F459796

General Info

Members Datasets Scaffolds Average Seq Length
529 289 1058 101

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_101335070|Ga0075436_1013350702
Length 108
Sequence MADVNYIDWHVHPFRSDRWLEIWRPALDRALAFGARSCYLTRDIDDPLHFRQVSVWDDHADFERYWYSDEIAAQREALQGYFNVPVLPEFYEIVGEGRALSLAPEEPS

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
192 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 8.32
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 9.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_101335070 3300006914 Bacteria 543
2 CNAas_1011488 3300000532 Bacteria 599
3 JGI24743J22301_10096452 3300001991 Bacteria 634
4 JGI24751J29686_10026942 3300002459 Bacteria 1193
5 JGI25404J52841_10021990 3300003659 Bacteria 1380
6 Ga0070658_10190259 3300005327 Bacteria 1730
7 Ga0070683_100016350 3300005329 Bacteria 6542
8 Ga0070683_100071230 3300005329 Bacteria 3243
9 Ga0070683_100444286 3300005329 Unclassified 1237
10 Ga0070683_101328676 3300005329 Bacteria 691
11 Ga0070690_100133061 3300005330 Bacteria 1681
12 Ga0070690_101252185 3300005330 Unclassified 593
13 Ga0070670_100149841 3300005331 Unclassified 2019
14 Ga0068869_102146520 3300005334 Unclassified 502
15 Ga0070680_100413928 3300005336 Bacteria 1150
16 Ga0070682_100000150 3300005337 Bacteria 55238
17 Ga0070682_100073609 3300005337 Bacteria 2192
18 Ga0068868_100000450 3300005338 Bacteria 27515
19 Ga0068868_100002756 3300005338 Bacteria 12165
20 Ga0068868_100729135 3300005338 Bacteria 889
21 Ga0068868_101674955 3300005338 Bacteria 599
22 Ga0070660_100207563 3300005339 Bacteria 1590
23 Ga0070689_100747599 3300005340 Bacteria 857
24 Ga0070687_100203649 3300005343 Unclassified 1201
25 Ga0070687_100449919 3300005343 Bacteria 856
26 Ga0070661_100000102 3300005344 Bacteria 69941
27 Ga0070692_10044881 3300005345 Bacteria 2279
28 Ga0070668_100031876 3300005347 Bacteria 4011
29 Ga0070668_100203778 3300005347 Bacteria 1625
30 Ga0070668_100497236 3300005347 Bacteria 1055
31 Ga0070668_101320920 3300005347 Unclassified 656
32 Ga0070669_101232365 3300005353 Bacteria 647
33 Ga0070675_100000027 3300005354 Bacteria 106172
34 Ga0070674_100092136 3300005356 Bacteria 2190
35 Ga0070674_100857662 3300005356 Bacteria 788
36 Ga0070674_101169558 3300005356 Bacteria 682
37 Ga0070673_100291921 3300005364 Bacteria 1433
38 Ga0070673_100812492 3300005364 Bacteria 864
39 Ga0070688_100001250 3300005365 Bacteria 12681
40 Ga0070688_100001531 3300005365 Bacteria 11553
41 Ga0070688_100323861 3300005365 Bacteria 1121
42 Ga0070688_100587882 3300005365 Bacteria 851
43 Ga0070659_100119409 3300005366 Bacteria 2134
44 Ga0070659_101071206 3300005366 Bacteria 710
45 Ga0070667_100006185 3300005367 Bacteria 9957
46 Ga0070667_100167082 3300005367 Bacteria 1941
47 Ga0070714_100090319 3300005435 Bacteria 2682
48 Ga0070713_100000085 3300005436 Bacteria 58902
49 Ga0070701_10440854 3300005438 Bacteria 834
50 Ga0070701_10468127 3300005438 Bacteria 812
51 Ga0070701_10857506 3300005438 Unclassified 624
52 Ga0070711_100003742 3300005439 Bacteria 8920
53 Ga0070705_100502191 3300005440 Unclassified 921
54 Ga0070700_100229234 3300005441 Bacteria 1321
55 Ga0070700_100659437 3300005441 Unclassified 827
56 Ga0070694_100672458 3300005444 Bacteria 840
57 Ga0070694_100941252 3300005444 Bacteria 715
58 Ga0070708_101900548 3300005445 Bacteria 552
59 Ga0070663_100824965 3300005455 Bacteria 797
60 Ga0070663_101859017 3300005455 Unclassified 540
61 Ga0070678_100025174 3300005456 Bacteria 3999
62 Ga0070678_100096103 3300005456 Bacteria 2285
63 Ga0070678_100187127 3300005456 Bacteria 1700
64 Ga0070662_100000004 3300005457 Bacteria 195534
65 Ga0070662_101357189 3300005457 Bacteria 612
66 Ga0070681_10579294 3300005458 Unclassified 1036
67 Ga0068867_100528839 3300005459 Bacteria 1018
68 Ga0068867_100892607 3300005459 Bacteria 799
69 Ga0070685_10001410 3300005466 Bacteria 12591
70 Ga0070685_10001719 3300005466 Bacteria 11497
71 Ga0070685_10128981 3300005466 Bacteria 1579
72 Ga0070685_11453797 3300005466 Bacteria 527
73 Ga0070706_101720280 3300005467 Bacteria 571
74 Ga0070707_100644243 3300005468 Bacteria 1022
75 Ga0070684_100024292 3300005535 Bacteria 5082
76 Ga0070684_100156085 3300005535 Bacteria 2069
77 Ga0070684_100430015 3300005535 Unclassified 1219
78 Ga0068853_100283811 3300005539 Bacteria 1526
79 Ga0070686_100157757 3300005544 Bacteria 1595
80 Ga0070695_100320435 3300005545 Bacteria 1152
81 Ga0070696_100310799 3300005546 Bacteria 1210
82 Ga0070693_100004573 3300005547 Bacteria 6563
83 Ga0070665_100039235 3300005548 Bacteria 4762
84 Ga0070665_100177505 3300005548 Bacteria 2131
85 Ga0070665_100440390 3300005548 Bacteria 1312
86 Ga0070704_100118890 3300005549 Bacteria 2025
87 Ga0070704_102191011 3300005549 Unclassified 514
88 Ga0070664_100224234 3300005564 Bacteria 1682
89 Ga0068857_100055196 3300005577 Bacteria 3526
90 Ga0068854_100000156 3300005578 Bacteria 46593
91 Ga0068854_100850248 3300005578 Bacteria 799
