F459786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 272 | 503 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100023920|Ga0068862_1000239202 |
| Length | 97 |
| Sequence | MRTLGQSEGHSTMALHFELVTPARLVRSEEVHMVVIPGTEGEMGVLQGHAPFMTTIKDGALKVYRSENGAPEEIQIQGGFAEVGANGLTVLAEHVEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 5 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 6 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 7 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 8 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 9 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 10 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 11 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 12 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 13 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 14 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 15 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 16 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 17 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 18 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 19 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 20 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 21 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 22 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 23 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 24 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 25 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 26 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 30 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 31 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 32 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 34 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 151 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 168 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 169 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 170 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 179 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 180 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 181 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 182 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 183 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 184 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 185 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 186 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 227 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 230 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 231 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 232 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 241 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 243 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 244 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 250 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 255 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 256 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 257 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 258 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 262 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 263 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 264 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 266 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 267 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.95 |
| Metatranscriptomes | 1.13 |
| Isolates | 4.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 9.07 |
| Nodule | 0.19 |
| Rhizoplane | 4.73 |
| Rhizosphere | 73.72 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 11.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1350033 | 2162886007 | Bacteria | 4823 |
| 2 | SwRhRL2b_contig_1774792 | 2162886007 | Bacteria | 15456 |
| 3 | SwRhRL2b_contig_2932459 | 2162886007 | Bacteria | 43460 |
| 4 | JGI24737J22298_10026213 | 3300001990 | Bacteria | 1841 |
| 5 | JGI24737J22298_10043129 | 3300001990 | Bacteria | 1381 |
| 6 | JGI24737J22298_10124574 | 3300001990 | Bacteria | 761 |
| 7 | JGI24735J21928_10031817 | 3300002067 | Bacteria | 1563 |
| 8 | JGI24735J21928_10033789 | 3300002067 | Bacteria | 1510 |
| 9 | JGI24735J21928_10039541 | 3300002067 | Bacteria | 1379 |
| 10 | JGI24735J21928_10051785 | 3300002067 | Bacteria | 1185 |
| 11 | JGI24735J21928_10063876 | 3300002067 | Bacteria | 1057 |
| 12 | JGI24034J26672_10109369 | 3300002239 | Bacteria | 527 |
| 13 | JGI24742J22300_10128557 | 3300002244 | Bacteria | 504 |
| 14 | JGI24751J29686_10100489 | 3300002459 | Bacteria | 604 |
| 15 | JGI25164J39214_1017967 | 3300002772 | Bacteria | 636 |
| 16 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 17 | Ga0055542_1005278 | 3300003762 | Bacteria | 2948 |
| 18 | Ga0055530_10022865 | 3300003791 | Bacteria | 1810 |
| 19 | Ga0065704_10000358 | 3300005289 | Bacteria | 27729 |
| 20 | Ga0065707_10085072 | 3300005295 | Bacteria | 6490 |
| 21 | Ga0070658_10003835 | 3300005327 | Bacteria | 12319 |
| 22 | Ga0070658_10095344 | 3300005327 | Bacteria | 2456 |
| 23 | Ga0070658_10203383 | 3300005327 | Bacteria | 1671 |
| 24 | Ga0070658_10666565 | 3300005327 | Bacteria | 903 |
| 25 | Ga0070670_100317010 | 3300005331 | Bacteria | 1365 |
| 26 | Ga0070670_101182245 | 3300005331 | Bacteria | 699 |
| 27 | Ga0070666_10938498 | 3300005335 | Bacteria | 640 |
| 28 | Ga0070682_100715296 | 3300005337 | Bacteria | 804 |
| 29 | Ga0070660_100066378 | 3300005339 | Bacteria | 2808 |
| 30 | Ga0070660_100100194 | 3300005339 | Bacteria | 2294 |
| 31 | Ga0070687_101176791 | 3300005343 | Bacteria | 564 |
| 32 | Ga0070661_100298807 | 3300005344 | Bacteria | 1253 |
| 33 | Ga0070661_101654082 | 3300005344 | Bacteria | 542 |
| 34 | Ga0070668_100062968 | 3300005347 | Bacteria | 2875 |
| 35 | Ga0070668_100167270 | 3300005347 | Bacteria | 1788 |
| 36 | Ga0070668_100243184 | 3300005347 | Bacteria | 1491 |
| 37 | Ga0070668_100756022 | 3300005347 | Bacteria | 861 |
| 38 | Ga0070669_100000200 | 3300005353 | Bacteria | 52177 |
| 39 | Ga0070669_100010144 | 3300005353 | Bacteria | 6698 |
| 40 | Ga0070669_100186315 | 3300005353 | Bacteria | 1626 |
| 41 | Ga0070669_100319735 | 3300005353 | Bacteria | 1253 |
| 42 | Ga0070669_100446953 | 3300005353 | Bacteria | 1065 |
| 43 | Ga0070671_100016012 | 3300005355 | Bacteria | 6058 |
| 44 | Ga0070671_100165508 | 3300005355 | Bacteria | 1870 |
| 45 | Ga0070671_100469955 | 3300005355 | Bacteria | 1080 |
| 46 | Ga0070674_100576472 | 3300005356 | Bacteria | 947 |
| 47 | Ga0070659_100423856 | 3300005366 | Bacteria | 1126 |
| 48 | Ga0070667_100000198 | 3300005367 | Bacteria | 71378 |
| 49 | Ga0070667_100000419 | 3300005367 | Bacteria | 45202 |
| 50 | Ga0070667_100003540 | 3300005367 | Bacteria | 13304 |
| 51 | Ga0070667_100103161 | 3300005367 | Bacteria | 2465 |
| 52 | Ga0070705_100470631 | 3300005440 | Bacteria | 947 |
| 53 | Ga0070705_101534203 | 3300005440 | Bacteria | 559 |
| 54 | Ga0070700_100495194 | 3300005441 | Bacteria | 939 |
| 55 | Ga0070663_100181650 | 3300005455 | Bacteria | 1632 |
| 56 | Ga0070663_100702455 | 3300005455 | Bacteria | 860 |
| 57 | Ga0070662_100493334 | 3300005457 | Bacteria | 1021 |
| 58 | Ga0068853_100000183 | 3300005539 | Bacteria | 44130 |
| 59 | Ga0068853_100014596 | 3300005539 | Bacteria | 6441 |
| 60 | Ga0068853_100047830 | 3300005539 | Bacteria | 3671 |
| 61 | Ga0068853_100084797 | 3300005539 | Bacteria | 2776 |
| 62 | Ga0068853_100123499 | 3300005539 | Bacteria | 2312 |
| 63 | Ga0068853_101254536 | 3300005539 | Bacteria | 716 |
| 64 | Ga0070672_100376552 | 3300005543 | Bacteria | 1214 |
| 65 | Ga0070672_101071455 | 3300005543 | Bacteria | 716 |
| 66 | Ga0070665_100000107 | 3300005548 | Bacteria | 156048 |
| 67 | Ga0070665_100012374 | 3300005548 | Bacteria | 8599 |
| 68 | Ga0070665_100121898 | 3300005548 | Bacteria | 2609 |
| 69 | Ga0070665_100201566 | 3300005548 | Bacteria | 1990 |
| 70 | Ga0068855_100002286 | 3300005563 | Bacteria | 23669 |
| 71 | Ga0068855_100293594 | 3300005563 | Bacteria | 1802 |
| 72 | Ga0068855_100304731 | 3300005563 | Bacteria | 1764 |
| 73 | Ga0068855_100499820 | 3300005563 | Bacteria | 1321 |
| 74 | Ga0068855_100625740 | 3300005563 | Bacteria | 1158 |
| 75 | Ga0068855_100818403 | 3300005563 | Bacteria | 989 |
| 76 | Ga0068855_101808922 | 3300005563 | Bacteria | 620 |
| 77 | Ga0068857_100074314 | 3300005577 | Bacteria | 3029 |
| 78 | Ga0068857_100182571 | 3300005577 | Bacteria | 1909 |
| 79 | Ga0068857_102096217 | 3300005577 | Bacteria | 555 |
| 80 | Ga0068854_100000359 | 3300005578 | Bacteria | 29216 |
| 81 | Ga0068854_100000809 | 3300005578 | Bacteria | 18649 |
| 82 | Ga0068854_100125271 | 3300005578 | Bacteria | 1955 |
| 83 | Ga0068856_100177822 | 3300005614 | Bacteria | 2140 |
| 84 | Ga0068856_100570811 | 3300005614 | Bacteria | 1152 |
| 85 | Ga0068852_100167061 | 3300005616 | Bacteria | 2059 |
| 86 | Ga0068852_100353287 | 3300005616 | Bacteria | 1436 |
| 87 | Ga0068852_101023645 | 3300005616 | Bacteria | 845 |
| 88 | Ga0068859_100805647 | 3300005617 | Bacteria | 1027 |
| 89 | Ga0068859_101750008 | 3300005617 | Bacteria | 686 |
