F459786

General Info

Members Datasets Scaffolds Average Seq Length
529 272 503 85

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100023920|Ga0068862_1000239202
Length 97
Sequence MRTLGQSEGHSTMALHFELVTPARLVRSEEVHMVVIPGTEGEMGVLQGHAPFMTTIKDGALKVYRSENGAPEEIQIQGGFAEVGANGLTVLAEHVEG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
9 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
12 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
13 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
14 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
15 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
16 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
17 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
18 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
19 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
20 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
21 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
22 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
23 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
24 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
25 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
26 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
185 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
186 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
241 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
242 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
243 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
244 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
255 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
258 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
263 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.95
Metatranscriptomes 1.13
Isolates 4.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 9.07
Nodule 0.19
Rhizoplane 4.73
Rhizosphere 73.72
Stem 0
Stem Tuber 0.19
Unclassified 11.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1350033 2162886007 Bacteria 4823
2 SwRhRL2b_contig_1774792 2162886007 Bacteria 15456
3 SwRhRL2b_contig_2932459 2162886007 Bacteria 43460
4 JGI24737J22298_10026213 3300001990 Bacteria 1841
5 JGI24737J22298_10043129 3300001990 Bacteria 1381
6 JGI24737J22298_10124574 3300001990 Bacteria 761
7 JGI24735J21928_10031817 3300002067 Bacteria 1563
8 JGI24735J21928_10033789 3300002067 Bacteria 1510
9 JGI24735J21928_10039541 3300002067 Bacteria 1379
10 JGI24735J21928_10051785 3300002067 Bacteria 1185
11 JGI24735J21928_10063876 3300002067 Bacteria 1057
12 JGI24034J26672_10109369 3300002239 Bacteria 527
13 JGI24742J22300_10128557 3300002244 Bacteria 504
14 JGI24751J29686_10100489 3300002459 Bacteria 604
15 JGI25164J39214_1017967 3300002772 Bacteria 636
16 JGI25165J46597_1000043 3300003214 Bacteria 264515
17 Ga0055542_1005278 3300003762 Bacteria 2948
18 Ga0055530_10022865 3300003791 Bacteria 1810
19 Ga0065704_10000358 3300005289 Bacteria 27729
20 Ga0065707_10085072 3300005295 Bacteria 6490
21 Ga0070658_10003835 3300005327 Bacteria 12319
22 Ga0070658_10095344 3300005327 Bacteria 2456
23 Ga0070658_10203383 3300005327 Bacteria 1671
24 Ga0070658_10666565 3300005327 Bacteria 903
25 Ga0070670_100317010 3300005331 Bacteria 1365
26 Ga0070670_101182245 3300005331 Bacteria 699
27 Ga0070666_10938498 3300005335 Bacteria 640
28 Ga0070682_100715296 3300005337 Bacteria 804
29 Ga0070660_100066378 3300005339 Bacteria 2808
30 Ga0070660_100100194 3300005339 Bacteria 2294
31 Ga0070687_101176791 3300005343 Bacteria 564
32 Ga0070661_100298807 3300005344 Bacteria 1253
33 Ga0070661_101654082 3300005344 Bacteria 542
34 Ga0070668_100062968 3300005347 Bacteria 2875
35 Ga0070668_100167270 3300005347 Bacteria 1788
36 Ga0070668_100243184 3300005347 Bacteria 1491
37 Ga0070668_100756022 3300005347 Bacteria 861
38 Ga0070669_100000200 3300005353 Bacteria 52177
39 Ga0070669_100010144 3300005353 Bacteria 6698
40 Ga0070669_100186315 3300005353 Bacteria 1626
41 Ga0070669_100319735 3300005353 Bacteria 1253
42 Ga0070669_100446953 3300005353 Bacteria 1065
43 Ga0070671_100016012 3300005355 Bacteria 6058
44 Ga0070671_100165508 3300005355 Bacteria 1870
45 Ga0070671_100469955 3300005355 Bacteria 1080
46 Ga0070674_100576472 3300005356 Bacteria 947
47 Ga0070659_100423856 3300005366 Bacteria 1126
48 Ga0070667_100000198 3300005367 Bacteria 71378
49 Ga0070667_100000419 3300005367 Bacteria 45202
50 Ga0070667_100003540 3300005367 Bacteria 13304
51 Ga0070667_100103161 3300005367 Bacteria 2465
52 Ga0070705_100470631 3300005440 Bacteria 947
53 Ga0070705_101534203 3300005440 Bacteria 559
54 Ga0070700_100495194 3300005441 Bacteria 939
55 Ga0070663_100181650 3300005455 Bacteria 1632
56 Ga0070663_100702455 3300005455 Bacteria 860
57 Ga0070662_100493334 3300005457 Bacteria 1021
58 Ga0068853_100000183 3300005539 Bacteria 44130
59 Ga0068853_100014596 3300005539 Bacteria 6441
60 Ga0068853_100047830 3300005539 Bacteria 3671
61 Ga0068853_100084797 3300005539 Bacteria 2776
62 Ga0068853_100123499 3300005539 Bacteria 2312
63 Ga0068853_101254536 3300005539 Bacteria 716
64 Ga0070672_100376552 3300005543 Bacteria 1214
65 Ga0070672_101071455 3300005543 Bacteria 716
66 Ga0070665_100000107 3300005548 Bacteria 156048
67 Ga0070665_100012374 3300005548 Bacteria 8599
68 Ga0070665_100121898 3300005548 Bacteria 2609
69 Ga0070665_100201566 3300005548 Bacteria 1990
70 Ga0068855_100002286 3300005563 Bacteria 23669
71 Ga0068855_100293594 3300005563 Bacteria 1802
72 Ga0068855_100304731 3300005563 Bacteria 1764
73 Ga0068855_100499820 3300005563 Bacteria 1321
74 Ga0068855_100625740 3300005563 Bacteria 1158
75 Ga0068855_100818403 3300005563 Bacteria 989
76 Ga0068855_101808922 3300005563 Bacteria 620
77 Ga0068857_100074314 3300005577 Bacteria 3029
78 Ga0068857_100182571 3300005577 Bacteria 1909
79 Ga0068857_102096217 3300005577 Bacteria 555
80 Ga0068854_100000359 3300005578 Bacteria 29216
81 Ga0068854_100000809 3300005578 Bacteria 18649
82 Ga0068854_100125271 3300005578 Bacteria 1955
83 Ga0068856_100177822 3300005614 Bacteria 2140
84 Ga0068856_100570811 3300005614 Bacteria 1152
85 Ga0068852_100167061 3300005616 Bacteria 2059
86 Ga0068852_100353287 3300005616 Bacteria 1436
87 Ga0068852_101023645 3300005616 Bacteria 845
88 Ga0068859_100805647 3300005617 Bacteria 1027
89 Ga0068859_101750008 3300005617 Bacteria 686
90 Ga0068859_103008942 3300005617 Bacteria 515
91 Ga0068864_100036825 3300005618 Bacteria 4172
92 Ga0068864_100506220 3300005618 Bacteria 1162
93 Ga0068851_10203998 3300005834 Bacteria 1105
94 Ga0068851_10454288 3300005834 Bacteria 762
95 Ga0068851_10568331 3300005834 Bacteria 687
96 Ga0068863_100000196 3300005841 Bacteria 64527
97 Ga0068863_100003687 3300005841 Bacteria 15135
98 Ga0068863_100038746 3300005841 Bacteria 4534
99 Ga0068863_100776883 3300005841 Bacteria 954
100 Ga0068858_100010069 3300005842 Bacteria 8976
101 Ga0068858_100028002 3300005842 Bacteria 5236
102 Ga0068858_100235912 3300005842 Bacteria 1735
103 Ga0068858_102569619 3300005842 Bacteria 503
104 Ga0068860_100000008 3300005843 Bacteria 427367
105 Ga0068860_100008194 3300005843 Bacteria 10402
106 Ga0068860_100042623 3300005843 Bacteria 4333
107 Ga0068860_100173233 3300005843 Bacteria 2085
108 Ga0068860_100208233 3300005843 Bacteria 1897
109 Ga0068860_101001476 3300005843 Bacteria 854
110 Ga0068862_100023920 3300005844 Bacteria 5120
111 Ga0068862_100031863 3300005844 Bacteria 4453