92 Ga0068856_100008468 3300005614 Bacteria 10010
93 Ga0068856_100166410 3300005614 Bacteria 2216
94 Ga0068852_100000006 3300005616 Bacteria 159569
95 Ga0068852_100173873 3300005616 Bacteria 2021
96 Ga0068852_100432959 3300005616 Bacteria 1299
97 Ga0068864_100000053 3300005618 Bacteria 133049
98 Ga0068866_10104193 3300005718 Bacteria 1571
99 Ga0068866_10252856 3300005718 Bacteria 1079
100 Ga0068851_10001568 3300005834 Bacteria 10036
101 Ga0068851_10277035 3300005834 Unclassified 958
102 Ga0068870_10274147 3300005840 Bacteria 1055
103 Ga0068870_10669180 3300005840 Bacteria 713
104 Ga0068863_100013897 3300005841 Bacteria 7763
105 Ga0068863_101116738 3300005841 Unclassified 793
106 Ga0068858_100133034 3300005842 Bacteria 2333
107 Ga0068858_100848521 3300005842 Bacteria 892
108 Ga0068860_100099968 3300005843 Bacteria 2767
109 Ga0068860_100213711 3300005843 Bacteria 1871
110 Ga0068862_100000050 3300005844 Bacteria 145502
111 Ga0068862_101871538 3300005844 Unclassified 610
112 Ga0081455_10015768 3300005937 Bacteria 7320
113 Ga0081455_10126014 3300005937 Bacteria 2010
114 Ga0081538_10259574 3300005981 Bacteria 657
115 Ga0081540_1000163 3300005983 Bacteria 68955
116 Ga0075365_10000254 3300006038 Bacteria 18312
117 Ga0075365_10009768 3300006038 Bacteria 5543
118 Ga0075365_10011771 3300006038 Bacteria 5160
119 Ga0075365_10209183 3300006038 Bacteria 1367
120 Ga0075365_10565614 3300006038 Bacteria 804
121 Ga0075368_10143636 3300006042 Bacteria 995
122 Ga0075368_10308826 3300006042 Bacteria 683
123 Ga0075363_100206608 3300006048 Bacteria 1123
124 Ga0075363_101000489 3300006048 Unclassified 515
125 Ga0075364_10048139 3300006051 Bacteria 2778
126 Ga0075364_10073425 3300006051 Bacteria 2255
127 Ga0070715_10090788 3300006163 Bacteria 1405
128 Ga0070712_100128331 3300006175 Bacteria 1919
129 Ga0075367_10171417 3300006178 Bacteria 1352
130 Ga0075367_10736944 3300006178 Bacteria 627
131 Ga0097621_101384106 3300006237 Bacteria 666
132 Ga0068871_100486996 3300006358 Unclassified 1110
133 Ga0075428_100031418 3300006844 Bacteria 5870
134 Ga0075430_100280718 3300006846 Bacteria 1378
135 Ga0075430_100923773 3300006846 Unclassified 719
136 Ga0075431_100001567 3300006847 Bacteria 21238
137 Ga0075431_101320141 3300006847 Bacteria 682
138 Ga0075433_10014351 3300006852 Bacteria 6471
139 Ga0075433_10111759 3300006852 Archaea 2424
140 Ga0075434_100001678 3300006871 Bacteria 18909
141 Ga0075434_100030706 3300006871 Bacteria 5293
142 Ga0068865_100000023 3300006881 Bacteria 100785
143 Ga0068865_100059820 3300006881 Bacteria 2666
144 Ga0075435_100460636 3300007076 Bacteria 1097
145 Ga0075435_100779849 3300007076 Bacteria 832
146 Ga0105240_10517701 3300009093 Bacteria 1324
147 Ga0105240_11104890 3300009093 Unclassified 843
148 Ga0111539_10005066 3300009094 Bacteria 17115
149 Ga0111539_10300546 3300009094 Bacteria 1868
150 Ga0111539_12124471 3300009094 Unclassified 651
151 Ga0105245_10000254 3300009098 Bacteria 50918
152 Ga0105245_10011357 3300009098 Bacteria 7756
153 Ga0105245_10261871 3300009098 Bacteria 1683
154 Ga0105245_10770683 3300009098 Bacteria 999
155 Ga0105245_10787908 3300009098 Bacteria 988
156 Ga0114129_10006865 3300009147 Bacteria 16187
157 Ga0114129_10740223 3300009147 Bacteria 1259
158 Ga0114129_11577306 3300009147 Bacteria 804
159 Ga0105243_10162820 3300009148 Bacteria 1925
160 Ga0105243_10287503 3300009148 Bacteria 1484
161 Ga0105243_11951245 3300009148 Unclassified 621
162 Ga0105241_10052214 3300009174 Bacteria 3120
163 Ga0105242_10000032 3300009176 Bacteria 98198
164 Ga0105242_11802106 3300009176 Bacteria 650
165 Ga0105248_10000008 3300009177 Bacteria 403910
166 Ga0105248_10359559 3300009177 Bacteria 1639
167 Ga0105238_11268020 3300009551 Bacteria 762
168 Ga0105249_10118734 3300009553 Bacteria 2511
169 Ga0105249_10140910 3300009553 Bacteria 2312
170 Ga0105249_11329598 3300009553 Bacteria 790
171 Ga0105249_11635343 3300009553 Bacteria 717
172 Ga0105239_10268371 3300010375 Bacteria 1919
173 Ga0105239_10610284 3300010375 Bacteria 1245
174 Ga0105239_10729858 3300010375 Bacteria 1133
175 Ga0105239_13428268 3300010375 Bacteria 516
176 Ga0157342_1016405 3300012507 Bacteria 819
177 Ga0157371_10004749 3300013102 Bacteria 11723
178 Ga0157370_10023676 3300013104 Bacteria 6094
179 Ga0157370_10141010 3300013104 Unclassified 2246
180 Ga0157369_10000020 3300013105 Bacteria 241679
181 Ga0157369_11623048 3300013105 Unclassified 657
182 Ga0157374_10308513 3300013296 Bacteria 1566
183 Ga0157374_10727882 3300013296 Bacteria 1006
184 Ga0157378_10005986 3300013297 Bacteria 10663
185 Ga0157378_10030467 3300013297 Bacteria 4768
186 Ga0157378_10238950 3300013297 Bacteria 1735
187 Ga0157378_10749058 3300013297 Bacteria 1000
188 Ga0157378_12450227 3300013297 Unclassified 574
189 Ga0163162_10150512 3300013306 Bacteria 2444
190 Ga0163162_10672328 3300013306 Bacteria 1158
191 Ga0157372_10000112 3300013307 Bacteria 85902
192 Ga0157372_10515980 3300013307 Bacteria 1393