| 90 | Ga0068859_103008942 | 3300005617 | Bacteria | 515 |
| 91 | Ga0068864_100036825 | 3300005618 | Bacteria | 4172 |
| 92 | Ga0068864_100506220 | 3300005618 | Bacteria | 1162 |
| 93 | Ga0068851_10203998 | 3300005834 | Bacteria | 1105 |
| 94 | Ga0068851_10454288 | 3300005834 | Bacteria | 762 |
| 95 | Ga0068851_10568331 | 3300005834 | Bacteria | 687 |
| 96 | Ga0068863_100000196 | 3300005841 | Bacteria | 64527 |
| 97 | Ga0068863_100003687 | 3300005841 | Bacteria | 15135 |
| 98 | Ga0068863_100038746 | 3300005841 | Bacteria | 4534 |
| 99 | Ga0068863_100776883 | 3300005841 | Bacteria | 954 |
| 100 | Ga0068858_100010069 | 3300005842 | Bacteria | 8976 |
| 101 | Ga0068858_100028002 | 3300005842 | Bacteria | 5236 |
| 102 | Ga0068858_100235912 | 3300005842 | Bacteria | 1735 |
| 103 | Ga0068858_102569619 | 3300005842 | Bacteria | 503 |
| 104 | Ga0068860_100000008 | 3300005843 | Bacteria | 427367 |
| 105 | Ga0068860_100008194 | 3300005843 | Bacteria | 10402 |
| 106 | Ga0068860_100042623 | 3300005843 | Bacteria | 4333 |
| 107 | Ga0068860_100173233 | 3300005843 | Bacteria | 2085 |
| 108 | Ga0068860_100208233 | 3300005843 | Bacteria | 1897 |
| 109 | Ga0068860_101001476 | 3300005843 | Bacteria | 854 |
| 110 | Ga0068862_100023920 | 3300005844 | Bacteria | 5120 |
| 111 | Ga0068862_100031863 | 3300005844 | Bacteria | 4453 |
| 112 | Ga0068862_100564283 | 3300005844 | Bacteria | 1088 |
| 113 | Ga0068862_102493850 | 3300005844 | Bacteria | 529 |
| 114 | Ga0075364_10014184 | 3300006051 | Bacteria | 4918 |
| 115 | Ga0075364_10215011 | 3300006051 | Bacteria | 1304 |
| 116 | Ga0075364_10271735 | 3300006051 | Bacteria | 1153 |
| 117 | Ga0075432_10000355 | 3300006058 | Bacteria | 13147 |
| 118 | Ga0075362_10000022 | 3300006177 | Bacteria | 62299 |
| 119 | Ga0075362_10037869 | 3300006177 | Bacteria | 2117 |
| 120 | Ga0075369_10008020 | 3300006186 | Bacteria | 4046 |
| 121 | Ga0075369_10336918 | 3300006186 | Bacteria | 707 |
| 122 | Ga0075366_10000034 | 3300006195 | Bacteria | 47623 |
| 123 | Ga0075366_10242371 | 3300006195 | Bacteria | 1099 |
| 124 | Ga0075366_10538452 | 3300006195 | Bacteria | 723 |
| 125 | Ga0097621_100010279 | 3300006237 | Bacteria | 6837 |
| 126 | Ga0075370_10106541 | 3300006353 | Bacteria | 1625 |
| 127 | Ga0075370_10205065 | 3300006353 | Bacteria | 1164 |
| 128 | Ga0068871_100100710 | 3300006358 | Bacteria | 2421 |
| 129 | Ga0068871_101258633 | 3300006358 | Bacteria | 695 |
| 130 | Ga0097620_100805586 | 3300006931 | Bacteria | 1027 |
| 131 | Ga0097620_101749985 | 3300006931 | Bacteria | 686 |
| 132 | Ga0097620_103009555 | 3300006931 | Bacteria | 515 |
| 133 | Ga0079104_1064557 | 3300006946 | Bacteria | 781 |
| 134 | Ga0105251_10003813 | 3300009011 | Bacteria | 10744 |
| 135 | Ga0105251_10079743 | 3300009011 | Bacteria | 1514 |
| 136 | Ga0105250_10047371 | 3300009092 | Bacteria | 1724 |
| 137 | Ga0105240_10174154 | 3300009093 | Bacteria | 2545 |
| 138 | Ga0105240_10893339 | 3300009093 | Bacteria | 956 |
| 139 | Ga0111539_10361450 | 3300009094 | Bacteria | 1690 |
| 140 | Ga0105247_10192536 | 3300009101 | Bacteria | 1366 |
| 141 | Ga0105247_10205835 | 3300009101 | Bacteria | 1325 |
| 142 | Ga0105241_10118578 | 3300009174 | Bacteria | 2128 |
| 143 | Ga0105241_10281528 | 3300009174 | Bacteria | 1420 |
| 144 | Ga0105248_10082606 | 3300009177 | Bacteria | 3613 |
| 145 | Ga0105248_10168254 | 3300009177 | Bacteria | 2470 |
| 146 | Ga0105248_10665962 | 3300009177 | Bacteria | 1174 |
| 147 | Ga0105248_11177741 | 3300009177 | Bacteria | 866 |
| 148 | Ga0105237_10591580 | 3300009545 | Bacteria | 1116 |
| 149 | Ga0105237_11289320 | 3300009545 | Bacteria | 737 |
| 150 | Ga0105237_11537421 | 3300009545 | Bacteria | 672 |
| 151 | Ga0105238_10093154 | 3300009551 | Bacteria | 3001 |
| 152 | Ga0105238_10302993 | 3300009551 | Bacteria | 1582 |
| 153 | Ga0105238_10345606 | 3300009551 | Bacteria | 1476 |
| 154 | Ga0105238_12189383 | 3300009551 | Bacteria | 588 |
| 155 | Ga0105249_10192944 | 3300009553 | Bacteria | 1989 |
| 156 | Ga0105249_11461612 | 3300009553 | Bacteria | 756 |
| 157 | Ga0105239_10344439 | 3300010375 | Bacteria | 1682 |
| 158 | Ga0157373_10202528 | 3300013100 | Bacteria | 1399 |
| 159 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 160 | Ga0157370_10910471 | 3300013104 | Bacteria | 798 |
| 161 | Ga0157369_10012079 | 3300013105 | Bacteria | 9807 |
| 162 | Ga0157374_10080778 | 3300013296 | Bacteria | 3084 |
| 163 | Ga0163162_10016336 | 3300013306 | Bacteria | 7255 |
| 164 | Ga0163162_10296576 | 3300013306 | Bacteria | 1748 |
| 165 | Ga0163162_10309189 | 3300013306 | Bacteria | 1713 |
| 166 | Ga0163162_12903952 | 3300013306 | Bacteria | 551 |
| 167 | Ga0157372_10183744 | 3300013307 | Bacteria | 2421 |
| 168 | Ga0157372_10984317 | 3300013307 | Bacteria | 977 |
| 169 | Ga0157372_12109862 | 3300013307 | Bacteria | 647 |
| 170 | Ga0157372_12936635 | 3300013307 | Bacteria | 546 |
| 171 | Ga0157372_12965051 | 3300013307 | Bacteria | 543 |
| 172 | Ga0157380_10308282 | 3300014326 | Bacteria | 1462 |
| 173 | Ga0157380_11474589 | 3300014326 | Bacteria | 733 |
| 174 | Ga0157380_12891824 | 3300014326 | Bacteria | 546 |
| 175 | Ga0163161_10020586 | 3300017792 | Bacteria | 4631 |
| 176 | Ga0163161_11448941 | 3300017792 | Bacteria | 601 |
| 177 | Ga0213876_10311492 | 3300021384 | Bacteria | 837 |
| 178 | Ga0207427_101209 | 3300025231 | Bacteria | 10020 |
| 179 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 180 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 181 | Ga0209455_1016220 | 3300025272 | Bacteria | 1607 |
| 182 | Ga0209050_1001213 | 3300025298 | Bacteria | 30197 |
| 183 | Ga0207656_10470501 | 3300025321 | Bacteria | 636 |
| 184 | Ga0207696_1005241 | 3300025711 | Bacteria | 5417 |
| 185 | Ga0207713_1006081 | 3300025735 | Bacteria | 7437 |
| 186 | Ga0207713_1033475 | 3300025735 | Bacteria | 2244 |
| 187 | Ga0207682_10061578 | 3300025893 | Bacteria | 1571 |
| 188 | Ga0207710_10156125 | 3300025900 | Bacteria | 1109 |
| 189 | Ga0207710_10239359 | 3300025900 | Bacteria | 905 |
| 190 | Ga0207680_10147441 | 3300025903 | Bacteria | 1566 |
| 191 | Ga0207680_10299148 | 3300025903 | Bacteria | 1121 |
| 192 | Ga0207647_10019760 | 3300025904 | Bacteria | 4525 |
| 193 | Ga0207647_10078881 | 3300025904 | Bacteria | 1977 |
| 194 | Ga0207647_10108014 | 3300025904 | Bacteria | 1646 |
| 195 | Ga0207647_10672691 | 3300025904 | Bacteria | 566 |
| 196 | Ga0207645_10357318 | 3300025907 | Bacteria | 978 |
| 197 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 198 | Ga0207705_10000076 | 3300025909 | Bacteria | 122975 |
| 199 | Ga0207705_10090209 | 3300025909 | Bacteria | 2244 |
| 200 | Ga0207705_11366094 | 3300025909 | Bacteria | 539 |
| 201 | Ga0207654_10148089 | 3300025911 | Bacteria | 1504 |
| 202 | Ga0207654_10413500 | 3300025911 | Bacteria | 940 |
| 203 | Ga0207695_10022234 | 3300025913 | Bacteria | 7210 |
| 204 | Ga0207695_10561899 | 3300025913 | Bacteria | 1022 |
| 205 | Ga0207695_11046316 | 3300025913 | Bacteria | 696 |
| 206 | Ga0207671_10676759 | 3300025914 | Bacteria | 821 |
| 207 | Ga0207657_10030317 | 3300025919 | Bacteria | 4910 |
| 208 | Ga0207657_10117913 | 3300025919 | Bacteria | 2186 |
| 209 | Ga0207657_10613597 | 3300025919 | Bacteria | 848 |
| 210 | Ga0207649_10180550 | 3300025920 | Bacteria | 1477 |
| 211 | Ga0207649_11322367 | 3300025920 | Bacteria | 570 |
| 212 | Ga0207646_10149265 | 3300025922 | Bacteria | 2108 |
| 213 | Ga0207681_10000444 | 3300025923 | Bacteria | 28971 |
| 214 | Ga0207681_10000798 | 3300025923 | Bacteria | 20751 |
| 215 | Ga0207681_10217206 | 3300025923 | Bacteria | 1477 |
| 216 | Ga0207681_10252933 | 3300025923 | Bacteria | 1376 |
| 217 | Ga0207681_10834082 | 3300025923 | Bacteria | 771 |
| 218 | Ga0207694_10056708 | 3300025924 | Bacteria | 3043 |
| 219 | Ga0207694_10826168 | 3300025924 | Bacteria | 783 |
| 220 | Ga0207650_10291636 | 3300025925 | Bacteria | 1330 |
| 221 | Ga0207650_10398367 | 3300025925 | Bacteria | 1139 |
| 222 | Ga0207659_10033379 | 3300025926 | Bacteria | 3542 |
| 223 | Ga0207644_10010082 | 3300025931 | Bacteria | 6223 |
| 224 | Ga0207644_10184727 | 3300025931 | Bacteria | 1636 |
| 225 | Ga0207644_10239382 | 3300025931 | Bacteria | 1444 |
| 226 | Ga0207644_10413206 | 3300025931 | Bacteria | 1104 |
| 227 | Ga0207690_10209833 | 3300025932 | Bacteria | 1484 |
| 228 | Ga0207690_10433975 | 3300025932 | Bacteria | 1053 |
| 229 | Ga0207706_10494539 | 3300025933 | Bacteria | 1056 |
| 230 | Ga0207669_10268908 | 3300025937 | Bacteria | 1279 |
| 231 | Ga0207691_10280177 | 3300025940 | Bacteria | 1435 |
| 232 | Ga0207691_10723158 | 3300025940 | Bacteria | 839 |
| 233 | Ga0207691_10957634 | 3300025940 | Bacteria | 715 |
| 234 | Ga0207711_10032949 | 3300025941 | Bacteria | 4381 |
| 235 | Ga0207711_10202592 | 3300025941 | Bacteria | 1811 |
| 236 | Ga0207711_11720947 | 3300025941 | Bacteria | 570 |
| 237 | Ga0207667_10002169 | 3300025949 | Bacteria | 24595 |
| 238 | Ga0207667_10013495 | 3300025949 | Bacteria | 9344 |
| 239 | Ga0207667_10064099 | 3300025949 | Bacteria | 3838 |
| 240 | Ga0207667_10209914 | 3300025949 | Bacteria | 1996 |
| 241 | Ga0207667_11004748 | 3300025949 | Bacteria | 821 |
| 242 | Ga0207712_10121665 | 3300025961 | Bacteria | 1975 |