112 Ga0068862_100564283 3300005844 Bacteria 1088
113 Ga0068862_102493850 3300005844 Bacteria 529
114 Ga0075364_10014184 3300006051 Bacteria 4918
115 Ga0075364_10215011 3300006051 Bacteria 1304
116 Ga0075364_10271735 3300006051 Bacteria 1153
117 Ga0075432_10000355 3300006058 Bacteria 13147
118 Ga0075362_10000022 3300006177 Bacteria 62299
119 Ga0075362_10037869 3300006177 Bacteria 2117
120 Ga0075369_10008020 3300006186 Bacteria 4046
121 Ga0075369_10336918 3300006186 Bacteria 707
122 Ga0075366_10000034 3300006195 Bacteria 47623
123 Ga0075366_10242371 3300006195 Bacteria 1099
124 Ga0075366_10538452 3300006195 Bacteria 723
125 Ga0097621_100010279 3300006237 Bacteria 6837
126 Ga0075370_10106541 3300006353 Bacteria 1625
127 Ga0075370_10205065 3300006353 Bacteria 1164
128 Ga0068871_100100710 3300006358 Bacteria 2421
129 Ga0068871_101258633 3300006358 Bacteria 695
130 Ga0097620_100805586 3300006931 Bacteria 1027
131 Ga0097620_101749985 3300006931 Bacteria 686
132 Ga0097620_103009555 3300006931 Bacteria 515
133 Ga0079104_1064557 3300006946 Bacteria 781
134 Ga0105251_10003813 3300009011 Bacteria 10744
135 Ga0105251_10079743 3300009011 Bacteria 1514
136 Ga0105250_10047371 3300009092 Bacteria 1724
137 Ga0105240_10174154 3300009093 Bacteria 2545
138 Ga0105240_10893339 3300009093 Bacteria 956
139 Ga0111539_10361450 3300009094 Bacteria 1690
140 Ga0105247_10192536 3300009101 Bacteria 1366
141 Ga0105247_10205835 3300009101 Bacteria 1325
142 Ga0105241_10118578 3300009174 Bacteria 2128
143 Ga0105241_10281528 3300009174 Bacteria 1420
144 Ga0105248_10082606 3300009177 Bacteria 3613
145 Ga0105248_10168254 3300009177 Bacteria 2470
146 Ga0105248_10665962 3300009177 Bacteria 1174
147 Ga0105248_11177741 3300009177 Bacteria 866
148 Ga0105237_10591580 3300009545 Bacteria 1116
149 Ga0105237_11289320 3300009545 Bacteria 737
150 Ga0105237_11537421 3300009545 Bacteria 672
151 Ga0105238_10093154 3300009551 Bacteria 3001
152 Ga0105238_10302993 3300009551 Bacteria 1582
153 Ga0105238_10345606 3300009551 Bacteria 1476
154 Ga0105238_12189383 3300009551 Bacteria 588
155 Ga0105249_10192944 3300009553 Bacteria 1989
156 Ga0105249_11461612 3300009553 Bacteria 756
157 Ga0105239_10344439 3300010375 Bacteria 1682
158 Ga0157373_10202528 3300013100 Bacteria 1399
159 Ga0157370_10000069 3300013104 Bacteria 112889
160 Ga0157370_10910471 3300013104 Bacteria 798
161 Ga0157369_10012079 3300013105 Bacteria 9807
162 Ga0157374_10080778 3300013296 Bacteria 3084
163 Ga0163162_10016336 3300013306 Bacteria 7255
164 Ga0163162_10296576 3300013306 Bacteria 1748
165 Ga0163162_10309189 3300013306 Bacteria 1713
166 Ga0163162_12903952 3300013306 Bacteria 551
167 Ga0157372_10183744 3300013307 Bacteria 2421
168 Ga0157372_10984317 3300013307 Bacteria 977
169 Ga0157372_12109862 3300013307 Bacteria 647
170 Ga0157372_12936635 3300013307 Bacteria 546
171 Ga0157372_12965051 3300013307 Bacteria 543
172 Ga0157380_10308282 3300014326 Bacteria 1462
173 Ga0157380_11474589 3300014326 Bacteria 733
174 Ga0157380_12891824 3300014326 Bacteria 546
175 Ga0163161_10020586 3300017792 Bacteria 4631
176 Ga0163161_11448941 3300017792 Bacteria 601
177 Ga0213876_10311492 3300021384 Bacteria 837
178 Ga0207427_101209 3300025231 Bacteria 10020
179 Ga0209148_1000238 3300025254 Bacteria 87836
180 Ga0209233_1000079 3300025261 Bacteria 346944
181 Ga0209455_1016220 3300025272 Bacteria 1607
182 Ga0209050_1001213 3300025298 Bacteria 30197
183 Ga0207656_10470501 3300025321 Bacteria 636
184 Ga0207696_1005241 3300025711 Bacteria 5417
185 Ga0207713_1006081 3300025735 Bacteria 7437
186 Ga0207713_1033475 3300025735 Bacteria 2244
187 Ga0207682_10061578 3300025893 Bacteria 1571
188 Ga0207710_10156125 3300025900 Bacteria 1109
189 Ga0207710_10239359 3300025900 Bacteria 905
190 Ga0207680_10147441 3300025903 Bacteria 1566
191 Ga0207680_10299148 3300025903 Bacteria 1121
192 Ga0207647_10019760 3300025904 Bacteria 4525
193 Ga0207647_10078881 3300025904 Bacteria 1977
194 Ga0207647_10108014 3300025904 Bacteria 1646
195 Ga0207647_10672691 3300025904 Bacteria 566
196 Ga0207645_10357318 3300025907 Bacteria 978
197 Ga0207705_10000004 3300025909 Bacteria 705756
198 Ga0207705_10000076 3300025909 Bacteria 122975
199 Ga0207705_10090209 3300025909 Bacteria 2244
200 Ga0207705_11366094 3300025909 Bacteria 539
201 Ga0207654_10148089 3300025911 Bacteria 1504
202 Ga0207654_10413500 3300025911 Bacteria 940
203 Ga0207695_10022234 3300025913 Bacteria 7210
204 Ga0207695_10561899 3300025913 Bacteria 1022
205 Ga0207695_11046316 3300025913 Bacteria 696
206 Ga0207671_10676759 3300025914 Bacteria 821
207 Ga0207657_10030317 3300025919 Bacteria 4910
208 Ga0207657_10117913 3300025919 Bacteria 2186
209 Ga0207657_10613597 3300025919 Bacteria 848
210 Ga0207649_10180550 3300025920 Bacteria 1477
211 Ga0207649_11322367 3300025920 Bacteria 570
212 Ga0207646_10149265 3300025922 Bacteria 2108
213 Ga0207681_10000444 3300025923 Bacteria 28971
214 Ga0207681_10000798 3300025923 Bacteria 20751
215 Ga0207681_10217206 3300025923 Bacteria 1477
216 Ga0207681_10252933 3300025923 Bacteria 1376
217 Ga0207681_10834082 3300025923 Bacteria 771
218 Ga0207694_10056708 3300025924 Bacteria 3043
219 Ga0207694_10826168 3300025924 Bacteria 783
220 Ga0207650_10291636 3300025925 Bacteria 1330
221 Ga0207650_10398367 3300025925 Bacteria 1139
222 Ga0207659_10033379 3300025926 Bacteria 3542
223 Ga0207644_10010082 3300025931 Bacteria 6223
224 Ga0207644_10184727 3300025931 Bacteria 1636
225 Ga0207644_10239382 3300025931 Bacteria 1444
226 Ga0207644_10413206 3300025931 Bacteria 1104
227 Ga0207690_10209833 3300025932 Bacteria 1484
228 Ga0207690_10433975 3300025932 Bacteria 1053
229 Ga0207706_10494539 3300025933 Bacteria 1056
230 Ga0207669_10268908 3300025937 Bacteria 1279
231 Ga0207691_10280177 3300025940 Bacteria 1435
232 Ga0207691_10723158 3300025940 Bacteria 839
233 Ga0207691_10957634 3300025940 Bacteria 715
234 Ga0207711_10032949 3300025941 Bacteria 4381
235 Ga0207711_10202592 3300025941 Bacteria 1811
236 Ga0207711_11720947 3300025941 Bacteria 570
237 Ga0207667_10002169 3300025949 Bacteria 24595
238 Ga0207667_10013495 3300025949 Bacteria 9344
239 Ga0207667_10064099 3300025949 Bacteria 3838
240 Ga0207667_10209914 3300025949 Bacteria 1996
241 Ga0207667_11004748 3300025949 Bacteria 821
242 Ga0207712_10121665 3300025961 Bacteria 1975
243 Ga0207668_10042927 3300025972 Bacteria 3065
244 Ga0207668_10116555 3300025972 Bacteria 2014
245 Ga0207668_10859938 3300025972 Bacteria 805
246 Ga0207640_10000063 3300025981 Bacteria 87065
247 Ga0207640_10032317 3300025981 Bacteria 3244
248 Ga0207640_10045421 3300025981 Bacteria 2821
249 Ga0207640_10150419 3300025981 Bacteria 1710
250 Ga0207658_10001044 3300025986 Bacteria 22500
251 Ga0207658_10007814 3300025986 Bacteria 7284
252 Ga0207658_10010022 3300025986 Bacteria 6439
253 Ga0207658_10016276 3300025986 Bacteria 5113
254 Ga0207658_10754996 3300025986 Bacteria 881
255 Ga0207703_10001270 3300026035 Bacteria 23457
256 Ga0207703_10098131 3300026035 Bacteria 2477
257 Ga0207639_10000220 3300026041 Bacteria 42726
258 Ga0207639_10003454 3300026041 Bacteria 10632
259 Ga0207639_10107202 3300026041 Bacteria 2269
260 Ga0207639_10228776 3300026041 Bacteria 1610
261 Ga0207639_11060173 3300026041 Bacteria 760
262 Ga0207678_10006049 3300026067 Bacteria 10763
263 Ga0207678_10209139 3300026067 Bacteria 1669
264 Ga0207702_10100850 3300026078 Bacteria 2548