193 Ga0157375_10101600 3300013308 Bacteria 2959
194 Ga0157375_10706131 3300013308 Bacteria 1162
195 Ga0163163_11307028 3300014325 Bacteria 787
196 Ga0163163_11956392 3300014325 Bacteria 646
197 Ga0157380_10000091 3300014326 Bacteria 49188
198 Ga0157380_10477609 3300014326 Bacteria 1205
199 Ga0157377_11493300 3300014745 Bacteria 537
200 Ga0157379_10031097 3300014968 Bacteria 4757
201 Ga0157379_10068023 3300014968 Bacteria 3184
202 Ga0157379_10581618 3300014968 Bacteria 1044
203 Ga0157376_12911503 3300014969 Unclassified 518
204 Ga0206356_10199296 3300020070 Bacteria 1213
205 Ga0224712_10038893 3300022467 Bacteria 1780
206 Ga0207656_10000385 3300025321 Bacteria 14857
207 Ga0207656_10187978 3300025321 Unclassified 994
208 Ga0207642_10078160 3300025899 Bacteria 1598
209 Ga0207688_10144741 3300025901 Bacteria 1400
210 Ga0207688_10275190 3300025901 Bacteria 1025
211 Ga0207685_10212719 3300025905 Bacteria 915
212 Ga0207645_10525397 3300025907 Bacteria 802
213 Ga0207643_10186047 3300025908 Bacteria 1259
214 Ga0207705_10167133 3300025909 Bacteria 1655
215 Ga0207654_10271036 3300025911 Bacteria 1145
216 Ga0207695_10353802 3300025913 Bacteria 1355
217 Ga0207695_10515603 3300025913 Bacteria 1077
218 Ga0207693_10028297 3300025915 Bacteria 4428
219 Ga0207693_10048890 3300025915 Bacteria 3321
220 Ga0207663_10002370 3300025916 Bacteria 9051
221 Ga0207662_10128755 3300025918 Bacteria 1594
222 Ga0207649_10000009 3300025920 Bacteria 295544
223 Ga0207649_10350271 3300025920 Bacteria 1093
224 Ga0207681_11318969 3300025923 Unclassified 606
225 Ga0207650_10130173 3300025925 Unclassified 1968
226 Ga0207659_10000010 3300025926 Bacteria 286639
227 Ga0207687_10000007 3300025927 Bacteria 604185
228 Ga0207687_10052479 3300025927 Bacteria 2846
229 Ga0207687_10082407 3300025927 Bacteria 2327
230 Ga0207687_10694306 3300025927 Bacteria 863
231 Ga0207700_10000027 3300025928 Bacteria 137708
232 Ga0207664_10100280 3300025929 Bacteria 2391
233 Ga0207690_10076663 3300025932 Bacteria 2322
234 Ga0207690_10141963 3300025932 Bacteria 1771
235 Ga0207706_10000012 3300025933 Bacteria 195475
236 Ga0207706_11432935 3300025933 Bacteria 566
237 Ga0207686_10000048 3300025934 Bacteria 115595
238 Ga0207709_10093921 3300025935 Bacteria 1967
239 Ga0207709_10404037 3300025935 Bacteria 1045
240 Ga0207670_10996910 3300025936 Bacteria 705
241 Ga0207669_10209009 3300025937 Bacteria 1423
242 Ga0207704_10000159 3300025938 Bacteria 36005
243 Ga0207704_10130732 3300025938 Bacteria 1738
244 Ga0207711_10000006 3300025941 Bacteria 792692
245 Ga0207661_10000253 3300025944 Bacteria 34627
246 Ga0207661_10007822 3300025944 Bacteria 7613
247 Ga0207661_10148671 3300025944 Bacteria 2023
248 Ga0207679_10293740 3300025945 Bacteria 1398
249 Ga0207651_10550904 3300025960 Bacteria 1003
250 Ga0207712_10096320 3300025961 Bacteria 2190
251 Ga0207712_10859340 3300025961 Unclassified 800
252 Ga0207668_10019945 3300025972 Bacteria 4250
253 Ga0207668_10027927 3300025972 Bacteria 3683
254 Ga0207668_10045033 3300025972 Bacteria 3006
255 Ga0207668_10409174 3300025972 Bacteria 1149
256 Ga0207668_10460501 3300025972 Bacteria 1087
257 Ga0207640_10000038 3300025981 Bacteria 108630
258 Ga0207640_10404440 3300025981 Bacteria 1113
259 Ga0207658_10013822 3300025986 Bacteria 5523
260 Ga0207677_10000200 3300026023 Bacteria 48320
261 Ga0207677_10001552 3300026023 Bacteria 12156
262 Ga0207677_10039577 3300026023 Bacteria 3101
263 Ga0207677_10972498 3300026023 Bacteria 768
264 Ga0207677_11461843 3300026023 Bacteria 631
265 Ga0207703_11322304 3300026035 Unclassified 693
266 Ga0207639_10230174 3300026041 Bacteria 1606
267 Ga0207678_10334328 3300026067 Bacteria 1304
268 Ga0207708_10047844 3300026075 Bacteria 3255
269 Ga0207708_10193019 3300026075 Bacteria 1622
270 Ga0207708_12002187 3300026075 Unclassified 507
271 Ga0207702_10000158 3300026078 Bacteria 79984
272 Ga0207641_10005198 3300026088 Bacteria 11129
273 Ga0207641_10703844 3300026088 Unclassified 995
274 Ga0207648_10006385 3300026089 Bacteria 11717
275 Ga0207648_10801368 3300026089 Bacteria 877
276 Ga0207648_11083934 3300026089 Bacteria 751
277 Ga0207676_10000195 3300026095 Bacteria 52951
278 Ga0207674_10107055 3300026116 Bacteria 2773
279 Ga0207683_10011741 3300026121 Bacteria 7475
280 Ga0207683_10334641 3300026121 Bacteria 1388
281 Ga0207698_10000013 3300026142 Bacteria 255414
282 Ga0207698_10068043 3300026142 Bacteria 2811
283 Ga0207698_10526067 3300026142 Bacteria 1155
284 Ga0207698_10643432 3300026142 Bacteria 1050
285 Ga0209813_10106604 3300027866 Bacteria 960
286 Ga0207428_10053592 3300027907 Bacteria 3216
287 Ga0268266_10009710 3300028379 Bacteria 8457
288 Ga0268266_10113867 3300028379 Bacteria 2399
289 Ga0268266_10626190 3300028379 Bacteria 1034
290 Ga0268265_10001136 3300028380 Bacteria 23498
291 Ga0268265_10726034 3300028380 Unclassified 962
292 Ga0268264_10238155 3300028381 Bacteria 1684
293 Ga0268264_11502190 3300028381 Unclassified 684
294 Ga0268264_12015981 3300028381 Bacteria 586