| 243 | Ga0207668_10042927 | 3300025972 | Bacteria | 3065 |
| 244 | Ga0207668_10116555 | 3300025972 | Bacteria | 2014 |
| 245 | Ga0207668_10859938 | 3300025972 | Bacteria | 805 |
| 246 | Ga0207640_10000063 | 3300025981 | Bacteria | 87065 |
| 247 | Ga0207640_10032317 | 3300025981 | Bacteria | 3244 |
| 248 | Ga0207640_10045421 | 3300025981 | Bacteria | 2821 |
| 249 | Ga0207640_10150419 | 3300025981 | Bacteria | 1710 |
| 250 | Ga0207658_10001044 | 3300025986 | Bacteria | 22500 |
| 251 | Ga0207658_10007814 | 3300025986 | Bacteria | 7284 |
| 252 | Ga0207658_10010022 | 3300025986 | Bacteria | 6439 |
| 253 | Ga0207658_10016276 | 3300025986 | Bacteria | 5113 |
| 254 | Ga0207658_10754996 | 3300025986 | Bacteria | 881 |
| 255 | Ga0207703_10001270 | 3300026035 | Bacteria | 23457 |
| 256 | Ga0207703_10098131 | 3300026035 | Bacteria | 2477 |
| 257 | Ga0207639_10000220 | 3300026041 | Bacteria | 42726 |
| 258 | Ga0207639_10003454 | 3300026041 | Bacteria | 10632 |
| 259 | Ga0207639_10107202 | 3300026041 | Bacteria | 2269 |
| 260 | Ga0207639_10228776 | 3300026041 | Bacteria | 1610 |
| 261 | Ga0207639_11060173 | 3300026041 | Bacteria | 760 |
| 262 | Ga0207678_10006049 | 3300026067 | Bacteria | 10763 |
| 263 | Ga0207678_10209139 | 3300026067 | Bacteria | 1669 |
| 264 | Ga0207702_10100850 | 3300026078 | Bacteria | 2548 |
| 265 | Ga0207702_10201008 | 3300026078 | Bacteria | 1847 |
| 266 | Ga0207641_10000198 | 3300026088 | Bacteria | 81646 |
| 267 | Ga0207641_10003709 | 3300026088 | Bacteria | 13453 |
| 268 | Ga0207641_10016064 | 3300026088 | Bacteria | 6131 |
| 269 | Ga0207641_10231376 | 3300026088 | Bacteria | 1718 |
| 270 | Ga0207641_10713411 | 3300026088 | Bacteria | 988 |
| 271 | Ga0207676_10005212 | 3300026095 | Bacteria | 9200 |
| 272 | Ga0207676_12351381 | 3300026095 | Bacteria | 530 |
| 273 | Ga0207674_10230960 | 3300026116 | Bacteria | 1797 |
| 274 | Ga0207674_10534127 | 3300026116 | Bacteria | 1133 |
| 275 | Ga0207674_11524884 | 3300026116 | Bacteria | 637 |
| 276 | Ga0207698_10000177 | 3300026142 | Bacteria | 39133 |
| 277 | Ga0207698_10019802 | 3300026142 | Bacteria | 4616 |
| 278 | Ga0207698_10250029 | 3300026142 | Bacteria | 1621 |
| 279 | Ga0207698_10405923 | 3300026142 | Bacteria | 1303 |
| 280 | Ga0207698_10857612 | 3300026142 | Bacteria | 913 |
| 281 | Ga0209371_1039959 | 3300027312 | Bacteria | 958 |
| 282 | Ga0210000_1043604 | 3300027462 | Bacteria | 714 |
| 283 | Ga0209983_1052771 | 3300027665 | Bacteria | 891 |
| 284 | Ga0209974_10005438 | 3300027876 | Bacteria | 4480 |
| 285 | Ga0268266_10000354 | 3300028379 | Bacteria | 70983 |
| 286 | Ga0268266_10017410 | 3300028379 | Bacteria | 6130 |
| 287 | Ga0268266_10021606 | 3300028379 | Bacteria | 5482 |
| 288 | Ga0268266_10046667 | 3300028379 | Bacteria | 3709 |
| 289 | Ga0268265_10022535 | 3300028380 | Bacteria | 4427 |
| 290 | Ga0268265_10077074 | 3300028380 | Bacteria | 2617 |
| 291 | Ga0268265_10476199 | 3300028380 | Bacteria | 1171 |
| 292 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 293 | Ga0268264_10034602 | 3300028381 | Bacteria | 4157 |
| 294 | Ga0268264_10063371 | 3300028381 | Bacteria | 3107 |
| 295 | Ga0268264_10300346 | 3300028381 | Bacteria | 1511 |
| 296 | Ga0307515_10321016 | 3300028794 | Bacteria | 1215 |
| 297 | Ga0268256_1030978 | 3300030500 | Bacteria | 1289 |
| 298 | Ga0265331_10045016 | 3300031250 | Bacteria | 2131 |
| 299 | Ga0265327_10111882 | 3300031251 | Bacteria | 1303 |
| 300 | Ga0307408_101031487 | 3300031548 | Bacteria | 760 |
| 301 | Ga0316578_10245466 | 3300031728 | Bacteria | 1075 |
| 302 | Ga0307405_10029177 | 3300031731 | Bacteria | 3222 |
| 303 | Ga0307405_10077990 | 3300031731 | Bacteria | 2154 |
| 304 | Ga0307405_11451242 | 3300031731 | Bacteria | 601 |
| 305 | Ga0307413_10147315 | 3300031824 | Bacteria | 1636 |
| 306 | Ga0307413_10858238 | 3300031824 | Bacteria | 768 |
| 307 | Ga0307413_10886421 | 3300031824 | Bacteria | 757 |
| 308 | Ga0307413_11104490 | 3300031824 | Bacteria | 685 |
| 309 | Ga0307413_11856967 | 3300031824 | Bacteria | 540 |
| 310 | Ga0307410_10397252 | 3300031852 | Bacteria | 1113 |
| 311 | Ga0307410_10748696 | 3300031852 | Bacteria | 827 |
| 312 | Ga0307410_11050062 | 3300031852 | Bacteria | 704 |
| 313 | Ga0307410_11343112 | 3300031852 | Bacteria | 626 |
| 314 | Ga0307410_12020770 | 3300031852 | Bacteria | 514 |
| 315 | Ga0307406_10925553 | 3300031901 | Bacteria | 744 |
| 316 | Ga0307407_10287224 | 3300031903 | Bacteria | 1142 |
| 317 | Ga0307407_11032494 | 3300031903 | Bacteria | 636 |
| 318 | Ga0307412_10043863 | 3300031911 | Bacteria | 2915 |
| 319 | Ga0307412_10224495 | 3300031911 | Bacteria | 1442 |
| 320 | Ga0307412_11430670 | 3300031911 | Bacteria | 626 |
| 321 | Ga0307412_11591209 | 3300031911 | Bacteria | 596 |
| 322 | Ga0307409_100419784 | 3300031995 | Bacteria | 1283 |
| 323 | Ga0307409_100534188 | 3300031995 | Bacteria | 1148 |
| 324 | Ga0307409_100706471 | 3300031995 | Bacteria | 1008 |
| 325 | Ga0307409_102647105 | 3300031995 | Bacteria | 530 |
| 326 | Ga0307416_101845808 | 3300032002 | Bacteria | 708 |
| 327 | Ga0307416_102032160 | 3300032002 | Bacteria | 677 |
| 328 | Ga0307414_10034062 | 3300032004 | Bacteria | 3372 |
| 329 | Ga0307414_10199380 | 3300032004 | Bacteria | 1626 |
| 330 | Ga0307414_10523481 | 3300032004 | Bacteria | 1053 |
| 331 | Ga0307414_10661470 | 3300032004 | Bacteria | 942 |
| 332 | Ga0307414_10673309 | 3300032004 | Bacteria | 934 |
| 333 | Ga0307414_11045100 | 3300032004 | Bacteria | 753 |
| 334 | Ga0307414_11468099 | 3300032004 | Bacteria | 634 |
| 335 | Ga0307411_10120547 | 3300032005 | Bacteria | 1897 |
| 336 | Ga0307411_10125634 | 3300032005 | Bacteria | 1865 |
| 337 | Ga0307411_10902488 | 3300032005 | Bacteria | 785 |
| 338 | Ga0307415_100182258 | 3300032126 | Bacteria | 1649 |
| 339 | Ga0316583_10003370 | 3300032133 | Bacteria | 5625 |
| 340 | Ga0316574_0468711 | 3300035398 | Bacteria | 788 |
| 341 | Ga0316582_0032089 | 3300036647 | Bacteria | 3215 |
| 342 | Ga0316584_0342664 | 3300036712 | Bacteria | 1074 |
| 343 | Ga0316584_0397088 | 3300036712 | Bacteria | 983 |
| 344 | Ga0316584_1000320 | 3300036712 | Bacteria | 559 |
| 345 | Ga0395899_0003766 | 3300037312 | Bacteria | 11972 |
| 346 | Ga0395900_0511270 | 3300037418 | Bacteria | 1150 |
| 347 | Ga0395900_0573966 | 3300037418 | Bacteria | 1070 |
| 348 | Ga0395900_1324974 | 3300037418 | Bacteria | 634 |
| 349 | Ga0395905_1184212 | 3300037471 | Bacteria | 668 |
| 350 | Ga0395901_0249242 | 3300038443 | Bacteria | 1851 |
| 351 | Ga0436365_1372378 | 3300039437 | Bacteria | 1000 |
| 352 | Ga0436365_1668286 | 3300039437 | Bacteria | 2135 |
| 353 | Ga0451789_0406830 | 3300041443 | Bacteria | 545 |
| 354 | Ga0451807_0941463 | 3300041486 | Bacteria | 540 |
| 355 | Ga0451839_1283613 | 3300041496 | Bacteria | 699 |
| 356 | Ga0451841_0662214 | 3300041498 | Bacteria | 902 |
| 357 | Ga0451841_0756227 | 3300041498 | Bacteria | 684 |
| 358 | Ga0451849_0265780 | 3300041505 | Bacteria | 805 |
| 359 | Ga0451851_0872115 | 3300041507 | Bacteria | 622 |
| 360 | Ga0451853_1262340 | 3300041512 | Bacteria | 1607 |
| 361 | Ga0451853_3327244 | 3300041512 | Bacteria | 607 |
| 362 | Ga0439431_0059657 | 3300041997 | Bacteria | 1002 |
| 363 | Ga0450912_021326 | 3300042116 | Bacteria | 628 |
| 364 | Ga0450921_019743 | 3300042123 | Bacteria | 634 |
| 365 | Ga0450891_037010 | 3300042129 | Bacteria | 518 |
| 366 | Ga0453684_0103485 | 3300044712 | Bacteria | 3479 |
| 367 | Ga0451576_0022769 | 3300045051 | Bacteria | 6787 |
| 368 | Ga0495627_001378 | 3300046453 | Bacteria | 14462 |
| 369 | Ga0495627_156283 | 3300046453 | Bacteria | 635 |
| 370 | Ga0495650_0004010 | 3300046471 | Bacteria | 10339 |
| 371 | Ga0495605_0079546 | 3300046474 | Bacteria | 1535 |
| 372 | Ga0495596_0000113 | 3300046500 | Bacteria | 55405 |
| 373 | Ga0495596_0011916 | 3300046500 | Bacteria | 3733 |
| 374 | Ga0495607_0029066 | 3300046501 | Bacteria | 3405 |
| 375 | Ga0495607_0175152 | 3300046501 | Bacteria | 1080 |
| 376 | Ga0495583_0276382 | 3300046506 | Bacteria | 670 |
| 377 | Ga0495610_0000018 | 3300046512 | Bacteria | 355044 |
| 378 | Ga0495610_0014626 | 3300046512 | Bacteria | 4601 |
| 379 | Ga0495620_0028498 | 3300046515 | Bacteria | 2596 |
| 380 | Ga0495632_0022034 | 3300046519 | Bacteria | 3423 |
| 381 | Ga0495643_0000217 | 3300046522 | Bacteria | 88279 |
| 382 | Ga0495643_0016799 | 3300046522 | Bacteria | 4294 |
| 383 | Ga0495643_0189614 | 3300046522 | Bacteria | 993 |
| 384 | Ga0495643_0285680 | 3300046522 | Bacteria | 757 |
| 385 | Ga0495609_0069851 | 3300046538 | Bacteria | 1544 |
| 386 | Ga0495621_0005243 | 3300046539 | Bacteria | 3712 |
| 387 | Ga0495633_0281936 | 3300046558 | Bacteria | 756 |
| 388 | Ga0495625_0027605 | 3300046660 | Bacteria | 4270 |
| 389 | Ga0495671_0177971 | 3300046692 | Bacteria | 1033 |
| 390 | Ga0495683_0196881 | 3300047323 | Bacteria | 911 |
| 391 | Ga0495673_0343340 | 3300047469 | Bacteria | 528 |
| 392 | Ga0495681_0000792 | 3300047470 | Bacteria | 24336 |
| 393 | Ga0495593_0540157 | 3300047673 | Bacteria | 585 |
| 394 | Ga0495615_0000113 | 3300048090 | Bacteria | 20683 |
| 395 | Ga0495626_0012697 | 3300048091 | Bacteria | 4405 |
| 396 | Ga0496100_0009680 | 3300048903 | Bacteria | 5421 |