265 Ga0207702_10201008 3300026078 Bacteria 1847
266 Ga0207641_10000198 3300026088 Bacteria 81646
267 Ga0207641_10003709 3300026088 Bacteria 13453
268 Ga0207641_10016064 3300026088 Bacteria 6131
269 Ga0207641_10231376 3300026088 Bacteria 1718
270 Ga0207641_10713411 3300026088 Bacteria 988
271 Ga0207676_10005212 3300026095 Bacteria 9200
272 Ga0207676_12351381 3300026095 Bacteria 530
273 Ga0207674_10230960 3300026116 Bacteria 1797
274 Ga0207674_10534127 3300026116 Bacteria 1133
275 Ga0207674_11524884 3300026116 Bacteria 637
276 Ga0207698_10000177 3300026142 Bacteria 39133
277 Ga0207698_10019802 3300026142 Bacteria 4616
278 Ga0207698_10250029 3300026142 Bacteria 1621
279 Ga0207698_10405923 3300026142 Bacteria 1303
280 Ga0207698_10857612 3300026142 Bacteria 913
281 Ga0209371_1039959 3300027312 Bacteria 958
282 Ga0210000_1043604 3300027462 Bacteria 714
283 Ga0209983_1052771 3300027665 Bacteria 891
284 Ga0209974_10005438 3300027876 Bacteria 4480
285 Ga0268266_10000354 3300028379 Bacteria 70983
286 Ga0268266_10017410 3300028379 Bacteria 6130
287 Ga0268266_10021606 3300028379 Bacteria 5482
288 Ga0268266_10046667 3300028379 Bacteria 3709
289 Ga0268265_10022535 3300028380 Bacteria 4427
290 Ga0268265_10077074 3300028380 Bacteria 2617
291 Ga0268265_10476199 3300028380 Bacteria 1171
292 Ga0268264_10000018 3300028381 Bacteria 495324
293 Ga0268264_10034602 3300028381 Bacteria 4157
294 Ga0268264_10063371 3300028381 Bacteria 3107
295 Ga0268264_10300346 3300028381 Bacteria 1511
296 Ga0307515_10321016 3300028794 Bacteria 1215
297 Ga0268256_1030978 3300030500 Bacteria 1289
298 Ga0265331_10045016 3300031250 Bacteria 2131
299 Ga0265327_10111882 3300031251 Bacteria 1303
300 Ga0307408_101031487 3300031548 Bacteria 760
301 Ga0316578_10245466 3300031728 Bacteria 1075
302 Ga0307405_10029177 3300031731 Bacteria 3222
303 Ga0307405_10077990 3300031731 Bacteria 2154
304 Ga0307405_11451242 3300031731 Bacteria 601
305 Ga0307413_10147315 3300031824 Bacteria 1636
306 Ga0307413_10858238 3300031824 Bacteria 768
307 Ga0307413_10886421 3300031824 Bacteria 757
308 Ga0307413_11104490 3300031824 Bacteria 685
309 Ga0307413_11856967 3300031824 Bacteria 540
310 Ga0307410_10397252 3300031852 Bacteria 1113
311 Ga0307410_10748696 3300031852 Bacteria 827
312 Ga0307410_11050062 3300031852 Bacteria 704
313 Ga0307410_11343112 3300031852 Bacteria 626
314 Ga0307410_12020770 3300031852 Bacteria 514
315 Ga0307406_10925553 3300031901 Bacteria 744
316 Ga0307407_10287224 3300031903 Bacteria 1142
317 Ga0307407_11032494 3300031903 Bacteria 636
318 Ga0307412_10043863 3300031911 Bacteria 2915
319 Ga0307412_10224495 3300031911 Bacteria 1442
320 Ga0307412_11430670 3300031911 Bacteria 626
321 Ga0307412_11591209 3300031911 Bacteria 596
322 Ga0307409_100419784 3300031995 Bacteria 1283
323 Ga0307409_100534188 3300031995 Bacteria 1148
324 Ga0307409_100706471 3300031995 Bacteria 1008
325 Ga0307409_102647105 3300031995 Bacteria 530
326 Ga0307416_101845808 3300032002 Bacteria 708
327 Ga0307416_102032160 3300032002 Bacteria 677
328 Ga0307414_10034062 3300032004 Bacteria 3372
329 Ga0307414_10199380 3300032004 Bacteria 1626
330 Ga0307414_10523481 3300032004 Bacteria 1053
331 Ga0307414_10661470 3300032004 Bacteria 942
332 Ga0307414_10673309 3300032004 Bacteria 934
333 Ga0307414_11045100 3300032004 Bacteria 753
334 Ga0307414_11468099 3300032004 Bacteria 634
335 Ga0307411_10120547 3300032005 Bacteria 1897
336 Ga0307411_10125634 3300032005 Bacteria 1865
337 Ga0307411_10902488 3300032005 Bacteria 785
338 Ga0307415_100182258 3300032126 Bacteria 1649
339 Ga0316583_10003370 3300032133 Bacteria 5625
340 Ga0316574_0468711 3300035398 Bacteria 788
341 Ga0316582_0032089 3300036647 Bacteria 3215
342 Ga0316584_0342664 3300036712 Bacteria 1074
343 Ga0316584_0397088 3300036712 Bacteria 983
344 Ga0316584_1000320 3300036712 Bacteria 559
345 Ga0395899_0003766 3300037312 Bacteria 11972
346 Ga0395900_0511270 3300037418 Bacteria 1150
347 Ga0395900_0573966 3300037418 Bacteria 1070
348 Ga0395900_1324974 3300037418 Bacteria 634
349 Ga0395905_1184212 3300037471 Bacteria 668
350 Ga0395901_0249242 3300038443 Bacteria 1851
351 Ga0436365_1372378 3300039437 Bacteria 1000
352 Ga0436365_1668286 3300039437 Bacteria 2135
353 Ga0451789_0406830 3300041443 Bacteria 545
354 Ga0451807_0941463 3300041486 Bacteria 540
355 Ga0451839_1283613 3300041496 Bacteria 699
356 Ga0451841_0662214 3300041498 Bacteria 902
357 Ga0451841_0756227 3300041498 Bacteria 684
358 Ga0451849_0265780 3300041505 Bacteria 805
359 Ga0451851_0872115 3300041507 Bacteria 622
360 Ga0451853_1262340 3300041512 Bacteria 1607
361 Ga0451853_3327244 3300041512 Bacteria 607
362 Ga0439431_0059657 3300041997 Bacteria 1002
363 Ga0450912_021326 3300042116 Bacteria 628
364 Ga0450921_019743 3300042123 Bacteria 634
365 Ga0450891_037010 3300042129 Bacteria 518
366 Ga0453684_0103485 3300044712 Bacteria 3479
367 Ga0451576_0022769 3300045051 Bacteria 6787
368 Ga0495627_001378 3300046453 Bacteria 14462
369 Ga0495627_156283 3300046453 Bacteria 635
370 Ga0495650_0004010 3300046471 Bacteria 10339
371 Ga0495605_0079546 3300046474 Bacteria 1535
372 Ga0495596_0000113 3300046500 Bacteria 55405
373 Ga0495596_0011916 3300046500 Bacteria 3733
374 Ga0495607_0029066 3300046501 Bacteria 3405
375 Ga0495607_0175152 3300046501 Bacteria 1080
376 Ga0495583_0276382 3300046506 Bacteria 670
377 Ga0495610_0000018 3300046512 Bacteria 355044
378 Ga0495610_0014626 3300046512 Bacteria 4601
379 Ga0495620_0028498 3300046515 Bacteria 2596
380 Ga0495632_0022034 3300046519 Bacteria 3423
381 Ga0495643_0000217 3300046522 Bacteria 88279
382 Ga0495643_0016799 3300046522 Bacteria 4294
383 Ga0495643_0189614 3300046522 Bacteria 993
384 Ga0495643_0285680 3300046522 Bacteria 757
385 Ga0495609_0069851 3300046538 Bacteria 1544
386 Ga0495621_0005243 3300046539 Bacteria 3712
387 Ga0495633_0281936 3300046558 Bacteria 756
388 Ga0495625_0027605 3300046660 Bacteria 4270
389 Ga0495671_0177971 3300046692 Bacteria 1033
390 Ga0495683_0196881 3300047323 Bacteria 911
391 Ga0495673_0343340 3300047469 Bacteria 528
392 Ga0495681_0000792 3300047470 Bacteria 24336
393 Ga0495593_0540157 3300047673 Bacteria 585
394 Ga0495615_0000113 3300048090 Bacteria 20683
395 Ga0495626_0012697 3300048091 Bacteria 4405
396 Ga0496100_0009680 3300048903 Bacteria 5421
397 Ga0496100_0627090 3300048903 Bacteria 836
398 Ga0496101_0836378 3300048904 Bacteria 725
399 Ga0496102_0012000 3300048905 Bacteria 7486
400 Ga0496102_0345842 3300048905 Bacteria 1400
401 Ga0496102_0450798 3300048905 Bacteria 1207
402 Ga0496102_0844509 3300048905 Bacteria 838
403 Ga0496103_0000081 3300048906 Bacteria 109734
404 Ga0496103_0188910 3300048906 Bacteria 1324
405 Ga0496104_0043737 3300048907 Bacteria 4206
406 Ga0496104_0094946 3300048907 Bacteria 2853
407 Ga0496105_0022181 3300048908 Bacteria 5142
408 Ga0496105_0040467 3300048908 Bacteria 3843
409 Ga0496106_0962482 3300048909 Bacteria 672
410 Ga0496107_0662264 3300048910 Bacteria 769
411 Ga0496110_1298700 3300048913 Bacteria 637
412 Ga0496111_0890057 3300048914 Bacteria 641
413 Ga0496113_0205129 3300048916 Bacteria 1568
414 Ga0496113_0385744 3300048916 Bacteria 1124
415 Ga0496113_0592594 3300048916 Bacteria 888
416 Ga0496114_0034544 3300048917 Bacteria 4172
417 Ga0496115_0879009 3300048918 Bacteria 692
418 Ga0496116_0000028 3300048919 Bacteria 424086
419 Ga0496116_0160592 3300048919 Bacteria 1233
420 Ga0496117_0010088 3300048920 Bacteria 8672