295 Ga0265337_1000807 3300028556 Bacteria 16498
296 Ga0265326_10000252 3300028558 Bacteria 25133
297 Ga0265319_1044415 3300028563 Bacteria 1489
298 Ga0265334_10116393 3300028573 Bacteria 958
299 Ga0265334_10283867 3300028573 Bacteria 568
300 Ga0265322_10000001 3300028654 Bacteria 543854
301 Ga0265336_10004887 3300028666 Bacteria 5023
302 Ga0265338_10284399 3300028800 Bacteria 1207
303 Ga0265324_10000498 3300029957 Bacteria 27248
304 Ga0265332_10017744 3300031238 Bacteria 3141
305 Ga0265328_10001094 3300031239 Bacteria 12441
306 Ga0265320_10000002 3300031240 Bacteria 542875
307 Ga0265329_10010170 3300031242 Bacteria 3470
308 Ga0265339_10033137 3300031249 Bacteria 2911
309 Ga0265331_10008961 3300031250 Bacteria 5655
310 Ga0265327_10000011 3300031251 Bacteria 543807
311 Ga0307408_100304669 3300031548 Bacteria 1336
312 Ga0265314_10000062 3300031711 Bacteria 159496
313 Ga0307415_100001241 3300032126 Bacteria 11977
314 Ga0373943_0224989 3300035170 Bacteria 1046
315 Ga0373961_0280663 3300035241 Unclassified 611
316 Ga0316574_0035851 3300035398 Bacteria 3034
317 Ga0373947_0862950 3300035725 Bacteria 618
318 Ga0395899_0019253 3300037312 Bacteria 5188
319 Ga0395899_0969220 3300037312 Bacteria 515
320 Ga0395900_0240995 3300037418 Bacteria 1814
321 Ga0395900_0325411 3300037418 Unclassified 1516
322 Ga0395898_0001408 3300037466 Bacteria 34249
323 Ga0395898_0178368 3300037466 Bacteria 2030
324 Ga0395898_0759438 3300037466 Unclassified 911
325 Ga0395898_1093279 3300037466 Bacteria 731
326 Ga0395905_0013982 3300037471 Bacteria 7678
327 Ga0395905_0149279 3300037471 Bacteria 2199
328 Ga0395901_0004783 3300038443 Bacteria 13666
329 Ga0395901_0200958 3300038443 Bacteria 2089
330 Ga0395901_1530705 3300038443 Unclassified 622
331 Ga0242420_039261 3300038996 Bacteria 901
332 Ga0451804_0586164 3300041463 Unclassified 525
333 Ga0451807_2276071 3300041486 Bacteria 1586
334 Ga0451837_1359903 3300041494 Bacteria 651
335 Ga0451855_0011574 3300041511 Bacteria 698
336 Ga0451853_2385083 3300041512 Bacteria 1131
337 Ga0466963_0006674 3300044694 Bacteria 6855
338 Ga0466964_0249778 3300044706 Bacteria 874
339 Ga0466957_0029121 3300044842 Bacteria 3292
340 Ga0466957_0287140 3300044842 Bacteria 1102
341 Ga0466958_0113749 3300045836 Bacteria 1690
342 Ga0466967_0000009 3300045976 Bacteria 122610
343 Ga0466967_0046799 3300045976 Bacteria 3768
344 Ga0495592_0392807 3300046454 Bacteria 880
345 Ga0495603_0000016 3300046455 Bacteria 67399
346 Ga0495603_0117873 3300046455 Bacteria 1548
347 Ga0495590_0250346 3300046457 Bacteria 659
348 Ga0495629_0001726 3300046459 Bacteria 17147
349 Ga0495629_0071888 3300046459 Bacteria 2414
350 Ga0495629_0505314 3300046459 Bacteria 815
351 Ga0495629_1028965 3300046459 Bacteria 535
352 Ga0495641_0007825 3300046461 Bacteria 6617
353 Ga0495641_0143819 3300046461 Bacteria 1065
354 Ga0495582_0162122 3300046473 Bacteria 1272
355 Ga0495662_0004365 3300046476 Bacteria 7100
356 Ga0495607_0214274 3300046501 Bacteria 946
357 Ga0495606_0000072 3300046507 Bacteria 173678
358 Ga0495610_0104506 3300046512 Bacteria 1263
359 Ga0495628_0210425 3300046516 Bacteria 1463
360 Ga0495630_0000020 3300046517 Bacteria 176389
361 Ga0495630_0137874 3300046517 Bacteria 1854
362 Ga0495644_0003786 3300046523 Bacteria 5953
363 Ga0495644_0020961 3300046523 Bacteria 2494
364 Ga0495666_0346009 3300046526 Bacteria 670
365 Ga0495640_0704543 3300046533 Unclassified 606
366 Ga0495587_0758295 3300046536 Bacteria 531
367 Ga0495598_0056702 3300046537 Bacteria 1196
368 Ga0495667_0410266 3300046559 Bacteria 853
369 Ga0495625_0568084 3300046660 Bacteria 685
370 Ga0495635_0100682 3300046663 Bacteria 1975
371 Ga0495635_0188788 3300046663 Bacteria 1399
372 Ga0495661_0278575 3300046665 Bacteria 844
373 Ga0495588_0000134 3300046674 Bacteria 117581
374 Ga0495647_0000156 3300046681 Bacteria 17539
375 Ga0495647_0032967 3300046681 Bacteria 1934
376 Ga0495658_0150163 3300046683 Bacteria 1430
377 Ga0495613_0000801 3300046689 Bacteria 24391
378 Ga0495624_0000647 3300046690 Bacteria 27259
379 Ga0495624_0118680 3300046690 Bacteria 1625
380 Ga0495624_0404917 3300046690 Bacteria 819
381 Ga0495581_0041693 3300047315 Bacteria 2657
382 Ga0495672_0054930 3300047320 Bacteria 2325
383 Ga0495672_0438509 3300047320 Bacteria 591
384 Ga0495676_0034423 3300047321 Bacteria 4251
385 Ga0495676_0210851 3300047321 Bacteria 1344
386 Ga0495676_0255640 3300047321 Bacteria 1193
387 Ga0495676_0373998 3300047321 Bacteria 949
388 Ga0495680_0004286 3300047322 Bacteria 13686
389 Ga0495680_0087866 3300047322 Bacteria 2337
390 Ga0495680_0162728 3300047322 Bacteria 1619
391 Ga0495593_0446320 3300047673 Unclassified 647
392 Ga0495614_0348313 3300048089 Unclassified 690
393 Ga0496100_0003241 3300048903 Bacteria 8456
394 Ga0496101_0045653 3300048904 Bacteria 3139
395 Ga0496102_0000115 3300048905 Bacteria 114224
396 Ga0496102_0033079 3300048905 Bacteria 4645
397 Ga0496102_0436598 3300048905 Bacteria 1229