| 397 | Ga0496100_0627090 | 3300048903 | Bacteria | 836 |
| 398 | Ga0496101_0836378 | 3300048904 | Bacteria | 725 |
| 399 | Ga0496102_0012000 | 3300048905 | Bacteria | 7486 |
| 400 | Ga0496102_0345842 | 3300048905 | Bacteria | 1400 |
| 401 | Ga0496102_0450798 | 3300048905 | Bacteria | 1207 |
| 402 | Ga0496102_0844509 | 3300048905 | Bacteria | 838 |
| 403 | Ga0496103_0000081 | 3300048906 | Bacteria | 109734 |
| 404 | Ga0496103_0188910 | 3300048906 | Bacteria | 1324 |
| 405 | Ga0496104_0043737 | 3300048907 | Bacteria | 4206 |
| 406 | Ga0496104_0094946 | 3300048907 | Bacteria | 2853 |
| 407 | Ga0496105_0022181 | 3300048908 | Bacteria | 5142 |
| 408 | Ga0496105_0040467 | 3300048908 | Bacteria | 3843 |
| 409 | Ga0496106_0962482 | 3300048909 | Bacteria | 672 |
| 410 | Ga0496107_0662264 | 3300048910 | Bacteria | 769 |
| 411 | Ga0496110_1298700 | 3300048913 | Bacteria | 637 |
| 412 | Ga0496111_0890057 | 3300048914 | Bacteria | 641 |
| 413 | Ga0496113_0205129 | 3300048916 | Bacteria | 1568 |
| 414 | Ga0496113_0385744 | 3300048916 | Bacteria | 1124 |
| 415 | Ga0496113_0592594 | 3300048916 | Bacteria | 888 |
| 416 | Ga0496114_0034544 | 3300048917 | Bacteria | 4172 |
| 417 | Ga0496115_0879009 | 3300048918 | Bacteria | 692 |
| 418 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 419 | Ga0496116_0160592 | 3300048919 | Bacteria | 1233 |
| 420 | Ga0496117_0010088 | 3300048920 | Bacteria | 8672 |
| 421 | Ga0496117_0081056 | 3300048920 | Bacteria | 2132 |
| 422 | Ga0496117_0225934 | 3300048920 | Bacteria | 1038 |
| 423 | Ga0496118_0059496 | 3300048921 | Bacteria | 2844 |
| 424 | Ga0496118_0093553 | 3300048921 | Bacteria | 2058 |
| 425 | Ga0496118_0134474 | 3300048921 | Bacteria | 1580 |
| 426 | Ga0496119_0022504 | 3300048922 | Bacteria | 4508 |
| 427 | Ga0496120_0022329 | 3300048923 | Bacteria | 3982 |
| 428 | Ga0496121_0000021 | 3300048924 | Bacteria | 478544 |
| 429 | Ga0496121_0001016 | 3300048924 | Bacteria | 50107 |
| 430 | Ga0496121_0002197 | 3300048924 | Bacteria | 30505 |
| 431 | Ga0496121_0020181 | 3300048924 | Bacteria | 6613 |
| 432 | Ga0496121_0100988 | 3300048924 | Bacteria | 2226 |
| 433 | Ga0496122_0026363 | 3300048925 | Bacteria | 5012 |
| 434 | Ga0496122_0027958 | 3300048925 | Bacteria | 4803 |
| 435 | Ga0496122_0038756 | 3300048925 | Bacteria | 3810 |
| 436 | Ga0496122_0618585 | 3300048925 | Bacteria | 503 |
| 437 | Ga0496123_0001766 | 3300048926 | Bacteria | 28525 |
| 438 | Ga0496123_0006131 | 3300048926 | Bacteria | 11786 |
| 439 | Ga0496123_0049053 | 3300048926 | Bacteria | 2835 |
| 440 | Ga0496123_0068111 | 3300048926 | Bacteria | 2243 |
| 441 | Ga0496124_0009285 | 3300048927 | Bacteria | 10140 |
| 442 | Ga0496124_0022041 | 3300048927 | Bacteria | 5851 |
| 443 | Ga0496124_0070953 | 3300048927 | Bacteria | 2889 |
| 444 | Ga0496124_0078982 | 3300048927 | Bacteria | 2710 |
| 445 | Ga0496124_0486385 | 3300048927 | Bacteria | 832 |
| 446 | Ga0496124_0702969 | 3300048927 | Bacteria | 640 |
| 447 | Ga0496125_0003360 | 3300048928 | Bacteria | 19487 |
| 448 | Ga0496125_0028306 | 3300048928 | Bacteria | 5065 |
| 449 | Ga0496125_0058900 | 3300048928 | Bacteria | 3099 |
| 450 | Ga0496125_0198910 | 3300048928 | Bacteria | 1314 |
| 451 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 452 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 453 | Ga0496126_0043461 | 3300048929 | Bacteria | 4145 |
| 454 | Ga0496126_0045167 | 3300048929 | Bacteria | 4051 |
| 455 | Ga0496126_0755234 | 3300048929 | Bacteria | 750 |
| 456 | Ga0501306_014832 | 3300049127 | Bacteria | 1032 |
| 457 | Ga0501032_0779476 | 3300049569 | Bacteria | 604 |
| 458 | Ga0501034_0578143 | 3300049571 | Bacteria | 1031 |
| 459 | Ga0501039_0297979 | 3300049575 | Bacteria | 1268 |
| 460 | Ga0501039_0704816 | 3300049575 | Bacteria | 789 |
| 461 | Ga0501042_0201556 | 3300049578 | Bacteria | 1435 |
| 462 | Ga0501070_0614950 | 3300049586 | Bacteria | 865 |
| 463 | Ga0501223_142054 | 3300049663 | Bacteria | 517 |
| 464 | Ga0501224_052401 | 3300049664 | Bacteria | 627 |
| 465 | Ga0501249_039421 | 3300049679 | Bacteria | 1068 |
| 466 | Ga0501253_041244 | 3300049683 | Bacteria | 931 |
| 467 | Ga0501268_044031 | 3300049765 | Bacteria | 848 |
| 468 | Ga0501044_0074168 | 3300049823 | Bacteria | 3458 |
| 469 | Ga0501044_0182431 | 3300049823 | Bacteria | 2065 |
| 470 | nmdc:mga03683_375711_c1 | 3300050489 | Bacteria | 676 |
| 471 | nmdc:mga03683_42_c1 | 3300050489 | Bacteria | 60876 |
| 472 | nmdc:mga03683_7634_c1 | 3300050489 | Bacteria | 2117 |
| 473 | nmdc:mga03n38_959_c1 | 3300050490 | Bacteria | 7829 |
| 474 | nmdc:mga00v17_136091_c1 | 3300050491 | Bacteria | 631 |
| 475 | nmdc:mga00v17_25342_c1 | 3300050491 | Bacteria | 3447 |
| 476 | nmdc:mga0k408_3_c1 | 3300050493 | Bacteria | 243777 |
| 477 | nmdc:mga0k408_411782_c1 | 3300050493 | Bacteria | 804 |
| 478 | nmdc:mga07m45_371029_c1 | 3300050496 | Bacteria | 831 |
| 479 | nmdc:mga08y16_314576_c1 | 3300050511 | Bacteria | 1612 |
| 480 | nmdc:mga0sz30_14903_c1 | 3300050516 | Bacteria | 3066 |
| 481 | nmdc:mga0sz30_3181_c1 | 3300050516 | Bacteria | 5887 |
| 482 | Ga0495601_1054800 | 3300053077 | Bacteria | 510 |
| 483 | Ga0500643_001306 | 3300053087 | Bacteria | 14670 |
| 484 | Ga0500562_077631 | 3300053108 | Bacteria | 898 |
| 485 | Ga0500607_033455 | 3300053121 | Bacteria | 2816 |
| 486 | Ga0500608_149537 | 3300053122 | Bacteria | 1025 |
| 487 | Ga0500618_004249 | 3300053125 | Bacteria | 4640 |
| 488 | Ga0500618_012576 | 3300053125 | Bacteria | 2213 |
| 489 | Ga0500559_0019143 | 3300053136 | Bacteria | 2893 |
| 490 | Ga0500568_0291104 | 3300053139 | Bacteria | 593 |
| 491 | Ga0500590_021975 | 3300053148 | Bacteria | 3312 |
| 492 | Ga0500590_148733 | 3300053148 | Bacteria | 1059 |
| 493 | Ga0500619_272223 | 3300053154 | Bacteria | 553 |
| 494 | Ga0500624_000100 | 3300053157 | Bacteria | 41296 |
| 495 | Ga0500636_0006048 | 3300053177 | Bacteria | 6943 |
| 496 | Ga0500636_0022292 | 3300053177 | Bacteria | 3749 |
| 497 | Ga0500637_0562455 | 3300053178 | Bacteria | 549 |
| 498 | Ga0500645_009914 | 3300053730 | Bacteria | 3178 |
| 499 | Ga0587084_004794 | 3300059477 | Bacteria | 1566 |
| 500 | Ga0587090_000073 | 3300059510 | Bacteria | 5690 |
| 501 | Ga0587115_012981 | 3300059626 | Bacteria | 1072 |
| 502 | Ga0587076_012545 | 3300059645 | Bacteria | 1268 |
| 503 | Ga0587111_0062462 | 3300060346 | Bacteria | 850 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2599185359 | 2600227343 | 79 |
| 2 | iso_pu_bacteria | 2818991466 | 2819715872 | 79 |
| 3 | iso_pu_bacteria | 2879163058 | 2879163362 | 79 |
| 4 | iso_pu_bacteria | 2928027323 | 2928031182 | 79 |
| 5 | iso_pu_bacteria | 2928968154 | 2928970666 | 79 |
| 6 | iso_pu_bacteria | 2984555340 | 2984557403 | 79 |
| 7 | iso_pu_bacteria | 2984564862 | 2984568200 | 79 |
| 8 | iso_pu_bacteria | 2993356040 | 2993359280 | 79 |
| 9 | iso_pu_bacteria | 2738541275 | 2738709417 | 80 |
| 10 | iso_pu_bacteria | 2738541301 | 2738847842 | 80 |
| 11 | iso_pu_bacteria | 2738541304 | 2738863571 | 80 |
| 12 | iso_pu_bacteria | 2738543022 | 2739296089 | 80 |
| 13 | iso_pu_bacteria | 2738543033 | 2739357767 | 80 |
| 14 | iso_pu_bacteria | 2818991438 | 2819553031 | 80 |
| 15 | iso_pu_bacteria | 2928100450 | 2928102555 | 80 |
| 16 | iso_pu_bacteria | 2928959182 | 2928959359 | 80 |
| 17 | iso_pu_bacteria | 2510917021 | 2511128012 | 81 |
| 18 | iso_pu_bacteria | 2643221588 | 2643949781 | 81 |
| 19 | iso_pu_bacteria | 2848297114 | 2848298275 | 81 |
| 20 | iso_pu_bacteria | 2882806704 | 2882807250 | 81 |
| 21 | iso_pu_bacteria | 2896184354 | 2896184412 | 81 |
| 22 | iso_pu_bacteria | 2896253425 | 2896256716 | 81 |
| 23 | iso_pu_bacteria | 2919138771 | 2919140176 | 81 |
| 24 | iso_pu_bacteria | 3000865235 | 3000866772 | 81 |
| 25 | iso_pu_bacteria | 8054302542 | 8054305742 | 81 |
| 26 | iso_pu_bacteria | 2885427238 | 2885428639 | 82 |
| 27 | 3300003791 | Ga0055530_10022865 | Ga0055530_100228653 | 83 |
| 28 | 3300005343 | Ga0070687_101176791 | Ga0070687_1011767911 | 83 |
| 29 | 3300005440 | Ga0070705_101534203 | Ga0070705_1015342032 | 83 |
| 30 | 3300005539 | Ga0068853_100000183 | Ga0068853_10000018319 | 83 |
| 31 | 3300005563 | Ga0068855_100304731 | Ga0068855_1003047312 | 83 |
| 32 | 3300005577 | Ga0068857_100074314 | Ga0068857_1000743143 | 83 |
| 33 | 3300005616 | Ga0068852_101023645 | Ga0068852_1010236452 | 83 |
| 34 | 3300005834 | Ga0068851_10454288 | Ga0068851_104542882 | 83 |
| 35 | 3300005841 | Ga0068863_100776883 | Ga0068863_1007768832 | 83 |
| 36 | 3300005843 | Ga0068860_100208233 | Ga0068860_1002082332 | 83 |
| 37 | 3300006946 | Ga0079104_1064557 | Ga0079104_10645572 | 83 |
| 38 | 3300009553 | Ga0105249_11461612 | Ga0105249_114616122 | 83 |
| 39 | 3300025298 | Ga0209050_1001213 | Ga0209050_100121314 | 83 |
| 40 | 3300025922 | Ga0207646_10149265 | Ga0207646_101492653 | 83 |
| 41 | 3300025981 | Ga0207640_10150419 | Ga0207640_101504192 | 83 |
| 42 | 3300026041 | Ga0207639_10000220 | Ga0207639_1000022036 | 83 |
| 43 | 3300026088 | Ga0207641_10713411 | Ga0207641_107134112 | 83 |
| 44 | 3300026116 | Ga0207674_10534127 | Ga0207674_105341272 | 83 |
| 45 | 3300026142 | Ga0207698_10405923 | Ga0207698_104059232 | 83 |
| 46 | 3300027312 | Ga0209371_1039959 | Ga0209371_10399592 | 83 |