421 Ga0496117_0081056 3300048920 Bacteria 2132
422 Ga0496117_0225934 3300048920 Bacteria 1038
423 Ga0496118_0059496 3300048921 Bacteria 2844
424 Ga0496118_0093553 3300048921 Bacteria 2058
425 Ga0496118_0134474 3300048921 Bacteria 1580
426 Ga0496119_0022504 3300048922 Bacteria 4508
427 Ga0496120_0022329 3300048923 Bacteria 3982
428 Ga0496121_0000021 3300048924 Bacteria 478544
429 Ga0496121_0001016 3300048924 Bacteria 50107
430 Ga0496121_0002197 3300048924 Bacteria 30505
431 Ga0496121_0020181 3300048924 Bacteria 6613
432 Ga0496121_0100988 3300048924 Bacteria 2226
433 Ga0496122_0026363 3300048925 Bacteria 5012
434 Ga0496122_0027958 3300048925 Bacteria 4803
435 Ga0496122_0038756 3300048925 Bacteria 3810
436 Ga0496122_0618585 3300048925 Bacteria 503
437 Ga0496123_0001766 3300048926 Bacteria 28525
438 Ga0496123_0006131 3300048926 Bacteria 11786
439 Ga0496123_0049053 3300048926 Bacteria 2835
440 Ga0496123_0068111 3300048926 Bacteria 2243
441 Ga0496124_0009285 3300048927 Bacteria 10140
442 Ga0496124_0022041 3300048927 Bacteria 5851
443 Ga0496124_0070953 3300048927 Bacteria 2889
444 Ga0496124_0078982 3300048927 Bacteria 2710
445 Ga0496124_0486385 3300048927 Bacteria 832
446 Ga0496124_0702969 3300048927 Bacteria 640
447 Ga0496125_0003360 3300048928 Bacteria 19487
448 Ga0496125_0028306 3300048928 Bacteria 5065
449 Ga0496125_0058900 3300048928 Bacteria 3099
450 Ga0496125_0198910 3300048928 Bacteria 1314
451 Ga0496126_0000028 3300048929 Bacteria 394082
452 Ga0496126_0000079 3300048929 Bacteria 222463
453 Ga0496126_0043461 3300048929 Bacteria 4145
454 Ga0496126_0045167 3300048929 Bacteria 4051
455 Ga0496126_0755234 3300048929 Bacteria 750
456 Ga0501306_014832 3300049127 Bacteria 1032
457 Ga0501032_0779476 3300049569 Bacteria 604
458 Ga0501034_0578143 3300049571 Bacteria 1031
459 Ga0501039_0297979 3300049575 Bacteria 1268
460 Ga0501039_0704816 3300049575 Bacteria 789
461 Ga0501042_0201556 3300049578 Bacteria 1435
462 Ga0501070_0614950 3300049586 Bacteria 865
463 Ga0501223_142054 3300049663 Bacteria 517
464 Ga0501224_052401 3300049664 Bacteria 627
465 Ga0501249_039421 3300049679 Bacteria 1068
466 Ga0501253_041244 3300049683 Bacteria 931
467 Ga0501268_044031 3300049765 Bacteria 848
468 Ga0501044_0074168 3300049823 Bacteria 3458
469 Ga0501044_0182431 3300049823 Bacteria 2065
470 nmdc:mga03683_375711_c1 3300050489 Bacteria 676
471 nmdc:mga03683_42_c1 3300050489 Bacteria 60876
472 nmdc:mga03683_7634_c1 3300050489 Bacteria 2117
473 nmdc:mga03n38_959_c1 3300050490 Bacteria 7829
474 nmdc:mga00v17_136091_c1 3300050491 Bacteria 631
475 nmdc:mga00v17_25342_c1 3300050491 Bacteria 3447
476 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
477 nmdc:mga0k408_411782_c1 3300050493 Bacteria 804
478 nmdc:mga07m45_371029_c1 3300050496 Bacteria 831
479 nmdc:mga08y16_314576_c1 3300050511 Bacteria 1612
480 nmdc:mga0sz30_14903_c1 3300050516 Bacteria 3066
481 nmdc:mga0sz30_3181_c1 3300050516 Bacteria 5887
482 Ga0495601_1054800 3300053077 Bacteria 510
483 Ga0500643_001306 3300053087 Bacteria 14670
484 Ga0500562_077631 3300053108 Bacteria 898
485 Ga0500607_033455 3300053121 Bacteria 2816
486 Ga0500608_149537 3300053122 Bacteria 1025
487 Ga0500618_004249 3300053125 Bacteria 4640
488 Ga0500618_012576 3300053125 Bacteria 2213
489 Ga0500559_0019143 3300053136 Bacteria 2893
490 Ga0500568_0291104 3300053139 Bacteria 593
491 Ga0500590_021975 3300053148 Bacteria 3312
492 Ga0500590_148733 3300053148 Bacteria 1059
493 Ga0500619_272223 3300053154 Bacteria 553
494 Ga0500624_000100 3300053157 Bacteria 41296
495 Ga0500636_0006048 3300053177 Bacteria 6943
496 Ga0500636_0022292 3300053177 Bacteria 3749
497 Ga0500637_0562455 3300053178 Bacteria 549
498 Ga0500645_009914 3300053730 Bacteria 3178
499 Ga0587084_004794 3300059477 Bacteria 1566
500 Ga0587090_000073 3300059510 Bacteria 5690
501 Ga0587115_012981 3300059626 Bacteria 1072
502 Ga0587076_012545 3300059645 Bacteria 1268
503 Ga0587111_0062462 3300060346 Bacteria 850

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2599185359 2600227343 79
2 iso_pu_bacteria 2818991466 2819715872 79
3 iso_pu_bacteria 2879163058 2879163362 79
4 iso_pu_bacteria 2928027323 2928031182 79
5 iso_pu_bacteria 2928968154 2928970666 79
6 iso_pu_bacteria 2984555340 2984557403 79
7 iso_pu_bacteria 2984564862 2984568200 79
8 iso_pu_bacteria 2993356040 2993359280 79
9 iso_pu_bacteria 2738541275 2738709417 80
10 iso_pu_bacteria 2738541301 2738847842 80
11 iso_pu_bacteria 2738541304 2738863571 80
12 iso_pu_bacteria 2738543022 2739296089 80
13 iso_pu_bacteria 2738543033 2739357767 80
14 iso_pu_bacteria 2818991438 2819553031 80
15 iso_pu_bacteria 2928100450 2928102555 80
16 iso_pu_bacteria 2928959182 2928959359 80
17 iso_pu_bacteria 2510917021 2511128012 81
18 iso_pu_bacteria 2643221588 2643949781 81
19 iso_pu_bacteria 2848297114 2848298275 81
20 iso_pu_bacteria 2882806704 2882807250 81
21 iso_pu_bacteria 2896184354 2896184412 81
22 iso_pu_bacteria 2896253425 2896256716 81
23 iso_pu_bacteria 2919138771 2919140176 81
24 iso_pu_bacteria 3000865235 3000866772 81
25 iso_pu_bacteria 8054302542 8054305742 81
26 iso_pu_bacteria 2885427238 2885428639 82
27 3300003791 Ga0055530_10022865 Ga0055530_100228653 83
28 3300005343 Ga0070687_101176791 Ga0070687_1011767911 83
29 3300005440 Ga0070705_101534203 Ga0070705_1015342032 83
30 3300005539 Ga0068853_100000183 Ga0068853_10000018319 83
31 3300005563 Ga0068855_100304731 Ga0068855_1003047312 83
32 3300005577 Ga0068857_100074314 Ga0068857_1000743143 83
33 3300005616 Ga0068852_101023645 Ga0068852_1010236452 83
34 3300005834 Ga0068851_10454288 Ga0068851_104542882 83
35 3300005841 Ga0068863_100776883 Ga0068863_1007768832 83
36 3300005843 Ga0068860_100208233 Ga0068860_1002082332 83
37 3300006946 Ga0079104_1064557 Ga0079104_10645572 83
38 3300009553 Ga0105249_11461612 Ga0105249_114616122 83
39 3300025298 Ga0209050_1001213 Ga0209050_100121314 83
40 3300025922 Ga0207646_10149265 Ga0207646_101492653 83
41 3300025981 Ga0207640_10150419 Ga0207640_101504192 83
42 3300026041 Ga0207639_10000220 Ga0207639_1000022036 83
43 3300026088 Ga0207641_10713411 Ga0207641_107134112 83
44 3300026116 Ga0207674_10534127 Ga0207674_105341272 83
45 3300026142 Ga0207698_10405923 Ga0207698_104059232 83
46 3300027312 Ga0209371_1039959 Ga0209371_10399592 83
47 3300030500 Ga0268256_1030978 Ga0268256_10309782 83
48 3300031251 Ga0265327_10111882 Ga0265327_101118822 83
49 3300041443 Ga0451789_0406830 Ga0451789_0406830_229_483 83
50 3300046453 Ga0495627_156283 Ga0495627_156283_227_481 83
51 3300046500 Ga0495596_0011916 Ga0495596_0011916_3465_3719 83
52 3300046512 Ga0495610_0014626 Ga0495610_0014626_1444_1698 83
53 3300046522 Ga0495643_0285680 Ga0495643_0285680_123_377 83
54 3300046558 Ga0495633_0281936 Ga0495633_0281936_278_532 83
55 3300047673 Ga0495593_0540157 Ga0495593_0540157_19_273 83
56 3300048091 Ga0495626_0012697 Ga0495626_0012697_511_765 83
57 3300048903 Ga0496100_0627090 Ga0496100_0627090_307_561 83
58 3300048905 Ga0496102_0450798 Ga0496102_0450798_66_320 83
59 3300048909 Ga0496106_0962482 Ga0496106_0962482_56_310 83
60 3300048919 Ga0496116_0000028 Ga0496116_0000028_68278_68532 83
61 3300048920 Ga0496117_0081056 Ga0496117_0081056_1024_1278 83
62 3300048924 Ga0496121_0002197 Ga0496121_0002197_1031_1285 83
63 3300048925 Ga0496122_0038756 Ga0496122_0038756_807_1061 83
64 3300048926 Ga0496123_0001766 Ga0496123_0001766_18922_19176 83