398 Ga0496102_0553888 3300048905 Bacteria 1073
399 Ga0496102_1042455 3300048905 Bacteria 738
400 Ga0496103_0000008 3300048906 Bacteria 340474
401 Ga0496103_0005173 3300048906 Bacteria 7850
402 Ga0496103_0196322 3300048906 Bacteria 1298
403 Ga0496104_0000004 3300048907 Bacteria 641830
404 Ga0496104_0380101 3300048907 Bacteria 1325
405 Ga0496104_1377168 3300048907 Bacteria 608
406 Ga0496105_0000001 3300048908 Bacteria 1328178
407 Ga0496105_0199680 3300048908 Unclassified 1632
408 Ga0496106_0006555 3300048909 Bacteria 8622
409 Ga0496106_0192776 3300048909 Bacteria 1621
410 Ga0496107_0018938 3300048910 Bacteria 4853
411 Ga0496107_0039557 3300048910 Bacteria 3383
412 Ga0496107_0268895 3300048910 Bacteria 1269
413 Ga0496108_0000175 3300048911 Bacteria 59373
414 Ga0496108_0174293 3300048911 Bacteria 1861
415 Ga0496108_0404344 3300048911 Bacteria 1192
416 Ga0496109_0000121 3300048912 Bacteria 81487
417 Ga0496109_0000249 3300048912 Bacteria 51718
418 Ga0496109_0111597 3300048912 Bacteria 2542
419 Ga0496109_0826775 3300048912 Unclassified 864
420 Ga0496110_0001510 3300048913 Bacteria 16887
421 Ga0496110_0021318 3300048913 Bacteria 5483
422 Ga0496110_0270238 3300048913 Bacteria 1548
423 Ga0496110_0833920 3300048913 Bacteria 827
424 Ga0496111_0000009 3300048914 Bacteria 93943
425 Ga0496111_0017476 3300048914 Bacteria 4959
426 Ga0496111_0229400 3300048914 Bacteria 1379
427 Ga0496112_0003135 3300048915 Bacteria 13566
428 Ga0496113_0023007 3300048916 Bacteria 4415
429 Ga0496113_0124627 3300048916 Bacteria 2017
430 Ga0496114_0013450 3300048917 Bacteria 6561
431 Ga0496114_0620830 3300048917 Bacteria 952
432 Ga0496114_1310020 3300048917 Bacteria 611
433 Ga0496115_0012444 3300048918 Bacteria 6405
434 Ga0496115_0077192 3300048918 Bacteria 2708
435 Ga0496119_0005911 3300048922 Bacteria 11538
436 Ga0496120_0141614 3300048923 Unclassified 1220
437 Ga0501031_0197227 3300049568 Bacteria 1314
438 Ga0501031_0918858 3300049568 Bacteria 560
439 Ga0501033_0226434 3300049570 Bacteria 1330
440 Ga0501036_0140288 3300049572 Bacteria 2040
441 Ga0501038_0355219 3300049574 Bacteria 1141
442 Ga0501039_0231756 3300049575 Bacteria 1452
443 Ga0501040_1128466 3300049576 Bacteria 569
444 Ga0501041_0153342 3300049577 Bacteria 1439
445 Ga0501041_0649779 3300049577 Bacteria 674
446 Ga0501042_0180552 3300049578 Bacteria 1523
447 Ga0501042_0607065 3300049578 Bacteria 795
448 Ga0501042_0968291 3300049578 Bacteria 620
449 Ga0501046_0794413 3300049580 Bacteria 663
450 Ga0501048_0113075 3300049582 Bacteria 1918
451 Ga0501048_0406323 3300049582 Bacteria 974
452 Ga0501048_0552602 3300049582 Bacteria 826
453 Ga0501048_0700740 3300049582 Bacteria 727
454 Ga0501068_0245467 3300049584 Bacteria 1140
455 Ga0501068_0736809 3300049584 Bacteria 645
456 Ga0501070_0397013 3300049586 Bacteria 1116
457 Ga0501070_1306118 3300049586 Unclassified 554
458 Ga0501071_0106318 3300049587 Unclassified 2072
459 Ga0501071_0140618 3300049587 Bacteria 1797
460 Ga0501071_0382511 3300049587 Bacteria 1073
461 Ga0501072_0115365 3300049588 Bacteria 2139
462 Ga0501072_0115413 3300049588 Bacteria 2138
463 Ga0501072_0289943 3300049588 Bacteria 1301
464 Ga0501072_1107092 3300049588 Bacteria 616
465 Ga0501072_1531061 3300049588 Unclassified 514
466 Ga0501074_0178944 3300049590 Bacteria 1513
467 Ga0501074_0476818 3300049590 Bacteria 884
468 Ga0501074_0862285 3300049590 Bacteria 638
469 Ga0501074_1092053 3300049590 Bacteria 560
470 Ga0501075_0009392 3300049591 Bacteria 6842
471 Ga0501075_0065292 3300049591 Bacteria 2746
472 Ga0501075_0275108 3300049591 Bacteria 1283
473 Ga0501075_0353514 3300049591 Bacteria 1120
474 Ga0501075_0480444 3300049591 Bacteria 948
475 Ga0501076_0111839 3300049592 Bacteria 2208
476 Ga0501076_0621651 3300049592 Bacteria 891
477 Ga0501076_0660828 3300049592 Bacteria 863
478 Ga0501077_0741094 3300049593 Bacteria 632
479 Ga0501079_0061586 3300049741 Bacteria 2895
480 Ga0501079_0400147 3300049741 Bacteria 1077
481 Ga0501081_0341470 3300049743 Bacteria 1103
482 Ga0501081_0367379 3300049743 Bacteria 1062
483 Ga0501081_0398740 3300049743 Bacteria 1018
484 Ga0501081_1153049 3300049743 Bacteria 587
485 Ga0501045_0061312 3300049824 Bacteria 2759
486 Ga0501045_0252710 3300049824 Unclassified 1312
487 Ga0501045_0314229 3300049824 Bacteria 1166
488 nmdc:mga03n38_140808_c1 3300050490 Bacteria 1204
489 nmdc:mga03n38_240000_c1 3300050490 Bacteria 953
490 nmdc:mga03n38_919781_c1 3300050490 Unclassified 515
491 nmdc:mga00v17_15328_c1 3300050491 Bacteria 4302
492 nmdc:mga00v17_36527_c1 3300050491 Bacteria 2928
493 nmdc:mga0yw44_206536_c1 3300050492 Bacteria 1298
494 nmdc:mga0yw44_2428_c2 3300050492 Bacteria 5820
495 nmdc:mga0yw44_3349_c1 3300050492 Bacteria 7102
496 nmdc:mga0yw44_5644_c1 3300050492 Bacteria 5950
497 nmdc:mga04h51_253280_c1 3300050495 Bacteria 706
498 nmdc:mga05p37_590184_c1 3300050507 Bacteria 1256
499 nmdc:mga05p37_853842_c1 3300050507 Bacteria 988
500 nmdc:mga0qj67_273240_c1 3300050509 Bacteria 1370