| 47 | 3300030500 | Ga0268256_1030978 | Ga0268256_10309782 | 83 |
| 48 | 3300031251 | Ga0265327_10111882 | Ga0265327_101118822 | 83 |
| 49 | 3300041443 | Ga0451789_0406830 | Ga0451789_0406830_229_483 | 83 |
| 50 | 3300046453 | Ga0495627_156283 | Ga0495627_156283_227_481 | 83 |
| 51 | 3300046500 | Ga0495596_0011916 | Ga0495596_0011916_3465_3719 | 83 |
| 52 | 3300046512 | Ga0495610_0014626 | Ga0495610_0014626_1444_1698 | 83 |
| 53 | 3300046522 | Ga0495643_0285680 | Ga0495643_0285680_123_377 | 83 |
| 54 | 3300046558 | Ga0495633_0281936 | Ga0495633_0281936_278_532 | 83 |
| 55 | 3300047673 | Ga0495593_0540157 | Ga0495593_0540157_19_273 | 83 |
| 56 | 3300048091 | Ga0495626_0012697 | Ga0495626_0012697_511_765 | 83 |
| 57 | 3300048903 | Ga0496100_0627090 | Ga0496100_0627090_307_561 | 83 |
| 58 | 3300048905 | Ga0496102_0450798 | Ga0496102_0450798_66_320 | 83 |
| 59 | 3300048909 | Ga0496106_0962482 | Ga0496106_0962482_56_310 | 83 |
| 60 | 3300048919 | Ga0496116_0000028 | Ga0496116_0000028_68278_68532 | 83 |
| 61 | 3300048920 | Ga0496117_0081056 | Ga0496117_0081056_1024_1278 | 83 |
| 62 | 3300048924 | Ga0496121_0002197 | Ga0496121_0002197_1031_1285 | 83 |
| 63 | 3300048925 | Ga0496122_0038756 | Ga0496122_0038756_807_1061 | 83 |
| 64 | 3300048926 | Ga0496123_0001766 | Ga0496123_0001766_18922_19176 | 83 |
| 65 | 3300048927 | Ga0496124_0022041 | Ga0496124_0022041_5574_5828 | 83 |
| 66 | 3300048927 | Ga0496124_0078982 | Ga0496124_0078982_306_560 | 83 |
| 67 | 3300048928 | Ga0496125_0058900 | Ga0496125_0058900_2247_2501 | 83 |
| 68 | 3300048928 | Ga0496125_0198910 | Ga0496125_0198910_325_579 | 83 |
| 69 | 3300048929 | Ga0496126_0000079 | Ga0496126_0000079_174287_174541 | 83 |
| 70 | 3300048929 | Ga0496126_0755234 | Ga0496126_0755234_127_381 | 83 |
| 71 | 3300053077 | Ga0495601_1054800 | Ga0495601_1054800_189_440 | 83 |
| 72 | 3300053087 | Ga0500643_001306 | Ga0500643_001306_10788_11042 | 83 |
| 73 | 3300053108 | Ga0500562_077631 | Ga0500562_077631_301_555 | 83 |
| 74 | 3300053122 | Ga0500608_149537 | Ga0500608_149537_535_789 | 83 |
| 75 | 3300053125 | Ga0500618_012576 | Ga0500618_012576_290_544 | 83 |
| 76 | 3300053136 | Ga0500559_0019143 | Ga0500559_0019143_288_542 | 83 |
| 77 | 3300053148 | Ga0500590_021975 | Ga0500590_021975_2338_2592 | 83 |
| 78 | 3300053157 | Ga0500624_000100 | Ga0500624_000100_33862_34116 | 83 |
| 79 | 3300053177 | Ga0500636_0006048 | Ga0500636_0006048_3954_4208 | 83 |
| 80 | 3300053177 | Ga0500636_0022292 | Ga0500636_0022292_269_523 | 83 |
| 81 | 3300053730 | Ga0500645_009914 | Ga0500645_009914_255_509 | 83 |
| 82 | 2162886007 | SwRhRL2b_contig_1350033 | SwRhRL2b_0306.00003490 | 84 |
| 83 | 2162886007 | SwRhRL2b_contig_1774792 | SwRhRL2b_0085.00006330 | 84 |
| 84 | 2162886007 | SwRhRL2b_contig_2932459 | SwRhRL2b_0720.00004220 | 84 |
| 85 | 3300001990 | JGI24737J22298_10026213 | JGI24737J22298_100262132 | 84 |
| 86 | 3300001990 | JGI24737J22298_10043129 | JGI24737J22298_100431293 | 84 |
| 87 | 3300001990 | JGI24737J22298_10124574 | JGI24737J22298_101245742 | 84 |
| 88 | 3300002067 | JGI24735J21928_10031817 | JGI24735J21928_100318171 | 84 |
| 89 | 3300002067 | JGI24735J21928_10033789 | JGI24735J21928_100337892 | 84 |
| 90 | 3300002067 | JGI24735J21928_10039541 | JGI24735J21928_100395411 | 84 |
| 91 | 3300002067 | JGI24735J21928_10051785 | JGI24735J21928_100517851 | 84 |
| 92 | 3300002067 | JGI24735J21928_10063876 | JGI24735J21928_100638762 | 84 |
| 93 | 3300002239 | JGI24034J26672_10109369 | JGI24034J26672_101093691 | 84 |
| 94 | 3300002244 | JGI24742J22300_10128557 | JGI24742J22300_101285571 | 84 |
| 95 | 3300002459 | JGI24751J29686_10100489 | JGI24751J29686_101004892 | 84 |
| 96 | 3300002772 | JGI25164J39214_1017967 | JGI25164J39214_10179672 | 84 |
| 97 | 3300003214 | JGI25165J46597_1000043 | JGI25165J46597_1000043119 | 84 |
| 98 | 3300003762 | Ga0055542_1005278 | Ga0055542_10052781 | 84 |
| 99 | 3300005289 | Ga0065704_10000358 | Ga0065704_100003584 | 84 |
| 100 | 3300005295 | Ga0065707_10085072 | Ga0065707_100850725 | 84 |
| 101 | 3300005327 | Ga0070658_10003835 | Ga0070658_100038354 | 84 |
| 102 | 3300005327 | Ga0070658_10095344 | Ga0070658_100953442 | 84 |
| 103 | 3300005327 | Ga0070658_10203383 | Ga0070658_102033832 | 84 |
| 104 | 3300005327 | Ga0070658_10666565 | Ga0070658_106665652 | 84 |
| 105 | 3300005331 | Ga0070670_100317010 | Ga0070670_1003170102 | 84 |
| 106 | 3300005331 | Ga0070670_101182245 | Ga0070670_1011822452 | 84 |
| 107 | 3300005335 | Ga0070666_10938498 | Ga0070666_109384981 | 84 |
| 108 | 3300005337 | Ga0070682_100715296 | Ga0070682_1007152962 | 84 |
| 109 | 3300005339 | Ga0070660_100066378 | Ga0070660_1000663782 | 84 |
| 110 | 3300005339 | Ga0070660_100100194 | Ga0070660_1001001942 | 84 |
| 111 | 3300005344 | Ga0070661_100298807 | Ga0070661_1002988072 | 84 |
| 112 | 3300005344 | Ga0070661_101654082 | Ga0070661_1016540822 | 84 |
| 113 | 3300005347 | Ga0070668_100062968 | Ga0070668_1000629682 | 84 |
| 114 | 3300005347 | Ga0070668_100167270 | Ga0070668_1001672701 | 84 |
| 115 | 3300005347 | Ga0070668_100243184 | Ga0070668_1002431841 | 84 |
| 116 | 3300005347 | Ga0070668_100756022 | Ga0070668_1007560221 | 84 |
| 117 | 3300005353 | Ga0070669_100000200 | Ga0070669_10000020023 | 84 |
| 118 | 3300005353 | Ga0070669_100010144 | Ga0070669_1000101447 | 84 |
| 119 | 3300005353 | Ga0070669_100186315 | Ga0070669_1001863151 | 84 |
| 120 | 3300005353 | Ga0070669_100319735 | Ga0070669_1003197352 | 84 |
| 121 | 3300005353 | Ga0070669_100446953 | Ga0070669_1004469532 | 84 |
| 122 | 3300005355 | Ga0070671_100016012 | Ga0070671_1000160124 | 84 |
| 123 | 3300005355 | Ga0070671_100165508 | Ga0070671_1001655083 | 84 |
| 124 | 3300005355 | Ga0070671_100469955 | Ga0070671_1004699553 | 84 |
| 125 | 3300005356 | Ga0070674_100576472 | Ga0070674_1005764722 | 84 |
| 126 | 3300005366 | Ga0070659_100423856 | Ga0070659_1004238562 | 84 |
| 127 | 3300005367 | Ga0070667_100000198 | Ga0070667_10000019854 | 84 |
| 128 | 3300005367 | Ga0070667_100000419 | Ga0070667_10000041936 | 84 |
| 129 | 3300005367 | Ga0070667_100003540 | Ga0070667_1000035403 | 84 |
| 130 | 3300005367 | Ga0070667_100103161 | Ga0070667_1001031612 | 84 |
| 131 | 3300005440 | Ga0070705_100470631 | Ga0070705_1004706311 | 84 |
| 132 | 3300005441 | Ga0070700_100495194 | Ga0070700_1004951941 | 84 |
| 133 | 3300005455 | Ga0070663_100181650 | Ga0070663_1001816502 | 84 |
| 134 | 3300005455 | Ga0070663_100702455 | Ga0070663_1007024552 | 84 |
| 135 | 3300005457 | Ga0070662_100493334 | Ga0070662_1004933342 | 84 |
| 136 | 3300005539 | Ga0068853_100014596 | Ga0068853_1000145962 | 84 |
| 137 | 3300005539 | Ga0068853_100047830 | Ga0068853_1000478303 | 84 |
| 138 | 3300005539 | Ga0068853_100084797 | Ga0068853_1000847971 | 84 |
| 139 | 3300005539 | Ga0068853_100123499 | Ga0068853_1001234991 | 84 |
| 140 | 3300005539 | Ga0068853_101254536 | Ga0068853_1012545361 | 84 |
| 141 | 3300005543 | Ga0070672_100376552 | Ga0070672_1003765522 | 84 |
| 142 | 3300005543 | Ga0070672_101071455 | Ga0070672_1010714552 | 84 |
| 143 | 3300005548 | Ga0070665_100000107 | Ga0070665_100000107136 | 84 |
| 144 | 3300005548 | Ga0070665_100012374 | Ga0070665_1000123742 | 84 |
| 145 | 3300005548 | Ga0070665_100121898 | Ga0070665_1001218981 | 84 |
| 146 | 3300005548 | Ga0070665_100201566 | Ga0070665_1002015662 | 84 |
| 147 | 3300005563 | Ga0068855_100002286 | Ga0068855_10000228619 | 84 |
| 148 | 3300005563 | Ga0068855_100293594 | Ga0068855_1002935942 | 84 |
| 149 | 3300005563 | Ga0068855_100499820 | Ga0068855_1004998202 | 84 |
| 150 | 3300005563 | Ga0068855_100625740 | Ga0068855_1006257402 | 84 |
| 151 | 3300005563 | Ga0068855_100818403 | Ga0068855_1008184032 | 84 |
| 152 | 3300005563 | Ga0068855_101808922 | Ga0068855_1018089222 | 84 |
| 153 | 3300005577 | Ga0068857_100182571 | Ga0068857_1001825713 | 84 |
| 154 | 3300005577 | Ga0068857_102096217 | Ga0068857_1020962172 | 84 |
| 155 | 3300005578 | Ga0068854_100000359 | Ga0068854_1000003594 | 84 |
| 156 | 3300005578 | Ga0068854_100000809 | Ga0068854_1000008095 | 84 |
| 157 | 3300005578 | Ga0068854_100125271 | Ga0068854_1001252712 | 84 |
| 158 | 3300005614 | Ga0068856_100177822 | Ga0068856_1001778223 | 84 |
| 159 | 3300005614 | Ga0068856_100570811 | Ga0068856_1005708111 | 84 |
| 160 | 3300005616 | Ga0068852_100167061 | Ga0068852_1001670612 | 84 |
| 161 | 3300005616 | Ga0068852_100353287 | Ga0068852_1003532873 | 84 |
| 162 | 3300005617 | Ga0068859_100805647 | Ga0068859_1008056472 | 84 |
| 163 | 3300005617 | Ga0068859_101750008 | Ga0068859_1017500082 | 84 |
| 164 | 3300005617 | Ga0068859_103008942 | Ga0068859_1030089422 | 84 |
| 165 | 3300005618 | Ga0068864_100036825 | Ga0068864_1000368252 | 84 |
| 166 | 3300005618 | Ga0068864_100506220 | Ga0068864_1005062202 | 84 |
| 167 | 3300005834 | Ga0068851_10203998 | Ga0068851_102039982 | 84 |
| 168 | 3300005834 | Ga0068851_10568331 | Ga0068851_105683312 | 84 |
| 169 | 3300005841 | Ga0068863_100000196 | Ga0068863_1000001968 | 84 |
| 170 | 3300005841 | Ga0068863_100003687 | Ga0068863_1000036874 | 84 |
| 171 | 3300005841 | Ga0068863_100038746 | Ga0068863_1000387463 | 84 |
| 172 | 3300005842 | Ga0068858_100010069 | Ga0068858_1000100699 | 84 |