65 3300048927 Ga0496124_0022041 Ga0496124_0022041_5574_5828 83
66 3300048927 Ga0496124_0078982 Ga0496124_0078982_306_560 83
67 3300048928 Ga0496125_0058900 Ga0496125_0058900_2247_2501 83
68 3300048928 Ga0496125_0198910 Ga0496125_0198910_325_579 83
69 3300048929 Ga0496126_0000079 Ga0496126_0000079_174287_174541 83
70 3300048929 Ga0496126_0755234 Ga0496126_0755234_127_381 83
71 3300053077 Ga0495601_1054800 Ga0495601_1054800_189_440 83
72 3300053087 Ga0500643_001306 Ga0500643_001306_10788_11042 83
73 3300053108 Ga0500562_077631 Ga0500562_077631_301_555 83
74 3300053122 Ga0500608_149537 Ga0500608_149537_535_789 83
75 3300053125 Ga0500618_012576 Ga0500618_012576_290_544 83
76 3300053136 Ga0500559_0019143 Ga0500559_0019143_288_542 83
77 3300053148 Ga0500590_021975 Ga0500590_021975_2338_2592 83
78 3300053157 Ga0500624_000100 Ga0500624_000100_33862_34116 83
79 3300053177 Ga0500636_0006048 Ga0500636_0006048_3954_4208 83
80 3300053177 Ga0500636_0022292 Ga0500636_0022292_269_523 83
81 3300053730 Ga0500645_009914 Ga0500645_009914_255_509 83
82 2162886007 SwRhRL2b_contig_1350033 SwRhRL2b_0306.00003490 84
83 2162886007 SwRhRL2b_contig_1774792 SwRhRL2b_0085.00006330 84
84 2162886007 SwRhRL2b_contig_2932459 SwRhRL2b_0720.00004220 84
85 3300001990 JGI24737J22298_10026213 JGI24737J22298_100262132 84
86 3300001990 JGI24737J22298_10043129 JGI24737J22298_100431293 84
87 3300001990 JGI24737J22298_10124574 JGI24737J22298_101245742 84
88 3300002067 JGI24735J21928_10031817 JGI24735J21928_100318171 84
89 3300002067 JGI24735J21928_10033789 JGI24735J21928_100337892 84
90 3300002067 JGI24735J21928_10039541 JGI24735J21928_100395411 84
91 3300002067 JGI24735J21928_10051785 JGI24735J21928_100517851 84
92 3300002067 JGI24735J21928_10063876 JGI24735J21928_100638762 84
93 3300002239 JGI24034J26672_10109369 JGI24034J26672_101093691 84
94 3300002244 JGI24742J22300_10128557 JGI24742J22300_101285571 84
95 3300002459 JGI24751J29686_10100489 JGI24751J29686_101004892 84
96 3300002772 JGI25164J39214_1017967 JGI25164J39214_10179672 84
97 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043119 84
98 3300003762 Ga0055542_1005278 Ga0055542_10052781 84
99 3300005289 Ga0065704_10000358 Ga0065704_100003584 84
100 3300005295 Ga0065707_10085072 Ga0065707_100850725 84
101 3300005327 Ga0070658_10003835 Ga0070658_100038354 84
102 3300005327 Ga0070658_10095344 Ga0070658_100953442 84
103 3300005327 Ga0070658_10203383 Ga0070658_102033832 84
104 3300005327 Ga0070658_10666565 Ga0070658_106665652 84
105 3300005331 Ga0070670_100317010 Ga0070670_1003170102 84
106 3300005331 Ga0070670_101182245 Ga0070670_1011822452 84
107 3300005335 Ga0070666_10938498 Ga0070666_109384981 84
108 3300005337 Ga0070682_100715296 Ga0070682_1007152962 84
109 3300005339 Ga0070660_100066378 Ga0070660_1000663782 84
110 3300005339 Ga0070660_100100194 Ga0070660_1001001942 84
111 3300005344 Ga0070661_100298807 Ga0070661_1002988072 84
112 3300005344 Ga0070661_101654082 Ga0070661_1016540822 84
113 3300005347 Ga0070668_100062968 Ga0070668_1000629682 84
114 3300005347 Ga0070668_100167270 Ga0070668_1001672701 84
115 3300005347 Ga0070668_100243184 Ga0070668_1002431841 84
116 3300005347 Ga0070668_100756022 Ga0070668_1007560221 84
117 3300005353 Ga0070669_100000200 Ga0070669_10000020023 84
118 3300005353 Ga0070669_100010144 Ga0070669_1000101447 84
119 3300005353 Ga0070669_100186315 Ga0070669_1001863151 84
120 3300005353 Ga0070669_100319735 Ga0070669_1003197352 84
121 3300005353 Ga0070669_100446953 Ga0070669_1004469532 84
122 3300005355 Ga0070671_100016012 Ga0070671_1000160124 84
123 3300005355 Ga0070671_100165508 Ga0070671_1001655083 84
124 3300005355 Ga0070671_100469955 Ga0070671_1004699553 84
125 3300005356 Ga0070674_100576472 Ga0070674_1005764722 84
126 3300005366 Ga0070659_100423856 Ga0070659_1004238562 84
127 3300005367 Ga0070667_100000198 Ga0070667_10000019854 84
128 3300005367 Ga0070667_100000419 Ga0070667_10000041936 84
129 3300005367 Ga0070667_100003540 Ga0070667_1000035403 84
130 3300005367 Ga0070667_100103161 Ga0070667_1001031612 84
131 3300005440 Ga0070705_100470631 Ga0070705_1004706311 84
132 3300005441 Ga0070700_100495194 Ga0070700_1004951941 84
133 3300005455 Ga0070663_100181650 Ga0070663_1001816502 84
134 3300005455 Ga0070663_100702455 Ga0070663_1007024552 84
135 3300005457 Ga0070662_100493334 Ga0070662_1004933342 84
136 3300005539 Ga0068853_100014596 Ga0068853_1000145962 84
137 3300005539 Ga0068853_100047830 Ga0068853_1000478303 84
138 3300005539 Ga0068853_100084797 Ga0068853_1000847971 84
139 3300005539 Ga0068853_100123499 Ga0068853_1001234991 84
140 3300005539 Ga0068853_101254536 Ga0068853_1012545361 84
141 3300005543 Ga0070672_100376552 Ga0070672_1003765522 84
142 3300005543 Ga0070672_101071455 Ga0070672_1010714552 84
143 3300005548 Ga0070665_100000107 Ga0070665_100000107136 84
144 3300005548 Ga0070665_100012374 Ga0070665_1000123742 84
145 3300005548 Ga0070665_100121898 Ga0070665_1001218981 84
146 3300005548 Ga0070665_100201566 Ga0070665_1002015662 84
147 3300005563 Ga0068855_100002286 Ga0068855_10000228619 84
148 3300005563 Ga0068855_100293594 Ga0068855_1002935942 84
149 3300005563 Ga0068855_100499820 Ga0068855_1004998202 84
150 3300005563 Ga0068855_100625740 Ga0068855_1006257402 84
151 3300005563 Ga0068855_100818403 Ga0068855_1008184032 84
152 3300005563 Ga0068855_101808922 Ga0068855_1018089222 84
153 3300005577 Ga0068857_100182571 Ga0068857_1001825713 84
154 3300005577 Ga0068857_102096217 Ga0068857_1020962172 84
155 3300005578 Ga0068854_100000359 Ga0068854_1000003594 84
156 3300005578 Ga0068854_100000809 Ga0068854_1000008095 84
157 3300005578 Ga0068854_100125271 Ga0068854_1001252712 84
158 3300005614 Ga0068856_100177822 Ga0068856_1001778223 84
159 3300005614 Ga0068856_100570811 Ga0068856_1005708111 84
160 3300005616 Ga0068852_100167061 Ga0068852_1001670612 84
161 3300005616 Ga0068852_100353287 Ga0068852_1003532873 84
162 3300005617 Ga0068859_100805647 Ga0068859_1008056472 84
163 3300005617 Ga0068859_101750008 Ga0068859_1017500082 84
164 3300005617 Ga0068859_103008942 Ga0068859_1030089422 84
165 3300005618 Ga0068864_100036825 Ga0068864_1000368252 84
166 3300005618 Ga0068864_100506220 Ga0068864_1005062202 84
167 3300005834 Ga0068851_10203998 Ga0068851_102039982 84
168 3300005834 Ga0068851_10568331 Ga0068851_105683312 84
169 3300005841 Ga0068863_100000196 Ga0068863_1000001968 84
170 3300005841 Ga0068863_100003687 Ga0068863_1000036874 84
171 3300005841 Ga0068863_100038746 Ga0068863_1000387463 84
172 3300005842 Ga0068858_100010069 Ga0068858_1000100699 84
173 3300005842 Ga0068858_100028002 Ga0068858_1000280022 84
174 3300005842 Ga0068858_100235912 Ga0068858_1002359122 84
175 3300005842 Ga0068858_102569619 Ga0068858_1025696191 84
176 3300005843 Ga0068860_100000008 Ga0068860_10000000898 84
177 3300005843 Ga0068860_100008194 Ga0068860_10000819410 84
178 3300005843 Ga0068860_100042623 Ga0068860_1000426232 84
179 3300005843 Ga0068860_100173233 Ga0068860_1001732332 84
180 3300005843 Ga0068860_101001476 Ga0068860_1010014762 84
181 3300005844 Ga0068862_100023920 Ga0068862_1000239202 84
182 3300005844 Ga0068862_100031863 Ga0068862_1000318632 84
183 3300005844 Ga0068862_100564283 Ga0068862_1005642832 84
184 3300005844 Ga0068862_102493850 Ga0068862_1024938501 84
185 3300006051 Ga0075364_10014184 Ga0075364_100141844 84
186 3300006051 Ga0075364_10215011 Ga0075364_102150112 84
187 3300006051 Ga0075364_10271735 Ga0075364_102717353 84