501 nmdc:mga06r32_9219_c1 3300050510 Bacteria 8897
502 nmdc:mga08y16_1757707_c1 3300050511 Unclassified 574
503 nmdc:mga08y16_58359_c1 3300050511 Bacteria 4032
504 nmdc:mga08y16_9469_c1 3300050511 Bacteria 10222
505 nmdc:mga0n895_3781_c1 3300050512 Bacteria 12256
506 nmdc:mga0n895_906732_c1 3300050512 Bacteria 867
507 nmdc:mga0rr50_13332_c1 3300050513 Bacteria 5348
508 nmdc:mga0a205_72741_c1 3300050515 Bacteria 3321
509 nmdc:mga0a205_98154_c1 3300050515 Bacteria 2828
510 Ga0495601_0000013 3300053077 Bacteria 226476
511 Ga0495601_0256051 3300053077 Bacteria 1143
512 Ga0495601_0277206 3300053077 Bacteria 1093
513 Ga0495612_0088014 3300053078 Bacteria 1311
514 Ga0495655_0000001 3300053083 Bacteria 419518
515 Ga0495619_0000157 3300053085 Bacteria 49848
516 Ga0495619_0000782 3300053085 Bacteria 20846
517 Ga0495619_0003131 3300053085 Bacteria 10732
518 Ga0500566_0185740 3300053094 Bacteria 1062
519 Ga0500628_000033 3300053129 Bacteria 52431
520 Ga0501084_0045121 3300054114 Bacteria 3691
521 Ga0501084_0225936 3300054114 Bacteria 1580
522 Ga0501084_0399577 3300054114 Bacteria 1161
523 Ga0501084_1202984 3300054114 Bacteria 636
524 Ga0501082_0931684 3300060353 Bacteria 760
525 Ga0530510_0041671 3300061734 Bacteria 3315
526 Ga0530510_0060860 3300061734 Bacteria 2733
527 Ga0530510_0204064 3300061734 Bacteria 1469
528 Ga0530510_0470631 3300061734 Bacteria 951
529 Ga0530510_0492166 3300061734 Bacteria 929
530 Ga0075436_101335070
531 CNAas_1011488
532 JGI24743J22301_10096452
533 JGI24751J29686_10026942
534 JGI25404J52841_10021990
535 Ga0070658_10190259
536 Ga0070683_100016350
537 Ga0070683_100071230
538 Ga0070683_100444286
539 Ga0070683_101328676
540 Ga0070690_100133061
541 Ga0070690_101252185
542 Ga0070670_100149841
543 Ga0068869_102146520
544 Ga0070680_100413928
545 Ga0070682_100000150
546 Ga0070682_100073609
547 Ga0068868_100000450
548 Ga0068868_100002756
549 Ga0068868_100729135
550 Ga0068868_101674955
551 Ga0070660_100207563
552 Ga0070689_100747599
553 Ga0070687_100203649
554 Ga0070687_100449919
555 Ga0070661_100000102
556 Ga0070692_10044881
557 Ga0070668_100031876
558 Ga0070668_100203778
559 Ga0070668_100497236
560 Ga0070668_101320920
561 Ga0070669_101232365
562 Ga0070675_100000027
563 Ga0070674_100092136
564 Ga0070674_100857662
565 Ga0070674_101169558
566 Ga0070673_100291921
567 Ga0070673_100812492
568 Ga0070688_100001250
569 Ga0070688_100001531
570 Ga0070688_100323861
571 Ga0070688_100587882
572 Ga0070659_100119409
573 Ga0070659_101071206
574 Ga0070667_100006185
575 Ga0070667_100167082
576 Ga0070714_100090319
577 Ga0070713_100000085
578 Ga0070701_10440854
579 Ga0070701_10468127
580 Ga0070701_10857506
581 Ga0070711_100003742
582 Ga0070705_100502191
583 Ga0070700_100229234
584 Ga0070700_100659437
585 Ga0070694_100672458
586 Ga0070694_100941252
587 Ga0070708_101900548
588 Ga0070663_100824965
589 Ga0070663_101859017
590 Ga0070678_100025174
591 Ga0070678_100096103
592 Ga0070678_100187127
593 Ga0070662_100000004
594 Ga0070662_101357189
595 Ga0070681_10579294
596 Ga0068867_100528839
597 Ga0068867_100892607
598 Ga0070685_10001410
599 Ga0070685_10001719
600 Ga0070685_10128981
601 Ga0070685_11453797
602 Ga0070706_101720280
603 Ga0070707_100644243
604 Ga0070684_100024292
605 Ga0070684_100156085
606 Ga0070684_100430015
607 Ga0068853_100283811
608 Ga0070686_100157757
609 Ga0070695_100320435
610 Ga0070696_100310799
611 Ga0070693_100004573
612 Ga0070665_100039235
613 Ga0070665_100177505
614 Ga0070665_100440390
615 Ga0070704_100118890
616 Ga0070704_102191011
617 Ga0070664_100224234
618 Ga0068857_100055196
619 Ga0068854_100000156
620 Ga0068854_100850248
621 Ga0068856_100008468
622 Ga0068856_100166410
623 Ga0068852_100000006
624 Ga0068852_100173873
625 Ga0068852_100432959
626 Ga0068864_100000053
627 Ga0068866_10104193
628 Ga0068866_10252856
629 Ga0068851_10001568
630 Ga0068851_10277035
631 Ga0068870_10274147
632 Ga0068870_10669180
633 Ga0068863_100013897
634 Ga0068863_101116738
635 Ga0068858_100133034
636 Ga0068858_100848521
637 Ga0068860_100099968
638 Ga0068860_100213711
639 Ga0068862_100000050
640 Ga0068862_101871538
641 Ga0081455_10015768
642 Ga0081455_10126014
643 Ga0081538_10259574
644 Ga0081540_1000163
645 Ga0075365_10000254
646 Ga0075365_10009768
647 Ga0075365_10011771
648 Ga0075365_10209183
649 Ga0075365_10565614
650 Ga0075368_10143636
651 Ga0075368_10308826
652 Ga0075363_100206608
653 Ga0075363_101000489
654 Ga0075364_10048139
655 Ga0075364_10073425
656 Ga0070715_10090788
657 Ga0070712_100128331
658 Ga0075367_10171417
659 Ga0075367_10736944
660 Ga0097621_101384106
661 Ga0068871_100486996
662 Ga0075428_100031418
663 Ga0075430_100280718
664 Ga0075430_100923773
665 Ga0075431_100001567
666 Ga0075431_101320141
667 Ga0075433_10014351
668 Ga0075433_10111759
669 Ga0075434_100001678
670 Ga0075434_100030706
671 Ga0068865_100000023
672 Ga0068865_100059820
673 Ga0075435_100460636
674 Ga0075435_100779849
675 Ga0105240_10517701