| 173 | 3300005842 | Ga0068858_100028002 | Ga0068858_1000280022 | 84 |
| 174 | 3300005842 | Ga0068858_100235912 | Ga0068858_1002359122 | 84 |
| 175 | 3300005842 | Ga0068858_102569619 | Ga0068858_1025696191 | 84 |
| 176 | 3300005843 | Ga0068860_100000008 | Ga0068860_10000000898 | 84 |
| 177 | 3300005843 | Ga0068860_100008194 | Ga0068860_10000819410 | 84 |
| 178 | 3300005843 | Ga0068860_100042623 | Ga0068860_1000426232 | 84 |
| 179 | 3300005843 | Ga0068860_100173233 | Ga0068860_1001732332 | 84 |
| 180 | 3300005843 | Ga0068860_101001476 | Ga0068860_1010014762 | 84 |
| 181 | 3300005844 | Ga0068862_100023920 | Ga0068862_1000239202 | 84 |
| 182 | 3300005844 | Ga0068862_100031863 | Ga0068862_1000318632 | 84 |
| 183 | 3300005844 | Ga0068862_100564283 | Ga0068862_1005642832 | 84 |
| 184 | 3300005844 | Ga0068862_102493850 | Ga0068862_1024938501 | 84 |
| 185 | 3300006051 | Ga0075364_10014184 | Ga0075364_100141844 | 84 |
| 186 | 3300006051 | Ga0075364_10215011 | Ga0075364_102150112 | 84 |
| 187 | 3300006051 | Ga0075364_10271735 | Ga0075364_102717353 | 84 |
| 188 | 3300006058 | Ga0075432_10000355 | Ga0075432_1000035511 | 84 |
| 189 | 3300006177 | Ga0075362_10000022 | Ga0075362_1000002264 | 84 |
| 190 | 3300006177 | Ga0075362_10037869 | Ga0075362_100378692 | 84 |
| 191 | 3300006186 | Ga0075369_10008020 | Ga0075369_100080203 | 84 |
| 192 | 3300006186 | Ga0075369_10336918 | Ga0075369_103369181 | 84 |
| 193 | 3300006195 | Ga0075366_10000034 | Ga0075366_1000003410 | 84 |
| 194 | 3300006195 | Ga0075366_10242371 | Ga0075366_102423712 | 84 |
| 195 | 3300006195 | Ga0075366_10538452 | Ga0075366_105384522 | 84 |
| 196 | 3300006237 | Ga0097621_100010279 | Ga0097621_1000102795 | 84 |
| 197 | 3300006353 | Ga0075370_10106541 | Ga0075370_101065412 | 84 |
| 198 | 3300006353 | Ga0075370_10205065 | Ga0075370_102050652 | 84 |
| 199 | 3300006358 | Ga0068871_100100710 | Ga0068871_1001007103 | 84 |
| 200 | 3300006358 | Ga0068871_101258633 | Ga0068871_1012586332 | 84 |
| 201 | 3300006931 | Ga0097620_100805586 | Ga0097620_1008055862 | 84 |
| 202 | 3300006931 | Ga0097620_101749985 | Ga0097620_1017499852 | 84 |
| 203 | 3300006931 | Ga0097620_103009555 | Ga0097620_1030095552 | 84 |
| 204 | 3300009011 | Ga0105251_10003813 | Ga0105251_1000381311 | 84 |
| 205 | 3300009011 | Ga0105251_10079743 | Ga0105251_100797432 | 84 |
| 206 | 3300009092 | Ga0105250_10047371 | Ga0105250_100473711 | 84 |
| 207 | 3300009093 | Ga0105240_10174154 | Ga0105240_101741543 | 84 |
| 208 | 3300009093 | Ga0105240_10893339 | Ga0105240_108933391 | 84 |
| 209 | 3300009094 | Ga0111539_10361450 | Ga0111539_103614502 | 84 |
| 210 | 3300009101 | Ga0105247_10192536 | Ga0105247_101925362 | 84 |
| 211 | 3300009101 | Ga0105247_10205835 | Ga0105247_102058352 | 84 |
| 212 | 3300009174 | Ga0105241_10118578 | Ga0105241_101185782 | 84 |
| 213 | 3300009174 | Ga0105241_10281528 | Ga0105241_102815282 | 84 |
| 214 | 3300009177 | Ga0105248_10082606 | Ga0105248_100826061 | 84 |
| 215 | 3300009177 | Ga0105248_10168254 | Ga0105248_101682542 | 84 |
| 216 | 3300009177 | Ga0105248_10665962 | Ga0105248_106659622 | 84 |
| 217 | 3300009177 | Ga0105248_11177741 | Ga0105248_111777411 | 84 |
| 218 | 3300009545 | Ga0105237_10591580 | Ga0105237_105915801 | 84 |
| 219 | 3300009545 | Ga0105237_11289320 | Ga0105237_112893202 | 84 |
| 220 | 3300009545 | Ga0105237_11537421 | Ga0105237_115374211 | 84 |
| 221 | 3300009551 | Ga0105238_10093154 | Ga0105238_100931542 | 84 |
| 222 | 3300009551 | Ga0105238_10302993 | Ga0105238_103029933 | 84 |
| 223 | 3300009551 | Ga0105238_10345606 | Ga0105238_103456062 | 84 |
| 224 | 3300009551 | Ga0105238_12189383 | Ga0105238_121893832 | 84 |
| 225 | 3300009553 | Ga0105249_10192944 | Ga0105249_101929441 | 84 |
| 226 | 3300010375 | Ga0105239_10344439 | Ga0105239_103444392 | 84 |
| 227 | 3300013100 | Ga0157373_10202528 | Ga0157373_102025282 | 84 |
| 228 | 3300013104 | Ga0157370_10000069 | Ga0157370_100000695 | 84 |
| 229 | 3300013104 | Ga0157370_10910471 | Ga0157370_109104711 | 84 |
| 230 | 3300013105 | Ga0157369_10012079 | Ga0157369_100120796 | 84 |
| 231 | 3300013296 | Ga0157374_10080778 | Ga0157374_100807783 | 84 |
| 232 | 3300013306 | Ga0163162_10016336 | Ga0163162_100163365 | 84 |
| 233 | 3300013306 | Ga0163162_10296576 | Ga0163162_102965762 | 84 |
| 234 | 3300013306 | Ga0163162_10309189 | Ga0163162_103091892 | 84 |
| 235 | 3300013306 | Ga0163162_12903952 | Ga0163162_129039521 | 84 |
| 236 | 3300013307 | Ga0157372_10183744 | Ga0157372_101837442 | 84 |
| 237 | 3300013307 | Ga0157372_10984317 | Ga0157372_109843171 | 84 |
| 238 | 3300013307 | Ga0157372_12109862 | Ga0157372_121098622 | 84 |
| 239 | 3300013307 | Ga0157372_12936635 | Ga0157372_129366352 | 84 |
| 240 | 3300013307 | Ga0157372_12965051 | Ga0157372_129650512 | 84 |
| 241 | 3300014326 | Ga0157380_10308282 | Ga0157380_103082822 | 84 |
| 242 | 3300014326 | Ga0157380_11474589 | Ga0157380_114745891 | 84 |
| 243 | 3300014326 | Ga0157380_12891824 | Ga0157380_128918241 | 84 |
| 244 | 3300017792 | Ga0163161_10020586 | Ga0163161_100205862 | 84 |
| 245 | 3300017792 | Ga0163161_11448941 | Ga0163161_114489412 | 84 |
| 246 | 3300021384 | Ga0213876_10311492 | Ga0213876_103114922 | 84 |
| 247 | 3300025231 | Ga0207427_101209 | Ga0207427_1012099 | 84 |
| 248 | 3300025254 | Ga0209148_1000238 | Ga0209148_10002384 | 84 |
| 249 | 3300025261 | Ga0209233_1000079 | Ga0209233_1000079150 | 84 |
| 250 | 3300025272 | Ga0209455_1016220 | Ga0209455_10162202 | 84 |
| 251 | 3300025321 | Ga0207656_10470501 | Ga0207656_104705011 | 84 |
| 252 | 3300025711 | Ga0207696_1005241 | Ga0207696_10052411 | 84 |
| 253 | 3300025735 | Ga0207713_1006081 | Ga0207713_10060816 | 84 |
| 254 | 3300025735 | Ga0207713_1033475 | Ga0207713_10334752 | 84 |
| 255 | 3300025893 | Ga0207682_10061578 | Ga0207682_100615783 | 84 |
| 256 | 3300025900 | Ga0207710_10156125 | Ga0207710_101561252 | 84 |
| 257 | 3300025900 | Ga0207710_10239359 | Ga0207710_102393592 | 84 |
| 258 | 3300025903 | Ga0207680_10147441 | Ga0207680_101474413 | 84 |
| 259 | 3300025903 | Ga0207680_10299148 | Ga0207680_102991482 | 84 |
| 260 | 3300025904 | Ga0207647_10019760 | Ga0207647_100197603 | 84 |
| 261 | 3300025904 | Ga0207647_10078881 | Ga0207647_100788812 | 84 |
| 262 | 3300025904 | Ga0207647_10108014 | Ga0207647_101080141 | 84 |
| 263 | 3300025904 | Ga0207647_10672691 | Ga0207647_106726912 | 84 |
| 264 | 3300025907 | Ga0207645_10357318 | Ga0207645_103573181 | 84 |
| 265 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004375 | 84 |
| 266 | 3300025909 | Ga0207705_10000076 | Ga0207705_1000007617 | 84 |
| 267 | 3300025909 | Ga0207705_10090209 | Ga0207705_100902092 | 84 |
| 268 | 3300025909 | Ga0207705_11366094 | Ga0207705_113660941 | 84 |
| 269 | 3300025911 | Ga0207654_10148089 | Ga0207654_101480892 | 84 |
| 270 | 3300025911 | Ga0207654_10413500 | Ga0207654_104135002 | 84 |
| 271 | 3300025913 | Ga0207695_10022234 | Ga0207695_100222342 | 84 |
| 272 | 3300025913 | Ga0207695_10561899 | Ga0207695_105618992 | 84 |
| 273 | 3300025913 | Ga0207695_11046316 | Ga0207695_110463161 | 84 |
| 274 | 3300025914 | Ga0207671_10676759 | Ga0207671_106767592 | 84 |
| 275 | 3300025919 | Ga0207657_10030317 | Ga0207657_100303172 | 84 |
| 276 | 3300025919 | Ga0207657_10117913 | Ga0207657_101179132 | 84 |
| 277 | 3300025919 | Ga0207657_10613597 | Ga0207657_106135971 | 84 |
| 278 | 3300025920 | Ga0207649_10180550 | Ga0207649_101805502 | 84 |
| 279 | 3300025920 | Ga0207649_11322367 | Ga0207649_113223671 | 84 |
| 280 | 3300025923 | Ga0207681_10000444 | Ga0207681_1000044435 | 84 |
| 281 | 3300025923 | Ga0207681_10000798 | Ga0207681_1000079811 | 84 |
| 282 | 3300025923 | Ga0207681_10217206 | Ga0207681_102172061 | 84 |
| 283 | 3300025923 | Ga0207681_10252933 | Ga0207681_102529332 | 84 |
| 284 | 3300025923 | Ga0207681_10834082 | Ga0207681_108340822 | 84 |
| 285 | 3300025924 | Ga0207694_10056708 | Ga0207694_100567083 | 84 |
| 286 | 3300025924 | Ga0207694_10826168 | Ga0207694_108261682 | 84 |
| 287 | 3300025925 | Ga0207650_10291636 | Ga0207650_102916362 | 84 |
| 288 | 3300025925 | Ga0207650_10398367 | Ga0207650_103983672 | 84 |
| 289 | 3300025926 | Ga0207659_10033379 | Ga0207659_100333793 | 84 |
| 290 | 3300025931 | Ga0207644_10010082 | Ga0207644_100100823 | 84 |
| 291 | 3300025931 | Ga0207644_10184727 | Ga0207644_101847272 | 84 |
| 292 | 3300025931 | Ga0207644_10239382 | Ga0207644_102393823 | 84 |
| 293 | 3300025931 | Ga0207644_10413206 | Ga0207644_104132061 | 84 |
| 294 | 3300025932 | Ga0207690_10209833 | Ga0207690_102098332 | 84 |
| 295 | 3300025932 | Ga0207690_10433975 | Ga0207690_104339751 | 84 |
| 296 | 3300025933 | Ga0207706_10494539 | Ga0207706_104945392 | 84 |
| 297 | 3300025937 | Ga0207669_10268908 | Ga0207669_102689082 | 84 |
| 298 | 3300025940 | Ga0207691_10280177 | Ga0207691_102801772 | 84 |
| 299 | 3300025940 | Ga0207691_10723158 | Ga0207691_107231581 | 84 |
| 300 | 3300025940 | Ga0207691_10957634 | Ga0207691_109576342 | 84 |
| 301 | 3300025941 | Ga0207711_10032949 | Ga0207711_100329494 | 84 |
| 302 | 3300025941 | Ga0207711_10202592 | Ga0207711_102025922 | 84 |
| 303 | 3300025941 | Ga0207711_11720947 | Ga0207711_117209471 | 84 |
| 304 | 3300025949 | Ga0207667_10002169 | Ga0207667_1000216919 | 84 |