188 3300006058 Ga0075432_10000355 Ga0075432_1000035511 84
189 3300006177 Ga0075362_10000022 Ga0075362_1000002264 84
190 3300006177 Ga0075362_10037869 Ga0075362_100378692 84
191 3300006186 Ga0075369_10008020 Ga0075369_100080203 84
192 3300006186 Ga0075369_10336918 Ga0075369_103369181 84
193 3300006195 Ga0075366_10000034 Ga0075366_1000003410 84
194 3300006195 Ga0075366_10242371 Ga0075366_102423712 84
195 3300006195 Ga0075366_10538452 Ga0075366_105384522 84
196 3300006237 Ga0097621_100010279 Ga0097621_1000102795 84
197 3300006353 Ga0075370_10106541 Ga0075370_101065412 84
198 3300006353 Ga0075370_10205065 Ga0075370_102050652 84
199 3300006358 Ga0068871_100100710 Ga0068871_1001007103 84
200 3300006358 Ga0068871_101258633 Ga0068871_1012586332 84
201 3300006931 Ga0097620_100805586 Ga0097620_1008055862 84
202 3300006931 Ga0097620_101749985 Ga0097620_1017499852 84
203 3300006931 Ga0097620_103009555 Ga0097620_1030095552 84
204 3300009011 Ga0105251_10003813 Ga0105251_1000381311 84
205 3300009011 Ga0105251_10079743 Ga0105251_100797432 84
206 3300009092 Ga0105250_10047371 Ga0105250_100473711 84
207 3300009093 Ga0105240_10174154 Ga0105240_101741543 84
208 3300009093 Ga0105240_10893339 Ga0105240_108933391 84
209 3300009094 Ga0111539_10361450 Ga0111539_103614502 84
210 3300009101 Ga0105247_10192536 Ga0105247_101925362 84
211 3300009101 Ga0105247_10205835 Ga0105247_102058352 84
212 3300009174 Ga0105241_10118578 Ga0105241_101185782 84
213 3300009174 Ga0105241_10281528 Ga0105241_102815282 84
214 3300009177 Ga0105248_10082606 Ga0105248_100826061 84
215 3300009177 Ga0105248_10168254 Ga0105248_101682542 84
216 3300009177 Ga0105248_10665962 Ga0105248_106659622 84
217 3300009177 Ga0105248_11177741 Ga0105248_111777411 84
218 3300009545 Ga0105237_10591580 Ga0105237_105915801 84
219 3300009545 Ga0105237_11289320 Ga0105237_112893202 84
220 3300009545 Ga0105237_11537421 Ga0105237_115374211 84
221 3300009551 Ga0105238_10093154 Ga0105238_100931542 84
222 3300009551 Ga0105238_10302993 Ga0105238_103029933 84
223 3300009551 Ga0105238_10345606 Ga0105238_103456062 84
224 3300009551 Ga0105238_12189383 Ga0105238_121893832 84
225 3300009553 Ga0105249_10192944 Ga0105249_101929441 84
226 3300010375 Ga0105239_10344439 Ga0105239_103444392 84
227 3300013100 Ga0157373_10202528 Ga0157373_102025282 84
228 3300013104 Ga0157370_10000069 Ga0157370_100000695 84
229 3300013104 Ga0157370_10910471 Ga0157370_109104711 84
230 3300013105 Ga0157369_10012079 Ga0157369_100120796 84
231 3300013296 Ga0157374_10080778 Ga0157374_100807783 84
232 3300013306 Ga0163162_10016336 Ga0163162_100163365 84
233 3300013306 Ga0163162_10296576 Ga0163162_102965762 84
234 3300013306 Ga0163162_10309189 Ga0163162_103091892 84
235 3300013306 Ga0163162_12903952 Ga0163162_129039521 84
236 3300013307 Ga0157372_10183744 Ga0157372_101837442 84
237 3300013307 Ga0157372_10984317 Ga0157372_109843171 84
238 3300013307 Ga0157372_12109862 Ga0157372_121098622 84
239 3300013307 Ga0157372_12936635 Ga0157372_129366352 84
240 3300013307 Ga0157372_12965051 Ga0157372_129650512 84
241 3300014326 Ga0157380_10308282 Ga0157380_103082822 84
242 3300014326 Ga0157380_11474589 Ga0157380_114745891 84
243 3300014326 Ga0157380_12891824 Ga0157380_128918241 84
244 3300017792 Ga0163161_10020586 Ga0163161_100205862 84
245 3300017792 Ga0163161_11448941 Ga0163161_114489412 84
246 3300021384 Ga0213876_10311492 Ga0213876_103114922 84
247 3300025231 Ga0207427_101209 Ga0207427_1012099 84
248 3300025254 Ga0209148_1000238 Ga0209148_10002384 84
249 3300025261 Ga0209233_1000079 Ga0209233_1000079150 84
250 3300025272 Ga0209455_1016220 Ga0209455_10162202 84
251 3300025321 Ga0207656_10470501 Ga0207656_104705011 84
252 3300025711 Ga0207696_1005241 Ga0207696_10052411 84
253 3300025735 Ga0207713_1006081 Ga0207713_10060816 84
254 3300025735 Ga0207713_1033475 Ga0207713_10334752 84
255 3300025893 Ga0207682_10061578 Ga0207682_100615783 84
256 3300025900 Ga0207710_10156125 Ga0207710_101561252 84
257 3300025900 Ga0207710_10239359 Ga0207710_102393592 84
258 3300025903 Ga0207680_10147441 Ga0207680_101474413 84
259 3300025903 Ga0207680_10299148 Ga0207680_102991482 84
260 3300025904 Ga0207647_10019760 Ga0207647_100197603 84
261 3300025904 Ga0207647_10078881 Ga0207647_100788812 84
262 3300025904 Ga0207647_10108014 Ga0207647_101080141 84
263 3300025904 Ga0207647_10672691 Ga0207647_106726912 84
264 3300025907 Ga0207645_10357318 Ga0207645_103573181 84
265 3300025909 Ga0207705_10000004 Ga0207705_10000004375 84
266 3300025909 Ga0207705_10000076 Ga0207705_1000007617 84
267 3300025909 Ga0207705_10090209 Ga0207705_100902092 84
268 3300025909 Ga0207705_11366094 Ga0207705_113660941 84
269 3300025911 Ga0207654_10148089 Ga0207654_101480892 84
270 3300025911 Ga0207654_10413500 Ga0207654_104135002 84
271 3300025913 Ga0207695_10022234 Ga0207695_100222342 84
272 3300025913 Ga0207695_10561899 Ga0207695_105618992 84
273 3300025913 Ga0207695_11046316 Ga0207695_110463161 84
274 3300025914 Ga0207671_10676759 Ga0207671_106767592 84
275 3300025919 Ga0207657_10030317 Ga0207657_100303172 84
276 3300025919 Ga0207657_10117913 Ga0207657_101179132 84
277 3300025919 Ga0207657_10613597 Ga0207657_106135971 84
278 3300025920 Ga0207649_10180550 Ga0207649_101805502 84
279 3300025920 Ga0207649_11322367 Ga0207649_113223671 84
280 3300025923 Ga0207681_10000444 Ga0207681_1000044435 84
281 3300025923 Ga0207681_10000798 Ga0207681_1000079811 84
282 3300025923 Ga0207681_10217206 Ga0207681_102172061 84
283 3300025923 Ga0207681_10252933 Ga0207681_102529332 84
284 3300025923 Ga0207681_10834082 Ga0207681_108340822 84
285 3300025924 Ga0207694_10056708 Ga0207694_100567083 84
286 3300025924 Ga0207694_10826168 Ga0207694_108261682 84
287 3300025925 Ga0207650_10291636 Ga0207650_102916362 84
288 3300025925 Ga0207650_10398367 Ga0207650_103983672 84
289 3300025926 Ga0207659_10033379 Ga0207659_100333793 84
290 3300025931 Ga0207644_10010082 Ga0207644_100100823 84
291 3300025931 Ga0207644_10184727 Ga0207644_101847272 84
292 3300025931 Ga0207644_10239382 Ga0207644_102393823 84
293 3300025931 Ga0207644_10413206 Ga0207644_104132061 84
294 3300025932 Ga0207690_10209833 Ga0207690_102098332 84
295 3300025932 Ga0207690_10433975 Ga0207690_104339751 84
296 3300025933 Ga0207706_10494539 Ga0207706_104945392 84
297 3300025937 Ga0207669_10268908 Ga0207669_102689082 84
298 3300025940 Ga0207691_10280177 Ga0207691_102801772 84
299 3300025940 Ga0207691_10723158 Ga0207691_107231581 84
300 3300025940 Ga0207691_10957634 Ga0207691_109576342 84
301 3300025941 Ga0207711_10032949 Ga0207711_100329494 84
302 3300025941 Ga0207711_10202592 Ga0207711_102025922 84
303 3300025941 Ga0207711_11720947 Ga0207711_117209471 84
304 3300025949 Ga0207667_10002169 Ga0207667_1000216919 84
305 3300025949 Ga0207667_10013495 Ga0207667_100134952 84
306 3300025949 Ga0207667_10064099 Ga0207667_100640992 84
307 3300025949 Ga0207667_10209914 Ga0207667_102099142 84
308 3300025949 Ga0207667_11004748 Ga0207667_110047481 84
309 3300025961 Ga0207712_10121665 Ga0207712_101216652 84
310 3300025972 Ga0207668_10042927 Ga0207668_100429273 84
311 3300025972 Ga0207668_10116555 Ga0207668_101165552 84
312 3300025972 Ga0207668_10859938 Ga0207668_108599382 84
313 3300025981 Ga0207640_10000063 Ga0207640_1000006372 84
314 3300025981 Ga0207640_10032317 Ga0207640_100323172 84
315 3300025981 Ga0207640_10045421 Ga0207640_100454213 84
316 3300025986 Ga0207658_10001044 Ga0207658_1000104416 84
317 3300025986 Ga0207658_10007814 Ga0207658_100078142 84
318 3300025986 Ga0207658_10010022 Ga0207658_100100222 84
319 3300025986 Ga0207658_10016276 Ga0207658_100162762 84
320 3300025986 Ga0207658_10754996 Ga0207658_107549961 84
321 3300026035 Ga0207703_10001270 Ga0207703_100012702 84
322 3300026035 Ga0207703_10098131 Ga0207703_100981313 84
323 3300026041 Ga0207639_10003454 Ga0207639_100034547 84
324 3300026041 Ga0207639_10107202 Ga0207639_101072021 84
325 3300026041 Ga0207639_10228776 Ga0207639_102287762 84
326 3300026041 Ga0207639_11060173 Ga0207639_110601731 84
327 3300026067 Ga0207678_10006049 Ga0207678_100060497 84
328 3300026067 Ga0207678_10209139 Ga0207678_102091393 84
329 3300026078 Ga0207702_10100850 Ga0207702_101008503 84
330 3300026078 Ga0207702_10201008 Ga0207702_102010082 84
331 3300026088 Ga0207641_10000198 Ga0207641_1000019872 84
332 3300026088 Ga0207641_10003709 Ga0207641_100037092 84
333 3300026088 Ga0207641_10016064 Ga0207641_100160642 84
334 3300026088 Ga0207641_10231376 Ga0207641_102313762 84
335 3300026095 Ga0207676_10005212 Ga0207676_100052122 84
336 3300026095 Ga0207676_12351381 Ga0207676_123513811 84
337 3300026116 Ga0207674_10230960 Ga0207674_102309602 84
338 3300026116 Ga0207674_11524884 Ga0207674_115248841 84
339 3300026142 Ga0207698_10000177 Ga0207698_1000017711 84
340 3300026142 Ga0207698_10019802 Ga0207698_100198026 84
341 3300026142 Ga0207698_10250029 Ga0207698_102500292 84
342 3300026142 Ga0207698_10857612 Ga0207698_108576121 84
343 3300027462 Ga0210000_1043604 Ga0210000_10436041 84
344 3300027665 Ga0209983_1052771 Ga0209983_10527712 84
345 3300027876 Ga0209974_10005438 Ga0209974_100054385 84
346 3300028379 Ga0268266_10000354 Ga0268266_1000035451 84
347 3300028379 Ga0268266_10017410 Ga0268266_100174103 84
348 3300028379 Ga0268266_10021606 Ga0268266_100216061 84
349 3300028379 Ga0268266_10046667 Ga0268266_100466672 84
350 3300028380 Ga0268265_10022535 Ga0268265_100225352 84
351 3300028380 Ga0268265_10077074 Ga0268265_100770742 84
352 3300028380 Ga0268265_10476199 Ga0268265_104761992 84
353 3300028381 Ga0268264_10000018 Ga0268264_10000018433 84
354 3300028381 Ga0268264_10034602 Ga0268264_100346024 84
355 3300028381 Ga0268264_10063371 Ga0268264_100633712 84
356 3300028381 Ga0268264_10300346 Ga0268264_103003462 84
357 3300028794 Ga0307515_10321016 Ga0307515_103210162 84
358 3300031250 Ga0265331_10045016 Ga0265331_100450161 84
359 3300031548 Ga0307408_101031487 Ga0307408_1010314872 84
360 3300031728 Ga0316578_10245466 Ga0316578_102454662 84
361 3300031731 Ga0307405_10029177 Ga0307405_100291775 84
362 3300031731 Ga0307405_10077990 Ga0307405_100779903 84
363 3300031731 Ga0307405_11451242 Ga0307405_114512422 84
364 3300031824 Ga0307413_10147315 Ga0307413_101473154 84
365 3300031824 Ga0307413_10858238 Ga0307413_108582382 84
366 3300031824 Ga0307413_10886421 Ga0307413_108864212 84
367 3300031824 Ga0307413_11104490 Ga0307413_111044901 84
368 3300031824 Ga0307413_11856967 Ga0307413_118569672 84
369 3300031852 Ga0307410_10397252 Ga0307410_103972522 84
370 3300031852 Ga0307410_10748696 Ga0307410_107486961 84
371 3300031852 Ga0307410_11050062 Ga0307410_110500622 84
372 3300031852 Ga0307410_11343112 Ga0307410_113431121 84
373 3300031852 Ga0307410_12020770 Ga0307410_120207702 84
374 3300031901 Ga0307406_10925553 Ga0307406_109255532 84
375 3300031903 Ga0307407_10287224 Ga0307407_102872242 84
376 3300031903 Ga0307407_11032494 Ga0307407_110324942 84
377 3300031911 Ga0307412_10043863 Ga0307412_100438631 84
378 3300031911 Ga0307412_10224495 Ga0307412_102244952 84
379 3300031911 Ga0307412_11430670 Ga0307412_114306702 84
380 3300031911 Ga0307412_11591209 Ga0307412_115912092 84
381 3300031995 Ga0307409_100419784 Ga0307409_1004197842 84
382 3300031995 Ga0307409_100534188 Ga0307409_1005341882 84
383 3300031995 Ga0307409_100706471 Ga0307409_1007064711 84
384 3300031995 Ga0307409_102647105 Ga0307409_1026471051 84
385 3300032002 Ga0307416_101845808 Ga0307416_1018458081 84
386 3300032002 Ga0307416_102032160 Ga0307416_1020321602 84
387 3300032004 Ga0307414_10034062 Ga0307414_100340622 84
388 3300032004 Ga0307414_10199380 Ga0307414_101993802 84
389 3300032004 Ga0307414_10523481 Ga0307414_105234812 84
390 3300032004 Ga0307414_10661470 Ga0307414_106614703 84
391 3300032004 Ga0307414_10673309 Ga0307414_106733093 84
392 3300032004 Ga0307414_11045100 Ga0307414_110451002 84
393 3300032004 Ga0307414_11468099 Ga0307414_114680992 84
394 3300032005 Ga0307411_10120547 Ga0307411_101205472 84
395 3300032005 Ga0307411_10125634 Ga0307411_101256342 84
396 3300032005 Ga0307411_10902488 Ga0307411_109024882 84
397 3300032126 Ga0307415_100182258 Ga0307415_1001822582 84
398 3300032133 Ga0316583_10003370 Ga0316583_100033703 84
399 3300035398 Ga0316574_0468711 Ga0316574_0468711_293_553 84
400 3300036647 Ga0316582_0032089 Ga0316582_0032089_2856_3113 84
401 3300036712 Ga0316584_0342664 Ga0316584_0342664_130_387 84
402 3300036712 Ga0316584_0397088 Ga0316584_0397088_615_872 84
403 3300036712 Ga0316584_1000320 Ga0316584_1000320_92_349 84
404 3300037312 Ga0395899_0003766 Ga0395899_0003766_8604_8873 84
405 3300037418 Ga0395900_0511270 Ga0395900_0511270_403_672 84
406 3300037418 Ga0395900_0573966 Ga0395900_0573966_552_815 84
407 3300037418 Ga0395900_1324974 Ga0395900_1324974_331_594 84
408 3300037471 Ga0395905_1184212 Ga0395905_1184212_83_352 84
409 3300038443 Ga0395901_0249242 Ga0395901_0249242_420_689 84
410 3300039437 Ga0436365_1372378 Ga0436365_1372378_278_535 84
411 3300039437 Ga0436365_1668286 Ga0436365_1668286_145_402 84
412 3300041486 Ga0451807_0941463 Ga0451807_0941463_137_394 84
413 3300041496 Ga0451839_1283613 Ga0451839_1283613_144_401 84
414 3300041498 Ga0451841_0662214 Ga0451841_0662214_377_634 84
415 3300041498 Ga0451841_0756227 Ga0451841_0756227_111_368 84
416 3300041505 Ga0451849_0265780 Ga0451849_0265780_334_591 84
417 3300041507 Ga0451851_0872115 Ga0451851_0872115_79_336 84
418 3300041512 Ga0451853_1262340 Ga0451853_1262340_72_329 84
419 3300041512 Ga0451853_3327244 Ga0451853_3327244_266_523 84
420 3300041997 Ga0439431_0059657 Ga0439431_0059657_492_749 84
421 3300042116 Ga0450912_021326 Ga0450912_021326_240_497 84
422 3300042123 Ga0450921_019743 Ga0450921_019743_54_311 84
423 3300042129 Ga0450891_037010 Ga0450891_037010_224_481 84
424 3300044712 Ga0453684_0103485 Ga0453684_0103485_2908_3165 84
425 3300045051 Ga0451576_0022769 Ga0451576_0022769_3429_3686 84
426 3300046453 Ga0495627_001378 Ga0495627_001378_10422_10679 84
427 3300046471 Ga0495650_0004010 Ga0495650_0004010_6345_6602 84
428 3300046474 Ga0495605_0079546 Ga0495605_0079546_265_522 84
429 3300046500 Ga0495596_0000113 Ga0495596_0000113_3556_3813 84
430 3300046501 Ga0495607_0029066 Ga0495607_0029066_55_312 84
431 3300046501 Ga0495607_0175152 Ga0495607_0175152_731_988 84
432 3300046506 Ga0495583_0276382 Ga0495583_0276382_51_308 84
433 3300046512 Ga0495610_0000018 Ga0495610_0000018_171484_171741 84
434 3300046515 Ga0495620_0028498 Ga0495620_0028498_2228_2485 84
435 3300046519 Ga0495632_0022034 Ga0495632_0022034_255_512 84
436 3300046522 Ga0495643_0000217 Ga0495643_0000217_83728_83985 84
437 3300046522 Ga0495643_0016799 Ga0495643_0016799_3002_3259 84
438 3300046522 Ga0495643_0189614 Ga0495643_0189614_391_648 84
439 3300046538 Ga0495609_0069851 Ga0495609_0069851_719_976 84
440 3300046539 Ga0495621_0005243 Ga0495621_0005243_2433_2687 84