676 Ga0105240_11104890
677 Ga0111539_10005066
678 Ga0111539_10300546
679 Ga0111539_12124471
680 Ga0105245_10000254
681 Ga0105245_10011357
682 Ga0105245_10261871
683 Ga0105245_10770683
684 Ga0105245_10787908
685 Ga0114129_10006865
686 Ga0114129_10740223
687 Ga0114129_11577306
688 Ga0105243_10162820
689 Ga0105243_10287503
690 Ga0105243_11951245
691 Ga0105241_10052214
692 Ga0105242_10000032
693 Ga0105242_11802106
694 Ga0105248_10000008
695 Ga0105248_10359559
696 Ga0105238_11268020
697 Ga0105249_10118734
698 Ga0105249_10140910
699 Ga0105249_11329598
700 Ga0105249_11635343
701 Ga0105239_10268371
702 Ga0105239_10610284
703 Ga0105239_10729858
704 Ga0105239_13428268
705 Ga0157342_1016405
706 Ga0157371_10004749
707 Ga0157370_10023676
708 Ga0157370_10141010
709 Ga0157369_10000020
710 Ga0157369_11623048
711 Ga0157374_10308513
712 Ga0157374_10727882
713 Ga0157378_10005986
714 Ga0157378_10030467
715 Ga0157378_10238950
716 Ga0157378_10749058
717 Ga0157378_12450227
718 Ga0163162_10150512
719 Ga0163162_10672328
720 Ga0157372_10000112
721 Ga0157372_10515980
722 Ga0157375_10101600
723 Ga0157375_10706131
724 Ga0163163_11307028
725 Ga0163163_11956392
726 Ga0157380_10000091
727 Ga0157380_10477609
728 Ga0157377_11493300
729 Ga0157379_10031097
730 Ga0157379_10068023
731 Ga0157379_10581618
732 Ga0157376_12911503
733 Ga0206356_10199296
734 Ga0224712_10038893
735 Ga0207656_10000385
736 Ga0207656_10187978
737 Ga0207642_10078160
738 Ga0207688_10144741
739 Ga0207688_10275190
740 Ga0207685_10212719
741 Ga0207645_10525397
742 Ga0207643_10186047
743 Ga0207705_10167133
744 Ga0207654_10271036
745 Ga0207695_10353802
746 Ga0207695_10515603
747 Ga0207693_10028297
748 Ga0207693_10048890
749 Ga0207663_10002370
750 Ga0207662_10128755
751 Ga0207649_10000009
752 Ga0207649_10350271
753 Ga0207681_11318969
754 Ga0207650_10130173
755 Ga0207659_10000010
756 Ga0207687_10000007
757 Ga0207687_10052479
758 Ga0207687_10082407
759 Ga0207687_10694306
760 Ga0207700_10000027
761 Ga0207664_10100280
762 Ga0207690_10076663
763 Ga0207690_10141963
764 Ga0207706_10000012
765 Ga0207706_11432935
766 Ga0207686_10000048
767 Ga0207709_10093921
768 Ga0207709_10404037
769 Ga0207670_10996910
770 Ga0207669_10209009
771 Ga0207704_10000159
772 Ga0207704_10130732
773 Ga0207711_10000006
774 Ga0207661_10000253
775 Ga0207661_10007822
776 Ga0207661_10148671
777 Ga0207679_10293740
778 Ga0207651_10550904
779 Ga0207712_10096320
780 Ga0207712_10859340
781 Ga0207668_10019945
782 Ga0207668_10027927
783 Ga0207668_10045033
784 Ga0207668_10409174
785 Ga0207668_10460501
786 Ga0207640_10000038
787 Ga0207640_10404440
788 Ga0207658_10013822
789 Ga0207677_10000200
790 Ga0207677_10001552
791 Ga0207677_10039577
792 Ga0207677_10972498
793 Ga0207677_11461843
794 Ga0207703_11322304
795 Ga0207639_10230174
796 Ga0207678_10334328
797 Ga0207708_10047844
798 Ga0207708_10193019
799 Ga0207708_12002187
800 Ga0207702_10000158
801 Ga0207641_10005198
802 Ga0207641_10703844
803 Ga0207648_10006385
804 Ga0207648_10801368
805 Ga0207648_11083934
806 Ga0207676_10000195
807 Ga0207674_10107055
808 Ga0207683_10011741
809 Ga0207683_10334641
810 Ga0207698_10000013
811 Ga0207698_10068043
812 Ga0207698_10526067
813 Ga0207698_10643432
814 Ga0209813_10106604
815 Ga0207428_10053592
816 Ga0268266_10009710
817 Ga0268266_10113867
818 Ga0268266_10626190
819 Ga0268265_10001136
820 Ga0268265_10726034
821 Ga0268264_10238155
822 Ga0268264_11502190
823 Ga0268264_12015981
824 Ga0265337_1000807
825 Ga0265326_10000252
826 Ga0265319_1044415
827 Ga0265334_10116393
828 Ga0265334_10283867
829 Ga0265322_10000001
830 Ga0265336_10004887
831 Ga0265338_10284399
832 Ga0265324_10000498
833 Ga0265332_10017744
834 Ga0265328_10001094
835 Ga0265320_10000002
836 Ga0265329_10010170
837 Ga0265339_10033137
838 Ga0265331_10008961
839 Ga0265327_10000011
840 Ga0307408_100304669
841 Ga0265314_10000062
842 Ga0307415_100001241
843 Ga0373943_0224989
844 Ga0373961_0280663
845 Ga0316574_0035851
846 Ga0373947_0862950
847 Ga0395899_0019253
848 Ga0395899_0969220
849 Ga0395900_0240995
850 Ga0395900_0325411
851 Ga0395898_0001408
852 Ga0395898_0178368
853 Ga0395898_0759438
854 Ga0395898_1093279
855 Ga0395905_0013982
856 Ga0395905_0149279
857 Ga0395901_0004783
858 Ga0395901_0200958
859 Ga0395901_1530705
860 Ga0242420_039261
861 Ga0451804_0586164
862 Ga0451807_2276071
863 Ga0451837_1359903
864 Ga0451855_0011574
865 Ga0451853_2385083
866 Ga0466963_0006674
867 Ga0466964_0249778
868 Ga0466957_0029121
869 Ga0466957_0287140
870 Ga0466958_0113749
871 Ga0466967_0000009
872 Ga0466967_0046799
873 Ga0495592_0392807
874 Ga0495603_0000016
875 Ga0495603_0117873
876 Ga0495590_0250346
877 Ga0495629_0001726
878 Ga0495629_0071888
879 Ga0495629_0505314
880 Ga0495629_1028965
881 Ga0495641_0007825
882 Ga0495641_0143819
883 Ga0495582_0162122
884 Ga0495662_0004365
885 Ga0495607_0214274
886 Ga0495606_0000072
887 Ga0495610_0104506
888 Ga0495628_0210425
889 Ga0495630_0000020
890 Ga0495630_0137874
891 Ga0495644_0003786
892 Ga0495644_0020961
893 Ga0495666_0346009
894 Ga0495640_0704543
895 Ga0495587_0758295
896 Ga0495598_0056702
897 Ga0495667_0410266
898 Ga0495625_0568084
899 Ga0495635_0100682
900 Ga0495635_0188788
901 Ga0495661_0278575
902 Ga0495588_0000134
903 Ga0495647_0000156
904 Ga0495647_0032967
905 Ga0495658_0150163
906 Ga0495613_0000801
907 Ga0495624_0000647
908 Ga0495624_0118680
909 Ga0495624_0404917
910 Ga0495581_0041693
911 Ga0495672_0054930
912 Ga0495672_0438509
913 Ga0495676_0034423
914 Ga0495676_0210851
915 Ga0495676_0255640
916 Ga0495676_0373998
917 Ga0495680_0004286
918 Ga0495680_0087866
919 Ga0495680_0162728
920 Ga0495593_0446320
921 Ga0495614_0348313
922 Ga0496100_0003241
923 Ga0496101_0045653
924 Ga0496102_0000115
925 Ga0496102_0033079
926 Ga0496102_0436598
927 Ga0496102_0553888
928 Ga0496102_1042455
929 Ga0496103_0000008
930 Ga0496103_0005173
931 Ga0496103_0196322
932 Ga0496104_0000004
933 Ga0496104_0380101
934 Ga0496104_1377168
935 Ga0496105_0000001
936 Ga0496105_0199680
937 Ga0496106_0006555
938 Ga0496106_0192776
939 Ga0496107_0018938
940 Ga0496107_0039557
941 Ga0496107_0268895
942 Ga0496108_0000175
943 Ga0496108_0174293
944 Ga0496108_0404344
945 Ga0496109_0000121
946 Ga0496109_0000249
947 Ga0496109_0111597
948 Ga0496109_0826775
949 Ga0496110_0001510
950 Ga0496110_0021318
951 Ga0496110_0270238
952 Ga0496110_0833920
953 Ga0496111_0000009
954 Ga0496111_0017476
955 Ga0496111_0229400
956 Ga0496112_0003135
957 Ga0496113_0023007
958 Ga0496113_0124627
959 Ga0496114_0013450
960 Ga0496114_0620830
961 Ga0496114_1310020
962 Ga0496115_0012444
963 Ga0496115_0077192
964 Ga0496119_0005911
965 Ga0496120_0141614
966 Ga0501031_0197227
967 Ga0501031_0918858
968 Ga0501033_0226434
969 Ga0501036_0140288
970 Ga0501038_0355219
971 Ga0501039_0231756
972 Ga0501040_1128466
973 Ga0501041_0153342
974 Ga0501041_0649779
975 Ga0501042_0180552
976 Ga0501042_0607065
977 Ga0501042_0968291
978 Ga0501046_0794413
979 Ga0501048_0113075
980 Ga0501048_0406323
981 Ga0501048_0552602
982 Ga0501048_0700740
983 Ga0501068_0245467
984 Ga0501068_0736809
985 Ga0501070_0397013
986 Ga0501070_1306118
987 Ga0501071_0106318
988 Ga0501071_0140618
989 Ga0501071_0382511
990 Ga0501072_0115365
991 Ga0501072_0115413
992 Ga0501072_0289943
993 Ga0501072_1107092
994 Ga0501072_1531061
995 Ga0501074_0178944
996 Ga0501074_0476818
997 Ga0501074_0862285
998 Ga0501074_1092053
999 Ga0501075_0009392
1000 Ga0501075_0065292
1001 Ga0501075_0275108
1002 Ga0501075_0353514
1003 Ga0501075_0480444
1004 Ga0501076_0111839
1005 Ga0501076_0621651
1006 Ga0501076_0660828
1007 Ga0501077_0741094
1008 Ga0501079_0061586
1009 Ga0501079_0400147
1010 Ga0501081_0341470
1011 Ga0501081_0367379
1012 Ga0501081_0398740
1013 Ga0501081_1153049
1014 Ga0501045_0061312
1015 Ga0501045_0252710
1016 Ga0501045_0314229
1017 nmdc:mga03n38_140808_c1
1018 nmdc:mga03n38_240000_c1
1019 nmdc:mga03n38_919781_c1
1020 nmdc:mga00v17_15328_c1
1021 nmdc:mga00v17_36527_c1
1022 nmdc:mga0yw44_206536_c1
1023 nmdc:mga0yw44_2428_c2
1024 nmdc:mga0yw44_3349_c1
1025 nmdc:mga0yw44_5644_c1
1026 nmdc:mga04h51_253280_c1
1027 nmdc:mga05p37_590184_c1
1028 nmdc:mga05p37_853842_c1
1029 nmdc:mga0qj67_273240_c1
1030 nmdc:mga06r32_9219_c1
1031 nmdc:mga08y16_1757707_c1
1032 nmdc:mga08y16_58359_c1
1033 nmdc:mga08y16_9469_c1
1034 nmdc:mga0n895_3781_c1
1035 nmdc:mga0n895_906732_c1
1036 nmdc:mga0rr50_13332_c1
1037 nmdc:mga0a205_72741_c1
1038 nmdc:mga0a205_98154_c1
1039 Ga0495601_0000013
1040 Ga0495601_0256051
1041 Ga0495601_0277206
1042 Ga0495612_0088014
1043 Ga0495655_0000001
1044 Ga0495619_0000157
1045 Ga0495619_0000782
1046 Ga0495619_0003131
1047 Ga0500566_0185740
1048 Ga0500628_000033
1049 Ga0501084_0045121
1050 Ga0501084_0225936
1051 Ga0501084_0399577
1052 Ga0501084_1202984
1053 Ga0501082_0931684
1054 Ga0530510_0041671
1055 Ga0530510_0060860
1056 Ga0530510_0204064
1057 Ga0530510_0470631
1058 Ga0530510_0492166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9291 2 94
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9187 3 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9037 1 91
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.9036 2 90
3qmq-assembly2.cif.gz_B crystal structure of e. coli lsrg 0.8983 1 96
ID Description Score Start End Superfamily
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8983 1 96 3.30.70.100
2omoE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8956 4 95 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8883 2 91 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8858 2 91 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8821 2 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A838V4U8-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9956 1 97
AF-A0A7V9S2F7-F1-model_v4 ABM domain-containing protein 0.9762 3 97
AF-A0A7W0RCL5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9701 3 97
AF-A0A6J7CXM4-F1-model_v4 Unannotated protein 0.9504 1 97
AF-A0A7W1NI50-F1-model_v4 deleted 0.9481 1 68

Map