| 305 | 3300025949 | Ga0207667_10013495 | Ga0207667_100134952 | 84 |
| 306 | 3300025949 | Ga0207667_10064099 | Ga0207667_100640992 | 84 |
| 307 | 3300025949 | Ga0207667_10209914 | Ga0207667_102099142 | 84 |
| 308 | 3300025949 | Ga0207667_11004748 | Ga0207667_110047481 | 84 |
| 309 | 3300025961 | Ga0207712_10121665 | Ga0207712_101216652 | 84 |
| 310 | 3300025972 | Ga0207668_10042927 | Ga0207668_100429273 | 84 |
| 311 | 3300025972 | Ga0207668_10116555 | Ga0207668_101165552 | 84 |
| 312 | 3300025972 | Ga0207668_10859938 | Ga0207668_108599382 | 84 |
| 313 | 3300025981 | Ga0207640_10000063 | Ga0207640_1000006372 | 84 |
| 314 | 3300025981 | Ga0207640_10032317 | Ga0207640_100323172 | 84 |
| 315 | 3300025981 | Ga0207640_10045421 | Ga0207640_100454213 | 84 |
| 316 | 3300025986 | Ga0207658_10001044 | Ga0207658_1000104416 | 84 |
| 317 | 3300025986 | Ga0207658_10007814 | Ga0207658_100078142 | 84 |
| 318 | 3300025986 | Ga0207658_10010022 | Ga0207658_100100222 | 84 |
| 319 | 3300025986 | Ga0207658_10016276 | Ga0207658_100162762 | 84 |
| 320 | 3300025986 | Ga0207658_10754996 | Ga0207658_107549961 | 84 |
| 321 | 3300026035 | Ga0207703_10001270 | Ga0207703_100012702 | 84 |
| 322 | 3300026035 | Ga0207703_10098131 | Ga0207703_100981313 | 84 |
| 323 | 3300026041 | Ga0207639_10003454 | Ga0207639_100034547 | 84 |
| 324 | 3300026041 | Ga0207639_10107202 | Ga0207639_101072021 | 84 |
| 325 | 3300026041 | Ga0207639_10228776 | Ga0207639_102287762 | 84 |
| 326 | 3300026041 | Ga0207639_11060173 | Ga0207639_110601731 | 84 |
| 327 | 3300026067 | Ga0207678_10006049 | Ga0207678_100060497 | 84 |
| 328 | 3300026067 | Ga0207678_10209139 | Ga0207678_102091393 | 84 |
| 329 | 3300026078 | Ga0207702_10100850 | Ga0207702_101008503 | 84 |
| 330 | 3300026078 | Ga0207702_10201008 | Ga0207702_102010082 | 84 |
| 331 | 3300026088 | Ga0207641_10000198 | Ga0207641_1000019872 | 84 |
| 332 | 3300026088 | Ga0207641_10003709 | Ga0207641_100037092 | 84 |
| 333 | 3300026088 | Ga0207641_10016064 | Ga0207641_100160642 | 84 |
| 334 | 3300026088 | Ga0207641_10231376 | Ga0207641_102313762 | 84 |
| 335 | 3300026095 | Ga0207676_10005212 | Ga0207676_100052122 | 84 |
| 336 | 3300026095 | Ga0207676_12351381 | Ga0207676_123513811 | 84 |
| 337 | 3300026116 | Ga0207674_10230960 | Ga0207674_102309602 | 84 |
| 338 | 3300026116 | Ga0207674_11524884 | Ga0207674_115248841 | 84 |
| 339 | 3300026142 | Ga0207698_10000177 | Ga0207698_1000017711 | 84 |
| 340 | 3300026142 | Ga0207698_10019802 | Ga0207698_100198026 | 84 |
| 341 | 3300026142 | Ga0207698_10250029 | Ga0207698_102500292 | 84 |
| 342 | 3300026142 | Ga0207698_10857612 | Ga0207698_108576121 | 84 |
| 343 | 3300027462 | Ga0210000_1043604 | Ga0210000_10436041 | 84 |
| 344 | 3300027665 | Ga0209983_1052771 | Ga0209983_10527712 | 84 |
| 345 | 3300027876 | Ga0209974_10005438 | Ga0209974_100054385 | 84 |
| 346 | 3300028379 | Ga0268266_10000354 | Ga0268266_1000035451 | 84 |
| 347 | 3300028379 | Ga0268266_10017410 | Ga0268266_100174103 | 84 |
| 348 | 3300028379 | Ga0268266_10021606 | Ga0268266_100216061 | 84 |
| 349 | 3300028379 | Ga0268266_10046667 | Ga0268266_100466672 | 84 |
| 350 | 3300028380 | Ga0268265_10022535 | Ga0268265_100225352 | 84 |
| 351 | 3300028380 | Ga0268265_10077074 | Ga0268265_100770742 | 84 |
| 352 | 3300028380 | Ga0268265_10476199 | Ga0268265_104761992 | 84 |
| 353 | 3300028381 | Ga0268264_10000018 | Ga0268264_10000018433 | 84 |
| 354 | 3300028381 | Ga0268264_10034602 | Ga0268264_100346024 | 84 |
| 355 | 3300028381 | Ga0268264_10063371 | Ga0268264_100633712 | 84 |
| 356 | 3300028381 | Ga0268264_10300346 | Ga0268264_103003462 | 84 |
| 357 | 3300028794 | Ga0307515_10321016 | Ga0307515_103210162 | 84 |
| 358 | 3300031250 | Ga0265331_10045016 | Ga0265331_100450161 | 84 |
| 359 | 3300031548 | Ga0307408_101031487 | Ga0307408_1010314872 | 84 |
| 360 | 3300031728 | Ga0316578_10245466 | Ga0316578_102454662 | 84 |
| 361 | 3300031731 | Ga0307405_10029177 | Ga0307405_100291775 | 84 |
| 362 | 3300031731 | Ga0307405_10077990 | Ga0307405_100779903 | 84 |
| 363 | 3300031731 | Ga0307405_11451242 | Ga0307405_114512422 | 84 |
| 364 | 3300031824 | Ga0307413_10147315 | Ga0307413_101473154 | 84 |
| 365 | 3300031824 | Ga0307413_10858238 | Ga0307413_108582382 | 84 |
| 366 | 3300031824 | Ga0307413_10886421 | Ga0307413_108864212 | 84 |
| 367 | 3300031824 | Ga0307413_11104490 | Ga0307413_111044901 | 84 |
| 368 | 3300031824 | Ga0307413_11856967 | Ga0307413_118569672 | 84 |
| 369 | 3300031852 | Ga0307410_10397252 | Ga0307410_103972522 | 84 |
| 370 | 3300031852 | Ga0307410_10748696 | Ga0307410_107486961 | 84 |
| 371 | 3300031852 | Ga0307410_11050062 | Ga0307410_110500622 | 84 |
| 372 | 3300031852 | Ga0307410_11343112 | Ga0307410_113431121 | 84 |
| 373 | 3300031852 | Ga0307410_12020770 | Ga0307410_120207702 | 84 |
| 374 | 3300031901 | Ga0307406_10925553 | Ga0307406_109255532 | 84 |
| 375 | 3300031903 | Ga0307407_10287224 | Ga0307407_102872242 | 84 |
| 376 | 3300031903 | Ga0307407_11032494 | Ga0307407_110324942 | 84 |
| 377 | 3300031911 | Ga0307412_10043863 | Ga0307412_100438631 | 84 |
| 378 | 3300031911 | Ga0307412_10224495 | Ga0307412_102244952 | 84 |
| 379 | 3300031911 | Ga0307412_11430670 | Ga0307412_114306702 | 84 |
| 380 | 3300031911 | Ga0307412_11591209 | Ga0307412_115912092 | 84 |
| 381 | 3300031995 | Ga0307409_100419784 | Ga0307409_1004197842 | 84 |
| 382 | 3300031995 | Ga0307409_100534188 | Ga0307409_1005341882 | 84 |
| 383 | 3300031995 | Ga0307409_100706471 | Ga0307409_1007064711 | 84 |
| 384 | 3300031995 | Ga0307409_102647105 | Ga0307409_1026471051 | 84 |
| 385 | 3300032002 | Ga0307416_101845808 | Ga0307416_1018458081 | 84 |
| 386 | 3300032002 | Ga0307416_102032160 | Ga0307416_1020321602 | 84 |
| 387 | 3300032004 | Ga0307414_10034062 | Ga0307414_100340622 | 84 |
| 388 | 3300032004 | Ga0307414_10199380 | Ga0307414_101993802 | 84 |
| 389 | 3300032004 | Ga0307414_10523481 | Ga0307414_105234812 | 84 |
| 390 | 3300032004 | Ga0307414_10661470 | Ga0307414_106614703 | 84 |
| 391 | 3300032004 | Ga0307414_10673309 | Ga0307414_106733093 | 84 |
| 392 | 3300032004 | Ga0307414_11045100 | Ga0307414_110451002 | 84 |
| 393 | 3300032004 | Ga0307414_11468099 | Ga0307414_114680992 | 84 |
| 394 | 3300032005 | Ga0307411_10120547 | Ga0307411_101205472 | 84 |
| 395 | 3300032005 | Ga0307411_10125634 | Ga0307411_101256342 | 84 |
| 396 | 3300032005 | Ga0307411_10902488 | Ga0307411_109024882 | 84 |
| 397 | 3300032126 | Ga0307415_100182258 | Ga0307415_1001822582 | 84 |
| 398 | 3300032133 | Ga0316583_10003370 | Ga0316583_100033703 | 84 |
| 399 | 3300035398 | Ga0316574_0468711 | Ga0316574_0468711_293_553 | 84 |
| 400 | 3300036647 | Ga0316582_0032089 | Ga0316582_0032089_2856_3113 | 84 |
| 401 | 3300036712 | Ga0316584_0342664 | Ga0316584_0342664_130_387 | 84 |
| 402 | 3300036712 | Ga0316584_0397088 | Ga0316584_0397088_615_872 | 84 |
| 403 | 3300036712 | Ga0316584_1000320 | Ga0316584_1000320_92_349 | 84 |
| 404 | 3300037312 | Ga0395899_0003766 | Ga0395899_0003766_8604_8873 | 84 |
| 405 | 3300037418 | Ga0395900_0511270 | Ga0395900_0511270_403_672 | 84 |
| 406 | 3300037418 | Ga0395900_0573966 | Ga0395900_0573966_552_815 | 84 |
| 407 | 3300037418 | Ga0395900_1324974 | Ga0395900_1324974_331_594 | 84 |
| 408 | 3300037471 | Ga0395905_1184212 | Ga0395905_1184212_83_352 | 84 |
| 409 | 3300038443 | Ga0395901_0249242 | Ga0395901_0249242_420_689 | 84 |
| 410 | 3300039437 | Ga0436365_1372378 | Ga0436365_1372378_278_535 | 84 |
| 411 | 3300039437 | Ga0436365_1668286 | Ga0436365_1668286_145_402 | 84 |
| 412 | 3300041486 | Ga0451807_0941463 | Ga0451807_0941463_137_394 | 84 |
| 413 | 3300041496 | Ga0451839_1283613 | Ga0451839_1283613_144_401 | 84 |
| 414 | 3300041498 | Ga0451841_0662214 | Ga0451841_0662214_377_634 | 84 |
| 415 | 3300041498 | Ga0451841_0756227 | Ga0451841_0756227_111_368 | 84 |
| 416 | 3300041505 | Ga0451849_0265780 | Ga0451849_0265780_334_591 | 84 |
| 417 | 3300041507 | Ga0451851_0872115 | Ga0451851_0872115_79_336 | 84 |
| 418 | 3300041512 | Ga0451853_1262340 | Ga0451853_1262340_72_329 | 84 |
| 419 | 3300041512 | Ga0451853_3327244 | Ga0451853_3327244_266_523 | 84 |
| 420 | 3300041997 | Ga0439431_0059657 | Ga0439431_0059657_492_749 | 84 |
| 421 | 3300042116 | Ga0450912_021326 | Ga0450912_021326_240_497 | 84 |
| 422 | 3300042123 | Ga0450921_019743 | Ga0450921_019743_54_311 | 84 |
| 423 | 3300042129 | Ga0450891_037010 | Ga0450891_037010_224_481 | 84 |
| 424 | 3300044712 | Ga0453684_0103485 | Ga0453684_0103485_2908_3165 | 84 |
| 425 | 3300045051 | Ga0451576_0022769 | Ga0451576_0022769_3429_3686 | 84 |
| 426 | 3300046453 | Ga0495627_001378 | Ga0495627_001378_10422_10679 | 84 |
| 427 | 3300046471 | Ga0495650_0004010 | Ga0495650_0004010_6345_6602 | 84 |
| 428 | 3300046474 | Ga0495605_0079546 | Ga0495605_0079546_265_522 | 84 |
| 429 | 3300046500 | Ga0495596_0000113 | Ga0495596_0000113_3556_3813 | 84 |
| 430 | 3300046501 | Ga0495607_0029066 | Ga0495607_0029066_55_312 | 84 |
| 431 | 3300046501 | Ga0495607_0175152 | Ga0495607_0175152_731_988 | 84 |
| 432 | 3300046506 | Ga0495583_0276382 | Ga0495583_0276382_51_308 | 84 |
| 433 | 3300046512 | Ga0495610_0000018 | Ga0495610_0000018_171484_171741 | 84 |