441 3300046660 Ga0495625_0027605 Ga0495625_0027605_1668_1925 84
442 3300046692 Ga0495671_0177971 Ga0495671_0177971_30_287 84
443 3300047323 Ga0495683_0196881 Ga0495683_0196881_74_331 84
444 3300047469 Ga0495673_0343340 Ga0495673_0343340_25_282 84
445 3300047470 Ga0495681_0000792 Ga0495681_0000792_13658_13915 84
446 3300048090 Ga0495615_0000113 Ga0495615_0000113_20124_20381 84
447 3300048903 Ga0496100_0009680 Ga0496100_0009680_2058_2312 84
448 3300048904 Ga0496101_0836378 Ga0496101_0836378_269_523 84
449 3300048905 Ga0496102_0012000 Ga0496102_0012000_3542_3796 84
450 3300048905 Ga0496102_0345842 Ga0496102_0345842_744_1001 84
451 3300048905 Ga0496102_0844509 Ga0496102_0844509_397_654 84
452 3300048906 Ga0496103_0000081 Ga0496103_0000081_3739_3993 84
453 3300048906 Ga0496103_0188910 Ga0496103_0188910_120_377 84
454 3300048907 Ga0496104_0043737 Ga0496104_0043737_2209_2463 84
455 3300048907 Ga0496104_0094946 Ga0496104_0094946_2093_2350 84
456 3300048908 Ga0496105_0022181 Ga0496105_0022181_2029_2283 84
457 3300048908 Ga0496105_0040467 Ga0496105_0040467_128_385 84
458 3300048910 Ga0496107_0662264 Ga0496107_0662264_368_622 84
459 3300048913 Ga0496110_1298700 Ga0496110_1298700_121_375 84
460 3300048914 Ga0496111_0890057 Ga0496111_0890057_164_418 84
461 3300048916 Ga0496113_0205129 Ga0496113_0205129_1273_1527 84
462 3300048916 Ga0496113_0385744 Ga0496113_0385744_760_1014 84
463 3300048916 Ga0496113_0592594 Ga0496113_0592594_337_600 84
464 3300048917 Ga0496114_0034544 Ga0496114_0034544_3785_4039 84
465 3300048918 Ga0496115_0879009 Ga0496115_0879009_104_358 84
466 3300048919 Ga0496116_0160592 Ga0496116_0160592_910_1164 84
467 3300048920 Ga0496117_0010088 Ga0496117_0010088_4835_5089 84
468 3300048920 Ga0496117_0225934 Ga0496117_0225934_87_344 84
469 3300048921 Ga0496118_0059496 Ga0496118_0059496_386_643 84
470 3300048921 Ga0496118_0093553 Ga0496118_0093553_1376_1630 84
471 3300048921 Ga0496118_0134474 Ga0496118_0134474_1077_1334 84
472 3300048922 Ga0496119_0022504 Ga0496119_0022504_3640_3894 84
473 3300048923 Ga0496120_0022329 Ga0496120_0022329_2190_2444 84
474 3300048924 Ga0496121_0000021 Ga0496121_0000021_356257_356514 84
475 3300048924 Ga0496121_0001016 Ga0496121_0001016_3401_3658 84
476 3300048924 Ga0496121_0020181 Ga0496121_0020181_2979_3233 84
477 3300048924 Ga0496121_0100988 Ga0496121_0100988_1219_1476 84
478 3300048925 Ga0496122_0026363 Ga0496122_0026363_3406_3660 84
479 3300048925 Ga0496122_0027958 Ga0496122_0027958_3150_3407 84
480 3300048925 Ga0496122_0618585 Ga0496122_0618585_124_381 84
481 3300048926 Ga0496123_0006131 Ga0496123_0006131_9018_9275 84
482 3300048926 Ga0496123_0049053 Ga0496123_0049053_764_1021 84
483 3300048926 Ga0496123_0068111 Ga0496123_0068111_451_705 84
484 3300048927 Ga0496124_0009285 Ga0496124_0009285_8903_9157 84
485 3300048927 Ga0496124_0070953 Ga0496124_0070953_2502_2759 84
486 3300048927 Ga0496124_0486385 Ga0496124_0486385_326_583 84
487 3300048927 Ga0496124_0702969 Ga0496124_0702969_221_478 84
488 3300048928 Ga0496125_0003360 Ga0496125_0003360_640_894 84
489 3300048928 Ga0496125_0028306 Ga0496125_0028306_4624_4881 84
490 3300048929 Ga0496126_0000028 Ga0496126_0000028_195653_195907 84
491 3300048929 Ga0496126_0043461 Ga0496126_0043461_3881_4135 84
492 3300048929 Ga0496126_0045167 Ga0496126_0045167_437_694 84
493 3300049127 Ga0501306_014832 Ga0501306_014832_166_420 84
494 3300049569 Ga0501032_0779476 Ga0501032_0779476_191_445 84
495 3300049571 Ga0501034_0578143 Ga0501034_0578143_168_425 84
496 3300049575 Ga0501039_0297979 Ga0501039_0297979_69_326 84
497 3300049575 Ga0501039_0704816 Ga0501039_0704816_308_562 84
498 3300049578 Ga0501042_0201556 Ga0501042_0201556_328_585 84
499 3300049586 Ga0501070_0614950 Ga0501070_0614950_20_274 84
500 3300049663 Ga0501223_142054 Ga0501223_142054_67_324 84
501 3300049664 Ga0501224_052401 Ga0501224_052401_47_301 84
502 3300049679 Ga0501249_039421 Ga0501249_039421_625_879 84
503 3300049683 Ga0501253_041244 Ga0501253_041244_622_876 84
504 3300049765 Ga0501268_044031 Ga0501268_044031_159_413 84
505 3300049823 Ga0501044_0074168 Ga0501044_0074168_437_691 84
506 3300049823 Ga0501044_0182431 Ga0501044_0182431_1545_1802 84
507 3300050489 nmdc:mga03683_375711_c1 nmdc:mga03683_375711_c1_17_271 84
508 3300050489 nmdc:mga03683_42_c1 nmdc:mga03683_42_c1_24833_25090 84
509 3300050489 nmdc:mga03683_7634_c1 nmdc:mga03683_7634_c1_827_1081 84
510 3300050490 nmdc:mga03n38_959_c1 nmdc:mga03n38_959_c1_7437_7694 84
511 3300050491 nmdc:mga00v17_136091_c1 nmdc:mga00v17_136091_c1_310_567 84
512 3300050491 nmdc:mga00v17_25342_c1 nmdc:mga00v17_25342_c1_501_755 84
513 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_94224_94481 84
514 3300050493 nmdc:mga0k408_411782_c1 nmdc:mga0k408_411782_c1_46_300 84
515 3300050496 nmdc:mga07m45_371029_c1 nmdc:mga07m45_371029_c1_360_614 84
516 3300050511 nmdc:mga08y16_314576_c1 nmdc:mga08y16_314576_c1_1037_1294 84
517 3300050516 nmdc:mga0sz30_14903_c1 nmdc:mga0sz30_14903_c1_126_380 84
518 3300050516 nmdc:mga0sz30_3181_c1 nmdc:mga0sz30_3181_c1_3480_3737 84
519 3300053121 Ga0500607_033455 Ga0500607_033455_2184_2441 84
520 3300053125 Ga0500618_004249 Ga0500618_004249_1111_1368 84
521 3300053139 Ga0500568_0291104 Ga0500568_0291104_120_374 84
522 3300053148 Ga0500590_148733 Ga0500590_148733_726_983 84
523 3300053154 Ga0500619_272223 Ga0500619_272223_184_441 84
524 3300053178 Ga0500637_0562455 Ga0500637_0562455_277_534 84
525 3300059477 Ga0587084_004794 Ga0587084_004794_1298_1555 84
526 3300059510 Ga0587090_000073 Ga0587090_000073_804_1061 84
527 3300059626 Ga0587115_012981 Ga0587115_012981_16_273 84
528 3300059645 Ga0587076_012545 Ga0587076_012545_16_273 84
529 3300060346 Ga0587111_0062462 Ga0587111_0062462_16_273 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

15

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zwl-assembly1.cif.gz_E crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial f1-atpase 0.9528 2 83
6fkh-assembly1.cif.gz_e chloroplast f1fo conformation 2 0.9393 2 83
6q45-assembly2.cif.gz_P f1-atpase from fusobacterium nucleatum 0.9219 2 83
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9208 1 83
6n2z-assembly1.cif.gz_H bacillus ps3 atp synthase class 2 0.9198 2 83
ID Description Score Start End Superfamily
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9567 2 83 2.60.15.10
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9238 2 83 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9153 2 83 2.60.15.10
5dn6I00 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9137 7 79 2.60.15.10
af_P9WPV1_1_120_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9117 2 83 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A196MK06-F1-model_v4 ATP synthase F1 subunit epsilon 1.007 2 83 GO:0012505
GO:0045261
GO:0046933
AF-T0IQ26-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 1.007 2 83 GO:0005524
GO:0005886
GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A0N1L3H5-F1-model_v4 ATP synthase F0F1 subunit epsilon (EC 3.6.3.14) 1.006 1 84 GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A0B2C3L1-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 1.006 2 84 GO:0005524
GO:0005886
GO:0012505
GO:0016787
GO:0045261
GO:0046933
AF-A0A7W7EZJ8-F1-model_v4 F-type H+-transporting ATPase subunit epsilon 1.005 2 83 GO:0012505
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
97.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map