158 3300006048 Bacteria 3418
117 Ga0075363_100044554 3300006048 Bacteria 2350
118 Ga0075362_10027147 3300006177 Bacteria 2449
119 Ga0075362_10029710 3300006177 Bacteria 2357
120 Ga0075367_10015770 3300006178 Bacteria 4115
121 Ga0075367_10025059 3300006178 Bacteria 3369
122 Ga0075369_10017275 3300006186 Bacteria 2921
123 Ga0075366_10000825 3300006195 Bacteria 14880
124 Ga0075366_10006399 3300006195 Bacteria 6453
125 Ga0075366_10009563 3300006195 Bacteria 5416
126 Ga0075366_10013243 3300006195 Bacteria 4691
127 Ga0075366_10014320 3300006195 Bacteria 4529
128 Ga0075366_10018641 3300006195 Bacteria 4009
129 Ga0075366_10039868 3300006195 Bacteria 2776
130 Ga0075366_10041887 3300006195 Bacteria 2711
131 Ga0075366_10045951 3300006195 Bacteria 2587
132 Ga0075366_10046313 3300006195 Bacteria 2577
133 Ga0075366_10055795 3300006195 Bacteria 2346
134 Ga0075366_10056956 3300006195 Bacteria 2322
135 Ga0075366_10109945 3300006195 Bacteria 1657
136 Ga0075370_10000124 3300006353 Bacteria 25565
137 Ga0075370_10001135 3300006353 Bacteria 11181
138 Ga0075370_10003217 3300006353 Bacteria 7726
139 Ga0075370_10007514 3300006353 Bacteria 5554
140 Ga0075370_10013959 3300006353 Bacteria 4276
141 Ga0075370_10016614 3300006353 Bacteria 3962
142 Ga0075370_10024208 3300006353 Bacteria 3352
143 Ga0075370_10045620 3300006353 Bacteria 2479
144 Ga0075370_10062634 3300006353 Bacteria 2119
145 Ga0068871_100037531 3300006358 Bacteria 3865
146 Ga0068865_100001694 3300006881 Bacteria 12918
147 Ga0068865_100021263 3300006881 Bacteria 4217
148 Ga0097620_100027186 3300006931 Bacteria 5740
149 Ga0099823_1013693 3300006944 Bacteria 8145
150 Ga0079104_1000017 3300006946 Bacteria 313784
151 Ga0105240_10040252 3300009093 Bacteria 5979
152 Ga0105243_10061870 3300009148 Bacteria 2995
153 Ga0105243_10135554 3300009148 Bacteria 2094
154 Ga0105248_10000445 3300009177 Bacteria 46980
155 Ga0105248_10055246 3300009177 Bacteria 4453
156 Ga0105248_10312223 3300009177 Bacteria 1771
157 Ga0105237_10000548 3300009545 Bacteria 52739
158 Ga0105238_10023940 3300009551 Bacteria 6225
159 Ga0105238_10082689 3300009551 Bacteria 3200
160 Ga0105249_10009940 3300009553 Bacteria 8344
161 Ga0105249_10034913 3300009553 Bacteria 4558
162 Ga0105239_10051481 3300010375 Bacteria 4514
163 Ga0105246_10167667 3300011119 Bacteria 1679
164 Ga0157319_1000006 3300012497 Bacteria 361506
165 Ga0157373_10059192 3300013100 Bacteria 2714
166 Ga0157374_10024816 3300013296 Bacteria 5377
167 Ga0157374_10040462 3300013296 Bacteria 4293
168 Ga0157374_10045052 3300013296 Bacteria 4081
169 Ga0157378_10000558 3300013297 Bacteria 35454
170 Ga0163162_10002211 3300013306 Bacteria 18267
171 Ga0163162_10034195 3300013306 Bacteria 5056
172 Ga0163162_10076955 3300013306 Bacteria 3399
173 Ga0157372_10013601 3300013307 Bacteria 8698
174 Ga0157375_10012805 3300013308 Bacteria 7448
175 Ga0157375_10049383 3300013308 Bacteria 4122
176 Ga0163163_10243368 3300014325 Bacteria 1849
177 Ga0157380_10037794 3300014326 Bacteria 3743
178 Ga0157380_10159830 3300014326 Bacteria 1957
179 Ga0157377_10000028 3300014745 Bacteria 134810
180 Ga0157379_10035744 3300014968 Bacteria 4429
181 Ga0157379_10054003 3300014968 Bacteria 3590
182 Ga0157379_10099189 3300014968 Bacteria 2615
183 Ga0157376_10014738 3300014969 Bacteria 5880
184 Ga0163161_10049300 3300017792 Bacteria 3043
185 Ga0213872_10000011 3300021361 Bacteria 194139
186 Ga0213872_10000013 3300021361 Bacteria 182866
187 Ga0213872_10000043 3300021361 Bacteria 117678
188 Ga0213872_10000172 3300021361 Bacteria 58334
189 Ga0209563_100005 3300025230 Bacteria 1774893
190 Ga0207425_1001503 3300025245 Bacteria 9645
191 Ga0209129_1000468 3300025258 Bacteria 29705
192 Ga0209673_1004857 3300025273 Bacteria 7022
193 Ga0209673_1006161 3300025273 Bacteria 5873
194 Ga0209564_1000003 3300025295 Bacteria 1585848
195 Ga0209564_1000046 3300025295 Bacteria 373787
196 Ga0209758_1000369 3300025297 Bacteria 79541
197 Ga0209758_1000709 3300025297 Bacteria 49238
198 Ga0209050_1000651 3300025298 Bacteria 53742
199 Ga0209050_1001823 3300025298 Bacteria 20745
200 Ga0209050_1002123 3300025298 Bacteria 18059
201 Ga0209256_1000011 3300025299 Bacteria 865309
202 Ga0209256_1001979 3300025299 Bacteria 18465
203 Ga0209256_1005905 3300025299 Bacteria 6770
204 Ga0209051_1000024 3300025303 Bacteria 437007
205 Ga0209051_1003875 3300025303 Bacteria 9554
206 Ga0209051_1004008 3300025303 Bacteria 9332
207 Ga0209051_1021773 3300025303 Bacteria 2717
208 Ga0209257_1000032 3300025304 Bacteria 680354
209 Ga0209257_1002360 3300025304 Bacteria 18953
210 Ga0209257_1009881 3300025304 Bacteria 4980
211 Ga0207697_10008278 3300025315 Bacteria 4566
212 Ga0207656_10015015 3300025321 Bacteria 2993
213 Ga0207656_10028511 3300025321 Bacteria 2292
214 Ga0207682_10005941 3300025893 Bacteria 4938
215 Ga0207682_10014037 3300025893 Bacteria 3121
216 Ga0207680_10070562 3300025903 Bacteria 2163
217 Ga0207645_10003308 3300025907 Bacteria 12298
218 Ga0207645_10003470 3300025907 Bacteria 11954
219 Ga0207645_10007379 3300025907 Bacteria 7776
220 Ga0207705_10057122 3300025909 Bacteria 2815
221 Ga0207684_10002530 3300025910 Bacteria 18373
222 Ga0207695_10058388 3300025913 Bacteria 4005
223 Ga0207671_10013052 3300025914 Bacteria 6642
224 Ga0207671_10072376 3300025914 Bacteria 2573
225 Ga0207671_10232853 3300025914 Bacteria 1445
226 Ga0207660_10138453 3300025917 Bacteria 1859
227 Ga0207657_10061574 3300025919 Bacteria 3217
228 Ga0207649_10000532 3300025920 Bacteria 26476
229 Ga0207649_10026350 3300025920 Bacteria 3400
230 Ga0207649_10163289 3300025920 Bacteria 1545
231 Ga0207652_10020904 3300025921 Bacteria 5396
232 Ga0207681_10012181 3300025923 Bacteria 5301
233 Ga0207681_10028238 3300025923 Bacteria 3633
234 Ga0207694_10026082 3300025924 Bacteria 4444
235 Ga0207650_10004032 3300025925 Bacteria 10044
236 Ga0207650_10009529 3300025925 Bacteria 6637
237 Ga0207650_10066335 3300025925 Bacteria 2706
238 Ga0207659_10002382 3300025926 Bacteria 11196
239 Ga0207644_10001974 3300025931 Bacteria 13260
240 Ga0207644_10041972 3300025931 Bacteria 3239
241 Ga0207644_10051954 3300025931 Bacteria 2944
242 Ga0207644_10096765 3300025931 Bacteria 2210
243 Ga0207690_10001103 3300025932 Bacteria 17214
244 Ga0207706_10001856 3300025933 Bacteria 20689
245 Ga0207706_10005010 3300025933 Bacteria 12370
246 Ga0207706_10005382 3300025933 Bacteria 11930
247 Ga0207706_10013469 3300025933 Bacteria 7431
248 Ga0207706_10043591 3300025933 Bacteria 3975
249 Ga0207706_10082354 3300025933 Bacteria 2828
250 Ga0207709_10000556 3300025935 Bacteria 31885
251 Ga0207709_10035232 3300025935 Bacteria 2957
252 Ga0207709_10041145 3300025935 Bacteria 2772
253 Ga0207670_10029647 3300025936 Bacteria 3488
254 Ga0207669_10002106 3300025937 Bacteria 8436
255 Ga0207669_10020351 3300025937 Bacteria 3478
256 Ga0207669_10029640 3300025937 Bacteria 3029
257 Ga0207704_10076082 3300025938 Bacteria 2149
258 Ga0207691_10004533 3300025940 Bacteria 13439
259 Ga0207691_10032636 3300025940 Bacteria 4854
260 Ga0207691_10036329 3300025940 Bacteria 4564
261 Ga0207691_10037652 3300025940 Bacteria 4479
262 Ga0207691_10042459 3300025940 Bacteria 4192
263 Ga0207691_10066379 3300025940 Bacteria 3264
264 Ga0207711_10054939 3300025941 Bacteria 3418
265 Ga0207711_10057147 3300025941 Bacteria 3354
266 Ga0207689_10003643 3300025942 Bacteria 14068
267 Ga0207689_10008045 3300025942 Bacteria 9202
268 Ga0207689_10014268 3300025942 Bacteria 6761
269 Ga0207689_10111830 3300025942 Bacteria 2245
270 Ga0207679_10000368 3300025945 Bacteria 32625
271 Ga0207667_10043068 3300025949 Bacteria 4792
272 Ga0207651_10011398 3300025960 Bacteria 4977
273 Ga0207651_10022117 3300025960 Bacteria 3880
274 Ga0207651_10030102 3300025960 Bacteria 3451
275 Ga0207712_10045536 3300025961 Bacteria 3038
276 Ga0207668_10022010 3300025972 Bacteria 4073
277 Ga0207640_10043990 3300025981 Bacteria 2858
278 Ga0207658_10002328 3300025986 Bacteria 13956
279 Ga0207658_10006006 3300025986 Bacteria 8293
280 Ga0207658_10176227 3300025986 Bacteria 1766
281 Ga0207677_10001461 3300026023 Bacteria 12514
282 Ga0207677_10036367 3300026023 Bacteria 3209
283 Ga0207703_10005642 3300026035 Bacteria 10052
284 Ga0207703_10021237 3300026035 Bacteria 5082
285 Ga0207678_10000500 3300026067 Bacteria 35694
286 Ga0207678_10041215 3300026067 Bacteria 4003
287 Ga0207678_10066410 3300026067 Bacteria 3098
288 Ga0207702_10102075 3300026078 Bacteria 2534
289 Ga0207641_10004758 3300026088 Bacteria 11701
290 Ga0207641_10006760 3300026088 Bacteria 9611
291 Ga0207641_10022505 3300026088 Bacteria 5186
292 Ga0207648_10000146 3300026089 Bacteria 70573
293 Ga0207648_10001822 3300026089 Bacteria 23296
294 Ga0207648_10003244 3300026089 Bacteria 17114
295 Ga0207648_10006202 3300026089 Bacteria 11909
296 Ga0207648_10007954 3300026089 Bacteria 10341
297 Ga0207648_10021691 3300026089 Bacteria 5771
298 Ga0207648_10038704 3300026089 Bacteria 4195
299 Ga0207648_10063471 3300026089 Bacteria 3219
300 Ga0207676_10001778 3300026095 Bacteria 15798
301 Ga0207676_10028868 3300026095 Bacteria 4149
302 Ga0207676_10043745 3300026095 Bacteria 3450
303 Ga0207674_10010215 3300026116 Bacteria 10663
304 Ga0207675_100000857 3300026118 Bacteria 30347
305 Ga0207675_100009279 3300026118 Bacteria 9227
306 Ga0207675_100024784 3300026118 Bacteria 5582
307 Ga0207675_100060605 3300026118 Bacteria 3533
308 Ga0207675_100280373 3300026118 Bacteria 1619
309 Ga0207683_10006427 3300026121 Bacteria 10062
310 Ga0207683_10022397 3300026121 Bacteria 5423
311 Ga0207683_10055659 3300026121 Bacteria 3469
312 Ga0207683_10096691 3300026121 Bacteria 2633
313 Ga0207683_10236997 3300026121 Bacteria 1664
314 Ga0207698_10181333 3300026142 Bacteria 1865
315 Ga0207698_10272564 3300026142 Bacteria 1561
316 Ga0207698_10293212 3300026142 Bacteria 1510
317 Ga0209281_1000042 3300027111 Bacteria 344748
318 Ga0209389_1041446 3300027296 Bacteria 3518
319 Ga0209981_1003831 3300027378 Bacteria 1959
320 Ga0209995_1009364 3300027471 Bacteria 1583
321 Ga0209968_1008527 3300027526 Bacteria 1563
322 Ga0209999_1008398 3300027543 Bacteria 1861
323 Ga0209966_1000001 3300027695 Bacteria 139125
324 Ga0209974_10005133 3300027876 Bacteria 4625
325 Ga0268266_10236896 3300028379 Bacteria 1683
326 Ga0268265_10014338 3300028380 Bacteria 5398
327 Ga0268265_10033535 3300028380 Bacteria 3734
328 Ga0268264_10004254 3300028381 Bacteria 12219
329 Ga0268264_10102230 3300028381 Bacteria 2494
330 Ga0307517_10000805 3300028786 Bacteria 53822
331 Ga0307515_10000020 3300028794 Bacteria 411735
332 Ga0307515_10000053 3300028794 Bacteria 266512
333 Ga0307515_10001342 3300028794 Bacteria 55698
334 Ga0307515_10002612 3300028794 Bacteria 38796
335 Ga0307515_10005265 3300028794 Bacteria 26299
336 Ga0307515_10009508 3300028794 Bacteria 18788
337 Ga0307515_10013171 3300028794 Bacteria 15473
338 Ga0307515_10031150 3300028794 Bacteria 8906
339 Ga0307515_10121128 3300028794 Bacteria 2962
340 Ga0307515_10156505 3300028794 Bacteria 2349
341 Ga0307512_10023178 3300030522 Bacteria 5552
342 Ga0307512_10053074 3300030522 Bacteria 3227
343 Ga0265328_10003934 3300031239 Bacteria 6533
344 Ga0265327_10000158 3300031251 Bacteria 145905
345 Ga0265327_10000355 3300031251 Bacteria 87181
346 Ga0265316_10000026 3300031344 Bacteria 165508
347 Ga0307513_10032738 3300031456 Bacteria 5856
348 Ga0307509_10002654 3300031507 Bacteria 28588
349 Ga0307509_10006788 3300031507 Bacteria 15234
350 Ga0307509_10010188 3300031507 Bacteria 11562
351 Ga0307509_10012003 3300031507 Bacteria 10403
352 Ga0307509_10023532 3300031507 Bacteria 6913
353 Ga0307408_100000150 3300031548 Bacteria 77682
354 Ga0307508_10000004 3300031616 Bacteria 287547
355 Ga0307508_10000078 3300031616 Bacteria 113416
356 Ga0307508_10003819 3300031616 Bacteria 15025
357 Ga0307514_10003397 3300031649 Bacteria 15360
358 Ga0307514_10041889 3300031649 Bacteria 3604
359 Ga0307514_10105240 3300031649 Bacteria 2016
360 Ga0307516_10000426 3300031730 Bacteria 55262
361 Ga0307516_10001023 3300031730 Bacteria 38802
362 Ga0307516_10007358 3300031730 Bacteria 12672
363 Ga0307410_10010512 3300031852 Bacteria 5248
364 Ga0307409_100000086 3300031995 Bacteria 33256
365 Ga0307416_100008651 3300032002 Bacteria 6589
366 Ga0307416_100415572 3300032002 Bacteria 1387
367 Ga0307414_10029622 3300032004 Bacteria 3565
368 Ga0307414_10159932 3300032004 Bacteria 1788
369 Ga0307411_10000910 3300032005 Bacteria 11236
370 Ga0307415_100000361 3300032126 Bacteria 19367
371 Ga0307507_10083368 3300033179 Bacteria 2796
372 Ga0307510_10028856 3300033180 Bacteria 6329
373 Ga0307510_10098931 3300033180 Bacteria 2718
374 Ga0373929_0010677 3300035085 Bacteria 1720
375 Ga0373932_0007674 3300035112 Bacteria 2574
376 Ga0373960_0002906 3300035121 Bacteria 3873
377 Ga0373931_0000200 3300035691 Bacteria 25528
378 Ga0373931_0006552 3300035691 Bacteria 5445
379 Ga0373937_0102105 3300036401 Bacteria 2662
380 Ga0373925_0002396 3300037068 Bacteria 15029
381 Ga0373925_0029184 3300037068 Bacteria 4046
382 Ga0395900_0000109 3300037418 Bacteria 146053
383 Ga0395898_0000868 3300037466 Bacteria 49428
384 Ga0395905_0000488 3300037471 Bacteria 54703
385 Ga0395905_0002212 3300037471 Bacteria 21946
386 Ga0395905_0004339 3300037471 Bacteria 14769
387 Ga0395905_0031352 3300037471 Bacteria 5004
388 Ga0395905_0067555 3300037471 Bacteria 3348
389 Ga0395905_0120402 3300037471 Bacteria 2467
390 Ga0395905_0158189 3300037471 Bacteria 2130
391 Ga0436361_0010737 3300039447 Bacteria 3021
392 Ga0436361_0167979 3300039447 Bacteria 86419
393 Ga0436361_0217332 3300039447 Bacteria 23737
394 Ga0436361_0236342 3300039447 Bacteria 16847
395 Ga0436361_0359670 3300039447 Bacteria 47250
396 Ga0451795_0104790 3300041456 Bacteria 1498
397 Ga0451802_0223057 3300041460 Bacteria 1412
398 Ga0451802_0427285 3300041460 Bacteria 1874
399 Ga0439449_0010362 3300042007 Bacteria 3519
400 Ga0450888_001209 3300042126 Bacteria 2467
401 Ga0450891_000220 3300042129 Bacteria 5753
402 Ga0450889_000187 3300042144 Bacteria 6760
403 Ga0439459_0001185 3300042438 Bacteria 3795
404 Ga0450893_0002556 3300042532 Bacteria 2842
405 Ga0451577_0000714 3300042876 Bacteria 51609
406 Ga0451577_0002068 3300042876 Bacteria 24786
407 Ga0466969_0000395 3300044656 Bacteria 23961
408 Ga0466972_0006534 3300044658 Bacteria 5858
409 Ga0453683_0099818 3300044673 Bacteria 1823
410 Ga0466966_0005482 3300044684 Bacteria 8338
411 Ga0466961_0058174 3300044693 Bacteria 2459
412 Ga0466963_0019955 3300044694 Bacteria 4211
413 Ga0466964_0006962 3300044706 Bacteria 4226
414 Ga0453684_0012158 3300044712 Bacteria 14280
415 Ga0453684_0024040 3300044712 Bacteria 8932
416 Ga0466971_0040111 3300044719 Bacteria 2102
417 Ga0466968_0028027 3300044735 Bacteria 2320
418 Ga0466970_0030505 3300044765 Bacteria 2843
419 Ga0466957_0016859 3300044842 Bacteria 4274
420 Ga0466960_0030629 3300044901 Bacteria 2477
421 Ga0466959_0012699 3300045049 Bacteria 6092
422 Ga0451576_0027382 3300045051 Bacteria 6122
423 Ga0451576_0095936 3300045051 Bacteria 3084
424 Ga0451576_0142279 3300045051 Bacteria 2501
425 Ga0466967_0067943 3300045976 Bacteria 3180
426 Ga0495592_0000028 3300046454 Bacteria 132590
427 Ga0495590_0003270 3300046457 Bacteria 6627
428 Ga0495629_0106894 3300046459 Bacteria 1952
429 Ga0495610_0062598 3300046512 Bacteria 1764
430 Ga0495632_0006432 3300046519 Bacteria 7554
431 Ga0495586_0063814 3300046535 Bacteria 2007
432 Ga0495597_0051548 3300046542 Bacteria 1814
433 Ga0495625_0010038 3300046660 Bacteria 7870
434 Ga0495625_0135339 3300046660 Bacteria 1666
435 Ga0495658_0021737 3300046683 Bacteria 3386
436 Ga0495658_0060734 3300046683 Bacteria 2168
437 Ga0495649_0015414 3300046694 Bacteria 4351
438 Ga0495687_000599 3300047443 Bacteria 42066
439 Ga0495687_010824 3300047443 Bacteria 4960
440 Ga0496102_0077689 3300048905 Bacteria 3055
441 Ga0496102_0106330 3300048905 Bacteria 2611
442 Ga0496104_0166058 3300048907 Bacteria 2117
443 Ga0496105_0066137 3300048908 Bacteria 2984
444 Ga0496105_0252901 3300048908 Bacteria 1427
445 Ga0496107_0027976 3300048910 Bacteria 4005
446 Ga0496108_0024028 3300048911 Bacteria 5018
447 Ga0496108_0029716 3300048911 Bacteria 4528
448 Ga0496109_0008335 3300048912 Bacteria 8802
449 Ga0496109_0116384 3300048912 Bacteria 2488
450 Ga0496110_0032221 3300048913 Bacteria 4525
451 Ga0496110_0238283 3300048913 Bacteria 1655
452 Ga0496111_0041819 3300048914 Bacteria 3290
453 Ga0496112_0018147 3300048915 Bacteria 6621
454 Ga0496113_0099134 3300048916 Bacteria 2256
455 Ga0496115_0011501 3300048918 Bacteria 6636
456 Ga0496124_0002660 3300048927 Bacteria 22924
457 Ga0496124_0186622 3300048927 Bacteria 1591
458 Ga0496125_0005283 3300048928 Bacteria 14458
459 Ga0501298_002673 3300049521 Bacteria 2717
460 Ga0501300_006322 3300049523 Bacteria 1745
461 Ga0501312_006826 3300049528 Bacteria 1440
462 Ga0501315_003622 3300049531 Bacteria 1558
463 Ga0501034_0072235 3300049571 Bacteria 3459
464 Ga0501043_0000023 3300049579 Bacteria 154331
465 Ga0501046_0000018 3300049580 Bacteria 220589
466 Ga0501047_0000020 3300049581 Bacteria 259377
467 Ga0501048_0001064 3300049582 Bacteria 20552
468 Ga0501198_000006 3300049649 Bacteria 129954
469 Ga0501211_001337 3300049658 Bacteria 2633
470 Ga0501222_000007 3300049662 Bacteria 126703
471 Ga0501222_000386 3300049662 Bacteria 6737
472 Ga0501227_004808 3300049665 Bacteria 2896
473 Ga0501258_002313 3300049687 Bacteria 1659
474 Ga0501221_002674 3300049704 Bacteria 2933
475 Ga0501229_001195 3300049706 Bacteria 3020
476 Ga0501272_000443 3300049769 Bacteria 3617
477 Ga0501280_006884 3300049776 Bacteria 1597
478 nmdc:mga03n38_25646_c1 3300050490 Bacteria 2424
479 nmdc:mga03n38_52504_c1 3300050490 Bacteria 1825
480 nmdc:mga0k408_10031_c1 3300050493 Bacteria 5115
481 nmdc:mga0k408_106292_c1 3300050493 Bacteria 1658
482 nmdc:mga0k408_1409_c1 3300050493 Bacteria 3503
483 nmdc:mga0k408_184_c1 3300050493 Bacteria 32850
484 nmdc:mga0k408_203_c2 3300050493 Bacteria 31214
485 nmdc:mga0k408_21076_c1 3300050493 Bacteria 3657
486 nmdc:mga0k408_2607_c1 3300050493 Bacteria 9575
487 nmdc:mga0k408_431_c1 3300050493 Bacteria 14862
488 nmdc:mga0k408_4791_c1 3300050493 Bacteria 7176
489 nmdc:mga06z11_91536_c1 3300050494 Bacteria 1652
490 nmdc:mga07m45_1438_c1 3300050496 Bacteria 10919
491 nmdc:mga07m45_1548_c1 3300050496 Bacteria 10583
492 nmdc:mga07m45_22183_c1 3300050496 Bacteria 3465
493 nmdc:mga07m45_222_c1 3300050496 Bacteria 22600
494 nmdc:mga07m45_3927_c2 3300050496 Bacteria 6505
495 nmdc:mga07m45_4604_c1 3300050496 Bacteria 6759
496 nmdc:mga07m45_48954_c1 3300050496 Bacteria 2378
497 nmdc:mga07m45_63_c1 3300050496 Bacteria 41859
498 nmdc:mga07m45_89_c1 3300050496 Bacteria 34943
499 Ga0500578_0002162 3300053086 Bacteria 17242
500 Ga0500644_0019251 3300053088 Bacteria 2012
501 Ga0500593_000236 3300053117 Bacteria 22651
502 Ga0500652_000307 3300053131 Bacteria 17714
503 Ga0500559_0000191 3300053136 Bacteria 49243
504 Ga0500568_0007902 3300053139 Bacteria 5177
505 Ga0500568_0028524 3300053139 Bacteria 2326
506 Ga0500619_000076 3300053154 Bacteria 27517
507 Ga0500622_0000160 3300053156 Bacteria 70774
508 Ga0500622_0001454 3300053156 Bacteria 18928
509 Ga0500622_0001554 3300053156 Bacteria 18138
510 Ga0500570_031871 3300053724 Bacteria 2841
511 Ga0500645_005872 3300053730 Bacteria 4454
512 Ga0590071_006056 3300059421 Bacteria 2890
513 2587730431 2585428057 Bacteria 6737412
514 2587733192 2585428058 Bacteria 6853932
515 2587755883 2585428062 Bacteria 6842168
516 2588294386 2588253510 Bacteria 6901809
517 2643745489 2643221544 Bacteria 5886209
518 2643935889 2643221585 Bacteria 5812563
519 2643968993 2643221592 Bacteria 6608788
520 2644144124 2643221625 Bacteria 6512927
521 2644221350 2643221639 Bacteria 6649903
522 2644257892 2643221646 Bacteria 6433402
523 2644273244 2643221648 Bacteria 6521465
524 2644304319 2643221654 Bacteria 5273570
525 2644317672 2643221656 Bacteria 5809961
526 2644341260 2643221660 Bacteria 4208257
527 2739057855 2738541337 Bacteria 6183410
528 2831870077 2831864461 Bacteria 6502356
529 2886852124 2886848708 Bacteria 5632523
530 Ga0070674_100002137
531 JGI25152J39213_1000849
532 JGI25153J46596_10002525
533 rootL2_10008667
534 Ga0055525_1000011
535 Ga0055526_1001549
536 Ga0055524_1000080
537 Ga0055524_1008226
538 Ga0055530_10007232
539 Ga0055540_1000002
540 Ga0055531_10000078
541 Ga0055531_10011352
542 Ga0055531_10011505
543 Ga0065165_1000613
544 Ga0065165_1000652
545 Ga0065165_1004114
546 Ga0065715_10106343
547 Ga0065707_10081939
548 Ga0070676_10003923
549 Ga0070676_10015489
550 Ga0070690_100005597
551 Ga0070670_100001125
552 Ga0070670_100050668
553 Ga0070670_100129638
554 Ga0070677_10001963
555 Ga0070677_10010175
556 Ga0068869_100001634
557 Ga0068869_100005104
558 Ga0068869_100011586
559 Ga0070666_10012274
560 Ga0070666_10034159
561 Ga0070680_100006075
562 Ga0068868_100003010
563 Ga0068868_100015324
564 Ga0068868_100036371
565 Ga0070660_100139159
566 Ga0070661_100052423
567 Ga0070668_100038093
568 Ga0070669_100001839
569 Ga0070669_100022631
570 Ga0070669_100043541
571 Ga0070675_100000735
572 Ga0070675_100001277
573 Ga0070675_100050288
574 Ga0070671_100061141
575 Ga0070671_100061288
576 Ga0070671_100092653
577 Ga0070674_100027566
578 Ga0070674_100066179
579 Ga0070674_100110614
580 Ga0070673_100001843
581 Ga0070673_100025175
582 Ga0070659_100001486
583 Ga0070667_100006821
584 Ga0070667_100007382
585 Ga0070667_100031167
586 Ga0070667_100045593
587 Ga0070663_100000131
588 Ga0070663_100039977
589 Ga0070663_100054226
590 Ga0070678_100002726
591 Ga0070678_100009020
592 Ga0070678_100011743
593 Ga0070678_100052302
594 Ga0070662_100003017
595 Ga0070662_100004955
596 Ga0070662_100007720
597 Ga0070662_100031821
598 Ga0070662_100131056
599 Ga0070662_100131400
600 Ga0068867_100000085
601 Ga0068867_100002069
602 Ga0068867_100002456
603 Ga0068867_100010602
604 Ga0068867_100017291
605 Ga0068867_100033462
606 Ga0068867_100036779
607 Ga0070679_100006077
608 Ga0070684_100012112
609 Ga0068853_100047115
610 Ga0070672_100012049
611 Ga0070672_100019914
612 Ga0070672_100021781
613 Ga0070672_100031886
614 Ga0070672_100076002
615 Ga0070665_100070051
616 Ga0070665_100137024
617 Ga0070665_100207776
618 Ga0070664_100002283
619 Ga0070664_100011471
620 Ga0070664_100034357
621 Ga0070664_100053655
622 Ga0070664_100250332
623 Ga0068856_100079423
624 Ga0068852_100024044
625 Ga0068852_100074839
626 Ga0068852_100150393
627 Ga0068859_100027187
628 Ga0068864_100004588
629 Ga0068864_100019471
630 Ga0068864_100087450
631 Ga0068864_100122424
632 Ga0068861_100000582
633 Ga0068861_100000677
634 Ga0068851_10075514
635 Ga0068858_100006635
636 Ga0068858_100045840
637 Ga0068860_100001910
638 Ga0068860_100015787
639 Ga0068860_100039151
640 Ga0068860_100042020
641 Ga0068860_100167938
642 Ga0068862_100096083
643 Ga0081455_10052449
644 Ga0075363_100005882
645 Ga0075363_100019158
646 Ga0075363_100044554
647 Ga0075362_10027147
648 Ga0075362_10029710
649 Ga0075367_10015770
650 Ga0075367_10025059
651 Ga0075369_10017275
652 Ga0075366_10000825
653 Ga0075366_10006399
654 Ga0075366_10009563
655 Ga0075366_10013243
656 Ga0075366_10014320
657 Ga0075366_10018641
658 Ga0075366_10039868
659 Ga0075366_10041887
660 Ga0075366_10045951
661 Ga0075366_10046313
662 Ga0075366_10055795
663 Ga0075366_10056956
664 Ga0075366_10109945
665 Ga0075370_10000124
666 Ga0075370_10001135
667 Ga0075370_10003217
668 Ga0075370_10007514
669 Ga0075370_10013959
670 Ga0075370_10016614
671 Ga0075370_10024208
672 Ga0075370_10045620
673 Ga0075370_10062634
674 Ga0068871_100037531
675 Ga0068865_100001694
676 Ga0068865_100021263
677 Ga0097620_100027186
678 Ga0099823_1013693
679 Ga0079104_1000017
680 Ga0105240_10040252
681 Ga0105243_10061870
682 Ga0105243_10135554
683 Ga0105248_10000445
684 Ga0105248_10055246
685 Ga0105248_10312223
686 Ga0105237_10000548
687 Ga0105238_10023940
688 Ga0105238_10082689
689 Ga0105249_10009940
690 Ga0105249_10034913
691 Ga0105239_10051481
692 Ga0105246_10167667
693 Ga0157319_1000006
694 Ga0157373_10059192
695 Ga0157374_10024816
696 Ga0157374_10040462
697 Ga0157374_10045052
698 Ga0157378_10000558
699 Ga0163162_10002211
700 Ga0163162_10034195
701 Ga0163162_10076955
702 Ga0157372_10013601
703 Ga0157375_10012805
704 Ga0157375_10049383
705 Ga0163163_10243368
706 Ga0157380_10037794
707 Ga0157380_10159830
708 Ga0157377_10000028
709 Ga0157379_10035744
710 Ga0157379_10054003
711 Ga0157379_10099189
712 Ga0157376_10014738
713 Ga0163161_10049300
714 Ga0213872_10000011
715 Ga0213872_10000013
716 Ga0213872_10000043
717 Ga0213872_10000172
718 Ga0209563_100005
719 Ga0207425_1001503
720 Ga0209129_1000468
721 Ga0209673_1004857
722 Ga0209673_1006161
723 Ga0209564_1000003
724 Ga0209564_1000046
725 Ga0209758_1000369
726 Ga0209758_1000709
727 Ga0209050_1000651
728 Ga0209050_1001823
729 Ga0209050_1002123
730 Ga0209256_1000011
731 Ga0209256_1001979
732 Ga0209256_1005905
733 Ga0209051_1000024
734 Ga0209051_1003875
735 Ga0209051_1004008
736 Ga0209051_1021773
737 Ga0209257_1000032
738 Ga0209257_1002360
739 Ga0209257_1009881
740 Ga0207697_10008278
741 Ga0207656_10015015
742 Ga0207656_10028511
743 Ga0207682_10005941
744 Ga0207682_10014037
745 Ga0207680_10070562
746 Ga0207645_10003308
747 Ga0207645_10003470
748 Ga0207645_10007379
749 Ga0207705_10057122
750 Ga0207684_10002530
751 Ga0207695_10058388
752 Ga0207671_10013052
753 Ga0207671_10072376
754 Ga0207671_10232853
755 Ga0207660_10138453
756 Ga0207657_10061574
757 Ga0207649_10000532
758 Ga0207649_10026350
759 Ga0207649_10163289
760 Ga0207652_10020904
761 Ga0207681_10012181
762 Ga0207681_10028238
763 Ga0207694_10026082
764 Ga0207650_10004032
765 Ga0207650_10009529
766 Ga0207650_10066335
767 Ga0207659_10002382
768 Ga0207644_10001974
769 Ga0207644_10041972
770 Ga0207644_10051954
771 Ga0207644_10096765
772 Ga0207690_10001103
773 Ga0207706_10001856
774 Ga0207706_10005010
775 Ga0207706_10005382
776 Ga0207706_10013469
777 Ga0207706_10043591
778 Ga0207706_10082354
779 Ga0207709_10000556
780 Ga0207709_10035232
781 Ga0207709_10041145
782 Ga0207670_10029647
783 Ga0207669_10002106
784 Ga0207669_10020351
785 Ga0207669_10029640
786 Ga0207704_10076082
787 Ga0207691_10004533
788 Ga0207691_10032636
789 Ga0207691_10036329
790 Ga0207691_10037652
791 Ga0207691_10042459
792 Ga0207691_10066379
793 Ga0207711_10054939
794 Ga0207711_10057147
795 Ga0207689_10003643
796 Ga0207689_10008045
797 Ga0207689_10014268
798 Ga0207689_10111830
799 Ga0207679_10000368
800 Ga0207667_10043068
801 Ga0207651_10011398
802 Ga0207651_10022117
803 Ga0207651_10030102
804 Ga0207712_10045536
805 Ga0207668_10022010
806 Ga0207640_10043990
807 Ga0207658_10002328
808 Ga0207658_10006006
809 Ga0207658_10176227
810 Ga0207677_10001461
811 Ga0207677_10036367
812 Ga0207703_10005642
813 Ga0207703_10021237
814 Ga0207678_10000500
815 Ga0207678_10041215
816 Ga0207678_10066410
817 Ga0207702_10102075
818 Ga0207641_10004758
819 Ga0207641_10006760
820 Ga0207641_10022505
821 Ga0207648_10000146
822 Ga0207648_10001822
823 Ga0207648_10003244
824 Ga0207648_10006202
825 Ga0207648_10007954
826 Ga0207648_10021691
827 Ga0207648_10038704
828 Ga0207648_10063471
829 Ga0207676_10001778
830 Ga0207676_10028868
831 Ga0207676_10043745
832 Ga0207674_10010215
833 Ga0207675_100000857
834 Ga0207675_100009279
835 Ga0207675_100024784
836 Ga0207675_100060605
837 Ga0207675_100280373
838 Ga0207683_10006427
839 Ga0207683_10022397
840 Ga0207683_10055659
841 Ga0207683_10096691
842 Ga0207683_10236997
843 Ga0207698_10181333
844 Ga0207698_10272564
845 Ga0207698_10293212
846 Ga0209281_1000042
847 Ga0209389_1041446
848 Ga0209981_1003831
849 Ga0209995_1009364
850 Ga0209968_1008527
851 Ga0209999_1008398
852 Ga0209966_1000001
853 Ga0209974_10005133
854 Ga0268266_10236896
855 Ga0268265_10014338
856 Ga0268265_10033535
857 Ga0268264_10004254
858 Ga0268264_10102230
859 Ga0307517_10000805
860 Ga0307515_10000020
861 Ga0307515_10000053
862 Ga0307515_10001342
863 Ga0307515_10002612
864 Ga0307515_10005265
865 Ga0307515_10009508
866 Ga0307515_10013171
867 Ga0307515_10031150
868 Ga0307515_10121128
869 Ga0307515_10156505
870 Ga0307512_10023178
871 Ga0307512_10053074
872 Ga0265328_10003934
873 Ga0265327_10000158
874 Ga0265327_10000355
875 Ga0265316_10000026
876 Ga0307513_10032738
877 Ga0307509_10002654
878 Ga0307509_10006788
879 Ga0307509_10010188
880 Ga0307509_10012003
881 Ga0307509_10023532
882 Ga0307408_100000150
883 Ga0307508_10000004
884 Ga0307508_10000078
885 Ga0307508_10003819
886 Ga0307514_10003397
887 Ga0307514_10041889
888 Ga0307514_10105240
889 Ga0307516_10000426
890 Ga0307516_10001023
891 Ga0307516_10007358
892 Ga0307410_10010512
893 Ga0307409_100000086
894 Ga0307416_100008651
895 Ga0307416_100415572
896 Ga0307414_10029622
897 Ga0307414_10159932
898 Ga0307411_10000910
899 Ga0307415_100000361
900 Ga0307507_10083368
901 Ga0307510_10028856
902 Ga0307510_10098931
903 Ga0373929_0010677
904 Ga0373932_0007674
905 Ga0373960_0002906
906 Ga0373931_0000200
907 Ga0373931_0006552
908 Ga0373937_0102105
909 Ga0373925_0002396
910 Ga0373925_0029184
911 Ga0395900_0000109
912 Ga0395898_0000868
913 Ga0395905_0000488
914 Ga0395905_0002212
915 Ga0395905_0004339
916 Ga0395905_0031352
917 Ga0395905_0067555
918 Ga0395905_0120402
919 Ga0395905_0158189
920 Ga0436361_0010737
921 Ga0436361_0167979
922 Ga0436361_0217332
923 Ga0436361_0236342
924 Ga0436361_0359670
925 Ga0451795_0104790
926 Ga0451802_0223057
927 Ga0451802_0427285
928 Ga0439449_0010362
929 Ga0450888_001209
930 Ga0450891_000220
931 Ga0450889_000187
932 Ga0439459_0001185
933 Ga0450893_0002556
934 Ga0451577_0000714
935 Ga0451577_0002068
936 Ga0466969_0000395
937 Ga0466972_0006534
938 Ga0453683_0099818
939 Ga0466966_0005482
940 Ga0466961_0058174
941 Ga0466963_0019955
942 Ga0466964_0006962
943 Ga0453684_0012158
944 Ga0453684_0024040
945 Ga0466971_0040111
946 Ga0466968_0028027
947 Ga0466970_0030505
948 Ga0466957_0016859
949 Ga0466960_0030629
950 Ga0466959_0012699
951 Ga0451576_0027382
952 Ga0451576_0095936
953 Ga0451576_0142279
954 Ga0466967_0067943
955 Ga0495592_0000028
956 Ga0495590_0003270
957 Ga0495629_0106894
958 Ga0495610_0062598
959 Ga0495632_0006432
960 Ga0495586_0063814
961 Ga0495597_0051548
962 Ga0495625_0010038
963 Ga0495625_0135339
964 Ga0495658_0021737
965 Ga0495658_0060734
966 Ga0495649_0015414
967 Ga0495687_000599
968 Ga0495687_010824
969 Ga0496102_0077689
970 Ga0496102_0106330
971 Ga0496104_0166058
972 Ga0496105_0066137
973 Ga0496105_0252901
974 Ga0496107_0027976
975 Ga0496108_0024028
976 Ga0496108_0029716
977 Ga0496109_0008335
978 Ga0496109_0116384
979 Ga0496110_0032221
980 Ga0496110_0238283
981 Ga0496111_0041819
982 Ga0496112_0018147
983 Ga0496113_0099134
984 Ga0496115_0011501
985 Ga0496124_0002660
986 Ga0496124_0186622
987 Ga0496125_0005283
988 Ga0501298_002673
989 Ga0501300_006322
990 Ga0501312_006826
991 Ga0501315_003622
992 Ga0501034_0072235
993 Ga0501043_0000023
994 Ga0501046_0000018
995 Ga0501047_0000020
996 Ga0501048_0001064
997 Ga0501198_000006
998 Ga0501211_001337
999 Ga0501222_000007
1000 Ga0501222_000386
1001 Ga0501227_004808
1002 Ga0501258_002313
1003 Ga0501221_002674
1004 Ga0501229_001195
1005 Ga0501272_000443
1006 Ga0501280_006884
1007 nmdc:mga03n38_25646_c1
1008 nmdc:mga03n38_52504_c1
1009 nmdc:mga0k408_10031_c1
1010 nmdc:mga0k408_106292_c1
1011 nmdc:mga0k408_1409_c1
1012 nmdc:mga0k408_184_c1
1013 nmdc:mga0k408_203_c2
1014 nmdc:mga0k408_21076_c1
1015 nmdc:mga0k408_2607_c1
1016 nmdc:mga0k408_431_c1
1017 nmdc:mga0k408_4791_c1
1018 nmdc:mga06z11_91536_c1
1019 nmdc:mga07m45_1438_c1
1020 nmdc:mga07m45_1548_c1
1021 nmdc:mga07m45_22183_c1
1022 nmdc:mga07m45_222_c1
1023 nmdc:mga07m45_3927_c2
1024 nmdc:mga07m45_4604_c1
1025 nmdc:mga07m45_48954_c1
1026 nmdc:mga07m45_63_c1
1027 nmdc:mga07m45_89_c1
1028 Ga0500578_0002162
1029 Ga0500644_0019251
1030 Ga0500593_000236
1031 Ga0500652_000307
1032 Ga0500559_0000191
1033 Ga0500568_0007902
1034 Ga0500568_0028524
1035 Ga0500619_000076
1036 Ga0500622_0000160
1037 Ga0500622_0001454
1038 Ga0500622_0001554
1039 Ga0500570_031871
1040 Ga0500645_005872
1041 Ga0590071_006056
1042 2587730431
1043 2587733192
1044 2587755883
1045 2588294386
1046 2643745489
1047 2643935889
1048 2643968993
1049 2644144124
1050 2644221350
1051 2644257892
1052 2644273244
1053 2644304319
1054 2644317672
1055 2644341260
1056 2739057855
1057 2831870077
1058 2886852124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06850

PHB_depo_C

PHB de-polymerase C-terminus

210

412

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xav-assembly1.cif.gz_B structure of phac from chromobacterium sp. usm2 0.7634 78 392
5xav-assembly1.cif.gz_A structure of phac from chromobacterium sp. usm2 0.7609 80 392
6k3c-assembly1.cif.gz_A crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a. 0.7516 78 388
6k3c-assembly1.cif.gz_B crystal structure of class i pha synthase (phac) mutant from chromobacterium sp. usm2 bound to coenzyme a. 0.6847 74 385
5jd6-assembly1.cif.gz_A crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco 0.6804 79 410
ID Description Score Start End Superfamily
af_Q23044_81_232_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7514 71 97 3.10.129.10
af_D4A328_4_184_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7455 344 412 3.40.50.1820
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7408 76 409 3.40.50.1820
af_O33185_49_361_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7343 76 409 3.40.50.1820
af_Q54PU4_55_149_2.60.40.290 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6959 74 96 2.60.40.290
ID Description Score Start End GO Terms
AF-A0A6S7B7R7-F1-model_v4 PHB de-polymerase C-terminal domain-containing protein 0.9852 306 411
AF-A0A2M7ELU1-F1-model_v4 Polyhydroxyalkanoate depolymerase 0.9757 329 411
AF-A0A522Y052-F1-model_v4 Polyhydroxyalkanoate depolymerase 0.9749 341 410
AF-A0A0S6X284-F1-model_v4 PHB de-polymerase C-terminal domain-containing protein 0.9733 306 411
AF-J7JCE8-F1-model_v4 deleted 0.9728 300 413

Map