| 434 | 3300046515 | Ga0495620_0028498 | Ga0495620_0028498_2228_2485 | 84 |
| 435 | 3300046519 | Ga0495632_0022034 | Ga0495632_0022034_255_512 | 84 |
| 436 | 3300046522 | Ga0495643_0000217 | Ga0495643_0000217_83728_83985 | 84 |
| 437 | 3300046522 | Ga0495643_0016799 | Ga0495643_0016799_3002_3259 | 84 |
| 438 | 3300046522 | Ga0495643_0189614 | Ga0495643_0189614_391_648 | 84 |
| 439 | 3300046538 | Ga0495609_0069851 | Ga0495609_0069851_719_976 | 84 |
| 440 | 3300046539 | Ga0495621_0005243 | Ga0495621_0005243_2433_2687 | 84 |
| 441 | 3300046660 | Ga0495625_0027605 | Ga0495625_0027605_1668_1925 | 84 |
| 442 | 3300046692 | Ga0495671_0177971 | Ga0495671_0177971_30_287 | 84 |
| 443 | 3300047323 | Ga0495683_0196881 | Ga0495683_0196881_74_331 | 84 |
| 444 | 3300047469 | Ga0495673_0343340 | Ga0495673_0343340_25_282 | 84 |
| 445 | 3300047470 | Ga0495681_0000792 | Ga0495681_0000792_13658_13915 | 84 |
| 446 | 3300048090 | Ga0495615_0000113 | Ga0495615_0000113_20124_20381 | 84 |
| 447 | 3300048903 | Ga0496100_0009680 | Ga0496100_0009680_2058_2312 | 84 |
| 448 | 3300048904 | Ga0496101_0836378 | Ga0496101_0836378_269_523 | 84 |
| 449 | 3300048905 | Ga0496102_0012000 | Ga0496102_0012000_3542_3796 | 84 |
| 450 | 3300048905 | Ga0496102_0345842 | Ga0496102_0345842_744_1001 | 84 |
| 451 | 3300048905 | Ga0496102_0844509 | Ga0496102_0844509_397_654 | 84 |
| 452 | 3300048906 | Ga0496103_0000081 | Ga0496103_0000081_3739_3993 | 84 |
| 453 | 3300048906 | Ga0496103_0188910 | Ga0496103_0188910_120_377 | 84 |
| 454 | 3300048907 | Ga0496104_0043737 | Ga0496104_0043737_2209_2463 | 84 |
| 455 | 3300048907 | Ga0496104_0094946 | Ga0496104_0094946_2093_2350 | 84 |
| 456 | 3300048908 | Ga0496105_0022181 | Ga0496105_0022181_2029_2283 | 84 |
| 457 | 3300048908 | Ga0496105_0040467 | Ga0496105_0040467_128_385 | 84 |
| 458 | 3300048910 | Ga0496107_0662264 | Ga0496107_0662264_368_622 | 84 |
| 459 | 3300048913 | Ga0496110_1298700 | Ga0496110_1298700_121_375 | 84 |
| 460 | 3300048914 | Ga0496111_0890057 | Ga0496111_0890057_164_418 | 84 |
| 461 | 3300048916 | Ga0496113_0205129 | Ga0496113_0205129_1273_1527 | 84 |
| 462 | 3300048916 | Ga0496113_0385744 | Ga0496113_0385744_760_1014 | 84 |
| 463 | 3300048916 | Ga0496113_0592594 | Ga0496113_0592594_337_600 | 84 |
| 464 | 3300048917 | Ga0496114_0034544 | Ga0496114_0034544_3785_4039 | 84 |
| 465 | 3300048918 | Ga0496115_0879009 | Ga0496115_0879009_104_358 | 84 |
| 466 | 3300048919 | Ga0496116_0160592 | Ga0496116_0160592_910_1164 | 84 |
| 467 | 3300048920 | Ga0496117_0010088 | Ga0496117_0010088_4835_5089 | 84 |
| 468 | 3300048920 | Ga0496117_0225934 | Ga0496117_0225934_87_344 | 84 |
| 469 | 3300048921 | Ga0496118_0059496 | Ga0496118_0059496_386_643 | 84 |
| 470 | 3300048921 | Ga0496118_0093553 | Ga0496118_0093553_1376_1630 | 84 |
| 471 | 3300048921 | Ga0496118_0134474 | Ga0496118_0134474_1077_1334 | 84 |
| 472 | 3300048922 | Ga0496119_0022504 | Ga0496119_0022504_3640_3894 | 84 |
| 473 | 3300048923 | Ga0496120_0022329 | Ga0496120_0022329_2190_2444 | 84 |
| 474 | 3300048924 | Ga0496121_0000021 | Ga0496121_0000021_356257_356514 | 84 |
| 475 | 3300048924 | Ga0496121_0001016 | Ga0496121_0001016_3401_3658 | 84 |
| 476 | 3300048924 | Ga0496121_0020181 | Ga0496121_0020181_2979_3233 | 84 |
| 477 | 3300048924 | Ga0496121_0100988 | Ga0496121_0100988_1219_1476 | 84 |
| 478 | 3300048925 | Ga0496122_0026363 | Ga0496122_0026363_3406_3660 | 84 |
| 479 | 3300048925 | Ga0496122_0027958 | Ga0496122_0027958_3150_3407 | 84 |
| 480 | 3300048925 | Ga0496122_0618585 | Ga0496122_0618585_124_381 | 84 |
| 481 | 3300048926 | Ga0496123_0006131 | Ga0496123_0006131_9018_9275 | 84 |
| 482 | 3300048926 | Ga0496123_0049053 | Ga0496123_0049053_764_1021 | 84 |
| 483 | 3300048926 | Ga0496123_0068111 | Ga0496123_0068111_451_705 | 84 |
| 484 | 3300048927 | Ga0496124_0009285 | Ga0496124_0009285_8903_9157 | 84 |
| 485 | 3300048927 | Ga0496124_0070953 | Ga0496124_0070953_2502_2759 | 84 |
| 486 | 3300048927 | Ga0496124_0486385 | Ga0496124_0486385_326_583 | 84 |
| 487 | 3300048927 | Ga0496124_0702969 | Ga0496124_0702969_221_478 | 84 |
| 488 | 3300048928 | Ga0496125_0003360 | Ga0496125_0003360_640_894 | 84 |
| 489 | 3300048928 | Ga0496125_0028306 | Ga0496125_0028306_4624_4881 | 84 |
| 490 | 3300048929 | Ga0496126_0000028 | Ga0496126_0000028_195653_195907 | 84 |
| 491 | 3300048929 | Ga0496126_0043461 | Ga0496126_0043461_3881_4135 | 84 |
| 492 | 3300048929 | Ga0496126_0045167 | Ga0496126_0045167_437_694 | 84 |
| 493 | 3300049127 | Ga0501306_014832 | Ga0501306_014832_166_420 | 84 |
| 494 | 3300049569 | Ga0501032_0779476 | Ga0501032_0779476_191_445 | 84 |
| 495 | 3300049571 | Ga0501034_0578143 | Ga0501034_0578143_168_425 | 84 |
| 496 | 3300049575 | Ga0501039_0297979 | Ga0501039_0297979_69_326 | 84 |
| 497 | 3300049575 | Ga0501039_0704816 | Ga0501039_0704816_308_562 | 84 |
| 498 | 3300049578 | Ga0501042_0201556 | Ga0501042_0201556_328_585 | 84 |
| 499 | 3300049586 | Ga0501070_0614950 | Ga0501070_0614950_20_274 | 84 |
| 500 | 3300049663 | Ga0501223_142054 | Ga0501223_142054_67_324 | 84 |
| 501 | 3300049664 | Ga0501224_052401 | Ga0501224_052401_47_301 | 84 |
| 502 | 3300049679 | Ga0501249_039421 | Ga0501249_039421_625_879 | 84 |
| 503 | 3300049683 | Ga0501253_041244 | Ga0501253_041244_622_876 | 84 |
| 504 | 3300049765 | Ga0501268_044031 | Ga0501268_044031_159_413 | 84 |
| 505 | 3300049823 | Ga0501044_0074168 | Ga0501044_0074168_437_691 | 84 |
| 506 | 3300049823 | Ga0501044_0182431 | Ga0501044_0182431_1545_1802 | 84 |
| 507 | 3300050489 | nmdc:mga03683_375711_c1 | nmdc:mga03683_375711_c1_17_271 | 84 |
| 508 | 3300050489 | nmdc:mga03683_42_c1 | nmdc:mga03683_42_c1_24833_25090 | 84 |
| 509 | 3300050489 | nmdc:mga03683_7634_c1 | nmdc:mga03683_7634_c1_827_1081 | 84 |
| 510 | 3300050490 | nmdc:mga03n38_959_c1 | nmdc:mga03n38_959_c1_7437_7694 | 84 |
| 511 | 3300050491 | nmdc:mga00v17_136091_c1 | nmdc:mga00v17_136091_c1_310_567 | 84 |
| 512 | 3300050491 | nmdc:mga00v17_25342_c1 | nmdc:mga00v17_25342_c1_501_755 | 84 |
| 513 | 3300050493 | nmdc:mga0k408_3_c1 | nmdc:mga0k408_3_c1_94224_94481 | 84 |
| 514 | 3300050493 | nmdc:mga0k408_411782_c1 | nmdc:mga0k408_411782_c1_46_300 | 84 |
| 515 | 3300050496 | nmdc:mga07m45_371029_c1 | nmdc:mga07m45_371029_c1_360_614 | 84 |
| 516 | 3300050511 | nmdc:mga08y16_314576_c1 | nmdc:mga08y16_314576_c1_1037_1294 | 84 |
| 517 | 3300050516 | nmdc:mga0sz30_14903_c1 | nmdc:mga0sz30_14903_c1_126_380 | 84 |
| 518 | 3300050516 | nmdc:mga0sz30_3181_c1 | nmdc:mga0sz30_3181_c1_3480_3737 | 84 |
| 519 | 3300053121 | Ga0500607_033455 | Ga0500607_033455_2184_2441 | 84 |
| 520 | 3300053125 | Ga0500618_004249 | Ga0500618_004249_1111_1368 | 84 |
| 521 | 3300053139 | Ga0500568_0291104 | Ga0500568_0291104_120_374 | 84 |
| 522 | 3300053148 | Ga0500590_148733 | Ga0500590_148733_726_983 | 84 |
| 523 | 3300053154 | Ga0500619_272223 | Ga0500619_272223_184_441 | 84 |
| 524 | 3300053178 | Ga0500637_0562455 | Ga0500637_0562455_277_534 | 84 |
| 525 | 3300059477 | Ga0587084_004794 | Ga0587084_004794_1298_1555 | 84 |
| 526 | 3300059510 | Ga0587090_000073 | Ga0587090_000073_804_1061 | 84 |
| 527 | 3300059626 | Ga0587115_012981 | Ga0587115_012981_16_273 | 84 |
| 528 | 3300059645 | Ga0587076_012545 | Ga0587076_012545_16_273 | 84 |
| 529 | 3300060346 | Ga0587111_0062462 | Ga0587111_0062462_16_273 | 84 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zwl-assembly1.cif.gz_E | crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial f1-atpase | 0.9528 | 2 | 83 |
| 6fkh-assembly1.cif.gz_e | chloroplast f1fo conformation 2 | 0.9393 | 2 | 83 |
| 6q45-assembly2.cif.gz_P | f1-atpase from fusobacterium nucleatum | 0.9219 | 2 | 83 |
| 5hkk-assembly2.cif.gz_P | caldalaklibacillus thermarum f1-atpase (wild type) | 0.9208 | 1 | 83 |
| 6n2z-assembly1.cif.gz_H | bacillus ps3 atp synthase class 2 | 0.9198 | 2 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2e5yB01 | Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal | 0.9567 | 2 | 83 | 2.60.15.10 |
| af_Q2FWF1_1_89_2.60.15.10 | Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal | 0.9238 | 2 | 83 | 2.60.15.10 |
| 1aqtA01 | Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal | 0.9153 | 2 | 83 | 2.60.15.10 |
| 5dn6I00 | Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal | 0.9137 | 7 | 79 | 2.60.15.10 |
| af_P9WPV1_1_120_2.60.15.10 | Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal | 0.9117 | 2 | 83 | 2.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A196MK06-F1-model_v4 | ATP synthase F1 subunit epsilon | 1.007 | 2 | 83 |
GO:0012505
GO:0045261 GO:0046933 |
| AF-T0IQ26-F1-model_v4 | ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) | 1.007 | 2 | 83 |
GO:0005524
GO:0005886 GO:0012505 GO:0016787 GO:0045261 GO:0046933 |
| AF-A0A0N1L3H5-F1-model_v4 | ATP synthase F0F1 subunit epsilon (EC 3.6.3.14) | 1.006 | 1 | 84 |
GO:0012505
GO:0016787 GO:0045261 GO:0046933 |
| AF-A0A0B2C3L1-F1-model_v4 | ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) | 1.006 | 2 | 84 |
GO:0005524
GO:0005886 GO:0012505 GO:0016787 GO:0045261 GO:0046933 |
| AF-A0A7W7EZJ8-F1-model_v4 | F-type H+-transporting ATPase subunit epsilon | 1.005 | 2 | 83 |
GO:0012505
GO:0045261 GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar