F459797

General Info

Members Datasets Scaffolds Average Seq Length
529 247 1058 147

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10014149|Ga0105251_100141496
Length 174
Sequence VSWKRSGDLEHRCKDGGVLMAMSGPPSSRRGRHRAPMADINVTPLVDVMLVLLIIFMVTAPLLVTGVPVNLPETRAKGLDQDQKPTVVSIDRDGGVFIDDAQISDAELPGRLAEIMSANAGKADPPQIFLRADKGLDYGRVMLVMGELNRAGLNKVALVSTGTEQGSAVSSGSE

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
134 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
135 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
192 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
198 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
199 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
200 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
203 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
204 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
207 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
208 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
209 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
212 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
215 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
216 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
217 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
235 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
238 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
239 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
240 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
241 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
242 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
243 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
244 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
245 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
246 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
247 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 0
Isolates 1.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 7.37
Nodule 0.19
Rhizoplane 2.46
Rhizosphere 83.93
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10014149 3300009011 Bacteria 4426
2 JGI24752J21851_1010400 3300001976 Bacteria 1214
3 JGI24740J21852_10131538 3300001979 Bacteria 624
4 JGI24739J22299_10001913 3300001989 Bacteria 7966
5 JGI24739J22299_10052324 3300001989 Bacteria 1314
6 JGI24737J22298_10039902 3300001990 Bacteria 1442
7 JGI24737J22298_10100943 3300001990 Bacteria 855
8 JGI24735J21928_10002676 3300002067 Bacteria 6157
9 JGI24735J21928_10040869 3300002067 Bacteria 1353
10 JGI24738J21930_10001021 3300002075 Bacteria 7993
11 JGI24034J26672_10024749 3300002239 Bacteria 958
12 JGI24034J26672_10099075 3300002239 Bacteria 548
13 JGI24751J29686_10028971 3300002459 Bacteria 1150
14 Ga0055537_1001791 3300003773 Bacteria 7833
15 Ga0055524_1000118 3300003775 Bacteria 93202
16 Ga0055530_10017528 3300003791 Bacteria 2242
17 Ga0055531_10000073 3300003794 Bacteria 109510
18 Ga0055531_10008805 3300003794 Bacteria 5257
19 Ga0055543_1033865 3300004625 Bacteria 882
20 Ga0065165_1030331 3300005262 Bacteria 1721
21 Ga0065165_1074914 3300005262 Bacteria 891
22 Ga0065704_10244845 3300005289 Bacteria 1005
23 Ga0065715_10115198 3300005293 Bacteria 2423
24 Ga0065715_10546941 3300005293 Bacteria 744
25 Ga0065707_10044766 3300005295 Bacteria 869
26 Ga0065707_10081805 3300005295 Bacteria 38502
27 Ga0070658_10019979 3300005327 Bacteria 5364
28 Ga0070683_100234171 3300005329 Bacteria 1746
29 Ga0070670_100000030 3300005331 Bacteria 164211
30 Ga0070670_100004155 3300005331 Bacteria 12108
31 Ga0070670_100036936 3300005331 Bacteria 4203
32 Ga0070670_100091031 3300005331 Bacteria 2622
33 Ga0070666_10000171 3300005335 Bacteria 44565
34 Ga0070680_100000487 3300005336 Bacteria 27255
35 Ga0070680_100107653 3300005336 Bacteria 2319
36 Ga0070660_100044177 3300005339 Bacteria 3407
37 Ga0070661_100000113 3300005344 Bacteria 67566
38 Ga0070661_100313629 3300005344 Bacteria 1223
39 Ga0070668_100000021 3300005347 Bacteria 96397
40 Ga0070668_100010996 3300005347 Bacteria 6737
41 Ga0070668_100064809 3300005347 Bacteria 2833
42 Ga0070668_100079005 3300005347 Bacteria 2575
43 Ga0070668_100087160 3300005347 Bacteria 2456
44 Ga0070668_100698168 3300005347 Bacteria 895
45 Ga0070669_100000001 3300005353 Bacteria 537589
46 Ga0070669_100012326 3300005353 Bacteria 6064
47 Ga0070669_100040711 3300005353 Bacteria 3378
48 Ga0070669_100121793 3300005353 Bacteria 1991
49 Ga0070669_100429053 3300005353 Bacteria 1086
50 Ga0070669_100463785 3300005353 Bacteria 1046
51 Ga0070671_100000007 3300005355 Bacteria 250397
52 Ga0070671_100000114 3300005355 Bacteria 51983
53 Ga0070671_100020058 3300005355 Bacteria 5447
54 Ga0070671_100062130 3300005355 Bacteria 3111
55 Ga0070671_100067370 3300005355 Bacteria 2985
56 Ga0070671_100232893 3300005355 Bacteria 1563
57 Ga0070671_100487221 3300005355 Bacteria 1060
58 Ga0070673_101260357 3300005364 Bacteria 694
59 Ga0070659_100036312 3300005366 Bacteria 3841
60 Ga0070667_100001586 3300005367 Bacteria 20353
61 Ga0070667_100075842 3300005367 Bacteria 2871
62 Ga0070667_101023944 3300005367 Bacteria 771
63 Ga0070663_100005719 3300005455 Bacteria 7413
64 Ga0070663_101270522 3300005455 Bacteria 649
65 Ga0070681_10216562 3300005458 Bacteria 1831
66 Ga0068867_100202170 3300005459 Bacteria 1591
67 Ga0070685_10057007 3300005466 Bacteria 2273
68 Ga0070707_101022641 3300005468 Bacteria 792
69 Ga0070679_100051356 3300005530 Bacteria 4107
70 Ga0068853_100005064 3300005539 Bacteria 10281
71 Ga0068853_100051458 3300005539 Bacteria 3545
72 Ga0070665_100026918 3300005548 Bacteria 5792
73 Ga0070665_100064570 3300005548 Bacteria 3671
74 Ga0070665_100169873 3300005548 Bacteria 2182
75 Ga0070665_100371492 3300005548 Bacteria 1437
76 Ga0068855_100009733 3300005563 Bacteria 11595
77 Ga0068855_101084729 3300005563 Bacteria 838
78 Ga0068857_100010280 3300005577 Bacteria 8132
79 Ga0068857_101107390 3300005577 Bacteria 765
80 Ga0068854_100046585 3300005578 Bacteria 3087
81 Ga0068854_100102525 3300005578 Bacteria 2147
82 Ga0068854_100214226 3300005578 Bacteria 1521
83 Ga0068854_100336585 3300005578 Bacteria 1231
84 Ga0068854_101019087 3300005578 Bacteria 734
85 Ga0068856_101684453 3300005614 Bacteria 647
86 Ga0068856_102241729 3300005614 Bacteria 555
87 Ga0068852_100250008 3300005616 Bacteria 1698
88 Ga0068852_100303983 3300005616 Bacteria 1545
89 Ga0068852_102066655 3300005616 Bacteria 592
90 Ga0068859_100000787 3300005617 Bacteria 32070
91 Ga0068859_100010809 3300005617 Bacteria 9190
92 Ga0068859_100041916 3300005617 Bacteria 4598
93 Ga0068859_100804469 3300005617 Bacteria 1027
94 Ga0068864_100000041 3300005618 Bacteria 165878
95 Ga0068864_100000809 3300005618 Bacteria 26301
96 Ga0068864_100576393 3300005618 Bacteria 1090
97 Ga0068864_101114098 3300005618 Bacteria 786
98 Ga0068861_100000094 3300005719 Bacteria 43101
99 Ga0068861_100002527 3300005719 Bacteria 11948
100 Ga0068861_100403221 3300005719 Bacteria 1214
101 Ga0068851_10018450 3300005834 Bacteria 3360
102 Ga0068851_10022324 3300005834 Bacteria 3081
103 Ga0068851_10088195 3300005834 Bacteria 1630
104 Ga0068863_100000035 3300005841 Bacteria 165877
105 Ga0068863_100000043 3300005841 Bacteria 153935
106 Ga0068863_100008510 3300005841 Bacteria 10020
107 Ga0068860_100018882 3300005843 Bacteria 6699
108 Ga0068862_100000042 3300005844 Bacteria 165084
109 Ga0068862_100000468 3300005844 Bacteria 43578
110 Ga0068862_100135638 3300005844 Bacteria 2181
111 Ga0068862_100187415 3300005844 Bacteria 1860
112 Ga0068862_100319331 3300005844 Bacteria 1433
113 Ga0068862_100405747 3300005844 Bacteria 1276
114 Ga0068862_101309562 3300005844 Bacteria 726
115 Ga0081539_10013701 3300005985 Bacteria 6089
116 Ga0075363_100002692 3300006048 Bacteria 7347
117 Ga0075367_10000051 3300006178 Bacteria 27695
118 Ga0097621_100046877 3300006237 Bacteria 3499
119 Ga0068871_100807870 3300006358 Bacteria 865
120 Ga0068871_101018119 3300006358 Bacteria 772
121 Ga0075431_100009771 3300006847 Bacteria 9634
122 Ga0097620_100000787 3300006931 Bacteria 32070
123 Ga0097620_100010809 3300006931 Bacteria 9190
124 Ga0097620_100041917 3300006931 Bacteria 4598
125 Ga0097620_100804447 3300006931 Bacteria 1027
126 Ga0099826_10353641 3300006948 Bacteria 730
127 Ga0105251_10000180 3300009011 Bacteria 63702
128 Ga0105240_10072045 3300009093 Bacteria 4272
129 Ga0105247_10002160 3300009101 Bacteria 13576
130 Ga0105247_10207779 3300009101 Bacteria 1319
131 Ga0105243_10233911 3300009148 Bacteria 1632
132 Ga0105243_10256761 3300009148 Bacteria 1563
133 Ga0105241_10473388 3300009174 Bacteria 1112
134 Ga0105242_10976958 3300009176 Bacteria 853
135 Ga0105248_10000045 3300009177 Bacteria 165909
136 Ga0105248_10000296 3300009177 Bacteria 59123
137 Ga0105248_10108107 3300009177 Bacteria 3136
138 Ga0105248_10246547 3300009177 Bacteria 2011
139 Ga0105248_10479692 3300009177 Bacteria 1402
140 Ga0105237_10024202 3300009545 Bacteria 6213
141 Ga0105238_11751391 3300009551 Bacteria 653
142 Ga0105249_10000055 3300009553 Bacteria 161674
143 Ga0105249_10024855 3300009553 Bacteria 5388
144 Ga0105239_10002689 3300010375 Bacteria 22375
145 Ga0105239_11148465 3300010375 Bacteria 895
146 Ga0163162_10007008 3300013306 Bacteria 10933
147 Ga0163162_10016899 3300013306 Bacteria 7134
148 Ga0163162_10019966 3300013306 Bacteria 6582
149 Ga0157372_11550593 3300013307 Bacteria 763
150 Ga0157375_10002847 3300013308 Bacteria 14973
151 Ga0163163_10608265 3300014325 Bacteria 1156
152 Ga0157380_10000606 3300014326 Bacteria 22069
153 Ga0157380_10932029 3300014326 Bacteria 897
154 Ga0157379_10027204 3300014968 Bacteria 5092
155 Ga0157379_10028314 3300014968 Bacteria 4986
156 Ga0157379_10228446 3300014968 Bacteria 1687
157 Ga0163161_10014669 3300017792 Bacteria 5456
158 Ga0163161_10020336 3300017792 Bacteria 4658
159 Ga0163161_10179163 3300017792 Bacteria 1624
160 Ga0213874_10270176 3300021377 Bacteria 632
161 Ga0209565_1000011 3300025263 Bacteria 637062
162 Ga0209673_1003868 3300025273 Bacteria 8450
163 Ga0207673_1003309 3300025290 Bacteria 1878
164 Ga0209758_1008619 3300025297 Bacteria 6550
165 Ga0209050_1000209 3300025298 Bacteria 130884
166 Ga0209050_1006138 3300025298 Bacteria 7240
167 Ga0209256_1000016 3300025299 Bacteria 599092
168 Ga0209257_1000027 3300025304 Bacteria 703541
169 Ga0209257_1006974 3300025304 Bacteria 7035
170 Ga0207697_10000442 3300025315 Bacteria 23401
171 Ga0207656_10009065 3300025321 Bacteria 3687
172 Ga0207713_1001001 3300025735 Bacteria 24726
173 Ga0207713_1014992 3300025735 Bacteria 3996
174 Ga0207710_10005275 3300025900 Bacteria 5584
175 Ga0207710_10209148 3300025900 Bacteria 965
176 Ga0207680_10001461 3300025903 Bacteria 11187
177 Ga0207647_10342559 3300025904 Bacteria 847
178 Ga0207705_10376076 3300025909 Bacteria 1097
179 Ga0207654_10163870 3300025911 Bacteria 1438
180 Ga0207707_10327945 3300025912 Bacteria 1321
181 Ga0207695_10017242 3300025913 Bacteria 8411
182 Ga0207695_10202888 3300025913 Bacteria 1896
183 Ga0207671_10001440 3300025914 Bacteria 27565
184 Ga0207657_10054497 3300025919 Bacteria 3458
185 Ga0207657_10331742 3300025919 Bacteria 1201
186 Ga0207649_10000089 3300025920 Bacteria 76923
187 Ga0207652_10115191 3300025921 Bacteria 2388
188 Ga0207646_10931621 3300025922 Bacteria 770
189 Ga0207681_10000002 3300025923 Bacteria 985597
190 Ga0207681_10268125 3300025923 Bacteria 1339
191 Ga0207681_10408175 3300025923 Bacteria 1098
192 Ga0207694_10549781 3300025924 Bacteria 969
193 Ga0207694_11111459 3300025924 Bacteria 669
194 Ga0207650_10000238 3300025925 Bacteria 61061
195 Ga0207650_10015111 3300025925 Bacteria 5371
196 Ga0207650_10036067 3300025925 Bacteria 3596
197 Ga0207650_10197717 3300025925 Bacteria 1609
198 Ga0207659_10798266 3300025926 Bacteria 811
199 Ga0207644_10000002 3300025931 Bacteria 942221
200 Ga0207644_10000077 3300025931 Bacteria 72394
201 Ga0207644_10532757 3300025931 Bacteria 971
202 Ga0207644_10666886 3300025931 Bacteria 866
203 Ga0207644_10669787 3300025931 Bacteria 864
204 Ga0207686_10511013 3300025934 Bacteria 934
205 Ga0207709_10224778 3300025935 Bacteria 1356
206 Ga0207691_10125090 3300025940 Bacteria 2276
207 Ga0207691_10883584 3300025940 Bacteria 749
208 Ga0207711_10000027 3300025941 Bacteria 236548
209 Ga0207711_10000251 3300025941 Bacteria 57860
210 Ga0207711_10122361 3300025941 Bacteria 2324
211 Ga0207711_10264875 3300025941 Bacteria 1580
212 Ga0207711_10278727 3300025941 Bacteria 1539
213 Ga0207661_10410439 3300025944 Bacteria 1229
214 Ga0207661_10642839 3300025944 Bacteria 975
215 Ga0207667_10031117 3300025949 Bacteria 5764
216 Ga0207667_10048527 3300025949 Bacteria 4489
217 Ga0207651_10986718 3300025960 Bacteria 752
218 Ga0207712_10000262 3300025961 Bacteria 51101
219 Ga0207712_10039787 3300025961 Bacteria 3223
220 Ga0207712_10092327 3300025961 Bacteria 2232
221 Ga0207712_10429354 3300025961 Bacteria 1116
222 Ga0207668_10000068 3300025972 Bacteria 81202
223 Ga0207668_10001858 3300025972 Bacteria 12320
224 Ga0207668_10003466 3300025972 Bacteria 9257
225 Ga0207668_10077524 3300025972 Bacteria 2396
226 Ga0207640_10040236 3300025981 Bacteria 2964
227 Ga0207640_10194062 3300025981 Bacteria 1533
228 Ga0207640_10247385 3300025981 Bacteria 1382
229 Ga0207658_10000362 3300025986 Bacteria 44869
230 Ga0207658_10024359 3300025986 Bacteria 4234
231 Ga0207658_10435562 3300025986 Bacteria 1158
232 Ga0207703_10040742 3300026035 Bacteria 3719
233 Ga0207639_10014011 3300026041 Bacteria 5626
234 Ga0207639_11208503 3300026041 Bacteria 709
235 Ga0207678_10000068 3300026067 Bacteria 81610
236 Ga0207702_11476383 3300026078 Bacteria 673
237 Ga0207702_11846804 3300026078 Bacteria 596
238 Ga0207641_10000031 3300026088 Bacteria 224320
239 Ga0207641_10000041 3300026088 Bacteria 191595
240 Ga0207641_10048450 3300026088 Bacteria 3586
241 Ga0207648_10682826 3300026089 Bacteria 951
242 Ga0207676_10000039 3300026095 Bacteria 171142
243 Ga0207676_10000383 3300026095 Bacteria 37759
244 Ga0207676_10123464 3300026095 Bacteria 2188
245 Ga0207676_10944673 3300026095 Bacteria 847
246 Ga0207674_10000811 3300026116 Bacteria 40585
247 Ga0207675_100000041 3300026118 Bacteria 90476
248 Ga0207675_100005628 3300026118 Bacteria 11998
249 Ga0207675_100312728 3300026118 Bacteria 1532
250 Ga0207698_10258887 3300026142 Bacteria 1597
251 Ga0207698_10688419 3300026142 Bacteria 1016
252 Ga0209970_1100606 3300027614 Bacteria 552
253 Ga0209813_10000172 3300027866 Bacteria 21011
254 Ga0209974_10008028 3300027876 Bacteria 3617
255 Ga0268266_10019585 3300028379 Bacteria 5765
256 Ga0268266_11132404 3300028379 Bacteria 757
257 Ga0268265_10000061 3300028380 Bacteria 148625
258 Ga0268265_10001875 3300028380 Bacteria 16712
259 Ga0268265_10058781 3300028380 Bacteria 2938
260 Ga0268265_10078398 3300028380 Bacteria 2598
261 Ga0268265_10099240 3300028380 Bacteria 2347
262 Ga0268265_10128782 3300028380 Bacteria 2099
263 Ga0268265_10546329 3300028380 Bacteria 1099
264 Ga0268265_12490559 3300028380 Bacteria 523
265 Ga0268264_10000071 3300028381 Bacteria 267236
266 Ga0268264_10016671 3300028381 Bacteria 6017
267 Ga0307517_10014909 3300028786 Bacteria 10383
268 Ga0316177_1010467 3300030731 Bacteria 1164
269 Ga0316178_1151566 3300030735 Bacteria 2421
270 Ga0316180_1187281 3300030736 Bacteria 2314
271 Ga0316183_1180393 3300030742 Bacteria 927
272 Ga0316182_1153558 3300030745 Bacteria 966
273 Ga0265327_10055612 3300031251 Bacteria 2043
274 Ga0307513_10632148 3300031456 Bacteria 778
275 Ga0307408_100011557 3300031548 Bacteria 5834
276 Ga0307408_100051480 3300031548 Bacteria 2966
277 Ga0307408_100117628 3300031548 Bacteria 2053
278 Ga0307408_100265169 3300031548 Bacteria 1423
279 Ga0307408_100335925 3300031548 Bacteria 1277
280 Ga0307408_100396029 3300031548 Bacteria 1185
281 Ga0307408_101078937 3300031548 Bacteria 744
282 Ga0307408_101238090 3300031548 Bacteria 697
283 Ga0307408_101975026 3300031548 Bacteria 560
284 Ga0307405_10023829 3300031731 Bacteria 3485
285 Ga0307405_10039398 3300031731 Bacteria 2855
286 Ga0307405_10067552 3300031731 Bacteria 2285
287 Ga0307405_10114949 3300031731 Bacteria 1830
288 Ga0307405_10131803 3300031731 Bacteria 1728
289 Ga0307405_10219714 3300031731 Bacteria 1393
290 Ga0307405_10243906 3300031731 Bacteria 1333
291 Ga0307405_10298729 3300031731 Bacteria 1220
292 Ga0307405_10619945 3300031731 Bacteria 885
293 Ga0307405_11323257 3300031731 Bacteria 627
294 Ga0307405_11559296 3300031731 Bacteria 582
295 Ga0307413_10009505 3300031824 Bacteria 4658
296 Ga0307413_10013310 3300031824 Bacteria 4130
297 Ga0307413_10060608 3300031824 Bacteria 2330
298 Ga0307413_10062284 3300031824 Bacteria 2306
299 Ga0307413_10238653 3300031824 Bacteria 1340
300 Ga0307413_10295783 3300031824 Bacteria 1225
301 Ga0307413_10314509 3300031824 Bacteria 1193
302 Ga0307413_10344969 3300031824 Bacteria 1147
303 Ga0307413_10784987 3300031824 Bacteria 799
304 Ga0307413_11350426 3300031824 Bacteria 625
305 Ga0307413_11437520 3300031824 Bacteria 608
306 Ga0307410_10025503 3300031852 Bacteria 3710
307 Ga0307410_10129911 3300031852 Bacteria 1849
308 Ga0307410_10231238 3300031852 Bacteria 1428
309 Ga0307410_10247483 3300031852 Bacteria 1384
310 Ga0307410_10270282 3300031852 Bacteria 1329
311 Ga0307410_10394589 3300031852 Bacteria 1116
312 Ga0307410_10475997 3300031852 Bacteria 1023
313 Ga0307410_10485635 3300031852 Bacteria 1014
314 Ga0307410_11226445 3300031852 Bacteria 654
315 Ga0307406_10006284 3300031901 Bacteria 6547
316 Ga0307406_10036022 3300031901 Bacteria 3046
317 Ga0307406_10061761 3300031901 Bacteria 2421
318 Ga0307406_10132577 3300031901 Bacteria 1751
319 Ga0307406_10181581 3300031901 Bacteria 1532
320 Ga0307406_10311608 3300031901 Bacteria 1213
321 Ga0307406_10397440 3300031901 Bacteria 1091
322 Ga0307406_10441583 3300031901 Bacteria 1041
323 Ga0307406_10543634 3300031901 Bacteria 949
324 Ga0307406_10652952 3300031901 Bacteria 873
325 Ga0307406_11326436 3300031901 Bacteria 629
326 Ga0307407_10003784 3300031903 Bacteria 6294
327 Ga0307407_10024854 3300031903 Bacteria 3148
328 Ga0307407_10111121 3300031903 Bacteria 1720
329 Ga0307407_10118948 3300031903 Bacteria 1671
330 Ga0307407_10194740 3300031903 Bacteria 1354
331 Ga0307407_10278637 3300031903 Bacteria 1157
332 Ga0307407_10781101 3300031903 Bacteria 725
333 Ga0307412_10001563 3300031911 Bacteria 12598
334 Ga0307412_10046826 3300031911 Bacteria 2836
335 Ga0307412_10059289 3300031911 Bacteria 2564
336 Ga0307412_10084975 3300031911 Bacteria 2198
337 Ga0307412_10134960 3300031911 Bacteria 1799
338 Ga0307412_10163373 3300031911 Bacteria 1657
339 Ga0307412_10187660 3300031911 Bacteria 1560
340 Ga0307412_10674097 3300031911 Bacteria 885
341 Ga0307412_10700166 3300031911 Bacteria 869
342 Ga0307412_10842715 3300031911 Bacteria 799
343 Ga0307409_100007148 3300031995 Bacteria 6650
344 Ga0307409_100022526 3300031995 Bacteria 4346
345 Ga0307409_100064682 3300031995 Bacteria 2874
346 Ga0307409_100076623 3300031995 Bacteria 2682
347 Ga0307409_100113522 3300031995 Bacteria 2277
348 Ga0307409_100877530 3300031995 Bacteria 909
349 Ga0307409_100950883 3300031995 Bacteria 875
350 Ga0307409_101039404 3300031995 Bacteria 838
351 Ga0307409_101569545 3300031995 Bacteria 686
352 Ga0307409_101696636 3300031995 Bacteria 660
353 Ga0307416_100036866 3300032002 Bacteria 3756
354 Ga0307416_100037872 3300032002 Bacteria 3716
355 Ga0307416_100045139 3300032002 Bacteria 3467
356 Ga0307416_100049966 3300032002 Bacteria 3329
357 Ga0307416_100541482 3300032002 Bacteria 1236
358 Ga0307416_100721329 3300032002 Bacteria 1087
359 Ga0307416_100810385 3300032002 Bacteria 1032
360 Ga0307416_100904890 3300032002 Bacteria 982
361 Ga0307416_100905187 3300032002 Bacteria 982
362 Ga0307416_100997021 3300032002 Bacteria 940
363 Ga0307416_101560537 3300032002 Bacteria 766
364 Ga0307414_10000308 3300032004 Bacteria 28338
365 Ga0307414_10005443 3300032004 Bacteria 7010
366 Ga0307414_10018974 3300032004 Bacteria 4251
367 Ga0307414_10020384 3300032004 Bacteria 4132
368 Ga0307414_10020899 3300032004 Bacteria 4090
369 Ga0307414_10128427 3300032004 Bacteria 1963
370 Ga0307414_10141905 3300032004 Bacteria 1882
371 Ga0307414_10155110 3300032004 Bacteria 1811
372 Ga0307414_10215528 3300032004 Bacteria 1572
373 Ga0307414_10263575 3300032004 Bacteria 1439
374 Ga0307414_10269538 3300032004 Bacteria 1425
375 Ga0307414_10314894 3300032004 Bacteria 1329
376 Ga0307414_10335293 3300032004 Bacteria 1293
377 Ga0307414_10355085 3300032004 Bacteria 1259
378 Ga0307414_10365094 3300032004 Bacteria 1243
379 Ga0307414_10443906 3300032004 Bacteria 1136
380 Ga0307414_10783788 3300032004 Bacteria 868
381 Ga0307414_10895018 3300032004 Bacteria 813
382 Ga0307414_10899357 3300032004 Bacteria 811
383 Ga0307414_10921993 3300032004 Bacteria 801
384 Ga0307414_11471032 3300032004 Bacteria 634
385 Ga0307414_11553035 3300032004 Bacteria 616
386 Ga0307414_12044263 3300032004 Bacteria 535
387 Ga0307411_10000768 3300032005 Bacteria 11868
388 Ga0307411_10012845 3300032005 Bacteria 4591
389 Ga0307411_10040468 3300032005 Bacteria 2957
390 Ga0307411_10050922 3300032005 Bacteria 2699
391 Ga0307411_10122066 3300032005 Bacteria 1887
392 Ga0307411_10134325 3300032005 Bacteria 1813
393 Ga0307411_10245497 3300032005 Bacteria 1404
394 Ga0307411_11421177 3300032005 Bacteria 635
395 Ga0307411_11568581 3300032005 Bacteria 607
396 Ga0307415_100038354 3300032126 Bacteria 3157
397 Ga0307415_100100707 3300032126 Bacteria 2118
398 Ga0307415_100102552 3300032126 Bacteria 2102
399 Ga0307415_100125483 3300032126 Bacteria 1933
400 Ga0307415_100659027 3300032126 Bacteria 939
401 Ga0307415_102073081 3300032126 Bacteria 555
402 Ga0307510_10197820 3300033180 Bacteria 1549
403 Ga0395905_0940862 3300037471 Bacteria 767
404 Ga0436363_0627825 3300039450 Bacteria 609
405 Ga0439465_0127568 3300041413 Bacteria 896
406 Ga0451802_1555010 3300041460 Bacteria 614
407 Ga0451853_2068090 3300041512 Bacteria 770
408 Ga0439446_0154201 3300042156 Bacteria 757
409 Ga0439464_0006676 3300042439 Bacteria 3011
410 Ga0466970_0785228 3300044765 Bacteria 557
411 Ga0466960_0294412 3300044901 Bacteria 913
412 Ga0495627_087003 3300046453 Bacteria 901
413 Ga0495590_0364812 3300046457 Bacteria 550
414 Ga0495638_0039054 3300046460 Bacteria 3015
415 Ga0495638_0220978 3300046460 Bacteria 1059
416 Ga0495650_0138866 3300046471 Bacteria 881
417 Ga0495650_0247932 3300046471 Bacteria 606
418 Ga0495616_0000007 3300046513 Bacteria 227689
419 Ga0495642_0134181 3300046528 Bacteria 1067
420 Ga0495621_0005871 3300046539 Bacteria 3554
421 Ga0495621_0355868 3300046539 Bacteria 615
422 Ga0495669_0008391 3300046684 Bacteria 4344
423 Ga0495670_0430653 3300046691 Bacteria 714
424 Ga0495671_0048528 3300046692 Bacteria 2118
425 Ga0495686_0000262 3300047472 Bacteria 94462
426 Ga0495686_0000834 3300047472 Bacteria 39641
427 Ga0495686_0458241 3300047472 Bacteria 676
428 Ga0496101_0199974 3300048904 Bacteria 1544
429 Ga0496102_1006514 3300048905 Bacteria 754
430 Ga0496103_0026623 3300048906 Bacteria 3501
431 Ga0496103_0158571 3300048906 Bacteria 1451
432 Ga0496107_0081724 3300048910 Bacteria 2357
433 Ga0496108_0157347 3300048911 Bacteria 1962
434 Ga0496108_0380922 3300048911 Bacteria 1232
435 Ga0496109_0276936 3300048912 Bacteria 1581
436 Ga0496109_1087582 3300048912 Bacteria 737
437 Ga0496110_0007823 3300048913 Bacteria 8565
438 Ga0496111_0054410 3300048914 Bacteria 2893
439 Ga0496114_0009716 3300048917 Bacteria 7642
440 Ga0496116_0170115 3300048919 Bacteria 1182
441 Ga0496117_0005718 3300048920 Bacteria 12932
442 Ga0496117_0030629 3300048920 Bacteria 4124
443 Ga0496117_0061445 3300048920 Bacteria 2582
444 Ga0496118_0000493 3300048921 Bacteria 65468
445 Ga0496118_0001107 3300048921 Bacteria 41821
446 Ga0496118_0037508 3300048921 Bacteria 3899
447 Ga0496118_0045558 3300048921 Bacteria 3422
448 Ga0496121_0001342 3300048924 Bacteria 42142
449 Ga0496121_0098057 3300048924 Bacteria 2269
450 Ga0496121_0126319 3300048924 Bacteria 1922
451 Ga0496121_0463062 3300048924 Bacteria 814
452 Ga0496122_0000306 3300048925 Bacteria 108166
453 Ga0496122_0030304 3300048925 Bacteria 4537
454 Ga0496123_0001592 3300048926 Bacteria 30871
455 Ga0496124_0077370 3300048927 Bacteria 2744
456 Ga0496125_0017748 3300048928 Bacteria 6774
457 Ga0496125_0018638 3300048928 Bacteria 6587
458 Ga0496125_0211088 3300048928 Bacteria 1261
459 Ga0496125_0278917 3300048928 Bacteria 1037
460 Ga0496125_0473182 3300048928 Bacteria 712
461 Ga0496126_0111938 3300048929 Bacteria 2377
462 Ga0496126_0161083 3300048929 Bacteria 1917
463 Ga0501292_000022 3300049515 Bacteria 47432
464 Ga0501294_000093 3300049517 Bacteria 9905
465 Ga0501033_0046394 3300049570 Bacteria 3231
466 Ga0501034_0064209 3300049571 Bacteria 3686
467 Ga0501043_0086941 3300049579 Bacteria 2457
468 Ga0501073_0414312 3300049589 Bacteria 931
469 Ga0501198_006741 3300049649 Bacteria 1640
470 Ga0501202_227463 3300049652 Bacteria 518
471 Ga0501206_028555 3300049653 Bacteria 821
472 Ga0501222_000207 3300049662 Bacteria 10398
473 Ga0501223_000599 3300049663 Bacteria 8650
474 Ga0501223_000978 3300049663 Bacteria 6741
475 Ga0501224_000006 3300049664 Bacteria 149611
476 Ga0501224_000109 3300049664 Bacteria 8861
477 Ga0501227_021759 3300049665 Bacteria 1479
478 Ga0501233_000508 3300049668 Bacteria 6253
479 Ga0501233_083091 3300049668 Bacteria 827
480 Ga0501235_002784 3300049669 Bacteria 3764
481 Ga0501235_050002 3300049669 Bacteria 967
482 Ga0501236_043757 3300049670 Bacteria 749
483 Ga0501239_028127 3300049672 Bacteria 725
484 Ga0501259_000841 3300049688 Bacteria 5056
485 Ga0501261_000075 3300049690 Bacteria 17084
486 Ga0501225_0001785 3300049705 Bacteria 6734
487 Ga0501225_0001860 3300049705 Bacteria 6631
488 Ga0501229_076860 3300049706 Bacteria 530
489 Ga0501245_000635 3300049708 Bacteria 4325
490 Ga0501268_009369 3300049765 Bacteria 1504
491 Ga0501279_000012 3300049775 Bacteria 80359
492 Ga0501279_095680 3300049775 Bacteria 529
493 Ga0501280_000005 3300049776 Bacteria 85174
494 Ga0501281_00020 3300049777 Bacteria 19726
495 Ga0501282_000176 3300049778 Bacteria 7822
496 Ga0501044_0025435 3300049823 Bacteria 6274
497 Ga0501226_000355 3300049853 Bacteria 6688
498 nmdc:mga0qj67_824388_c1 3300050509 Bacteria 733
499 nmdc:mga06r32_53054_c1 3300050510 Bacteria 3884
500 Ga0500643_000121 3300053087 Bacteria 81461
501 Ga0500643_002760 3300053087 Bacteria 8790
502 Ga0500643_016369 3300053087 Bacteria 2513
503 Ga0500566_0079841 3300053094 Bacteria 1823
504 Ga0500641_0173514 3300053096 Bacteria 928
505 Ga0500562_081465 3300053108 Bacteria 876
506 Ga0500592_000224 3300053116 Bacteria 10279
507 Ga0500594_0005662 3300053118 Bacteria 2776
508 Ga0500608_133899 3300053122 Bacteria 1108
509 Ga0500658_0296373 3300053134 Bacteria 743
510 Ga0500559_0098159 3300053136 Bacteria 1347
511 Ga0500559_0289904 3300053136 Bacteria 769
512 Ga0500577_0098457 3300053142 Bacteria 1192
513 Ga0500604_0013225 3300053151 Bacteria 2234
514 Ga0500616_0007857 3300053153 Bacteria 6713
515 Ga0500616_0270272 3300053153 Bacteria 718
516 Ga0500624_000254 3300053157 Bacteria 18781
517 Ga0500627_0000272 3300053158 Bacteria 14690
518 Ga0500636_0006645 3300053177 Bacteria 6650
519 Ga0500587_011857 3300053739 Bacteria 1100
520 2778125494 2775507255 Bacteria 3945731
521 2809065332 2808606401 Bacteria 4586670
522 2809081276 2808606404 Bacteria 4652788
523 2809085641 2808606405 Bacteria 4586632
524 2880520824 2880518877 Bacteria 5012590
525 2885427275 2885427238 Bacteria 2291351
526 2885432386 2885429604 Bacteria 3642894
527 2896429262 2896429255 Bacteria 2557483
528 2919711202 2919709256 Bacteria 4318106
529 2984565093 2984564862 Bacteria 4339992
530 Ga0105251_10014149
531 JGI24752J21851_1010400
532 JGI24740J21852_10131538
533 JGI24739J22299_10001913
534 JGI24739J22299_10052324
535 JGI24737J22298_10039902
536 JGI24737J22298_10100943
537 JGI24735J21928_10002676
538 JGI24735J21928_10040869
539 JGI24738J21930_10001021
540 JGI24034J26672_10024749
541 JGI24034J26672_10099075
542 JGI24751J29686_10028971
543 Ga0055537_1001791
544 Ga0055524_1000118
545 Ga0055530_10017528
546 Ga0055531_10000073
547 Ga0055531_10008805
548 Ga0055543_1033865
549 Ga0065165_1030331
550 Ga0065165_1074914
551 Ga0065704_10244845
552 Ga0065715_10115198
553 Ga0065715_10546941
554 Ga0065707_10044766
555 Ga0065707_10081805
556 Ga0070658_10019979
557 Ga0070683_100234171
558 Ga0070670_100000030
559 Ga0070670_100004155
560 Ga0070670_100036936
561 Ga0070670_100091031
562 Ga0070666_10000171
563 Ga0070680_100000487
564 Ga0070680_100107653
565 Ga0070660_100044177
566 Ga0070661_100000113
567 Ga0070661_100313629
568 Ga0070668_100000021
569 Ga0070668_100010996
570 Ga0070668_100064809
571 Ga0070668_100079005
572 Ga0070668_100087160
573 Ga0070668_100698168
574 Ga0070669_100000001
575 Ga0070669_100012326
576 Ga0070669_100040711
577 Ga0070669_100121793
578 Ga0070669_100429053
579 Ga0070669_100463785
580 Ga0070671_100000007
581 Ga0070671_100000114
582 Ga0070671_100020058
583 Ga0070671_100062130
584 Ga0070671_100067370
585 Ga0070671_100232893
586 Ga0070671_100487221
587 Ga0070673_101260357
588 Ga0070659_100036312
589 Ga0070667_100001586
590 Ga0070667_100075842
591 Ga0070667_101023944
592 Ga0070663_100005719
593 Ga0070663_101270522
594 Ga0070681_10216562
595 Ga0068867_100202170
596 Ga0070685_10057007
597 Ga0070707_101022641
598 Ga0070679_100051356
599 Ga0068853_100005064
600 Ga0068853_100051458
601 Ga0070665_100026918
602 Ga0070665_100064570
603 Ga0070665_100169873
604 Ga0070665_100371492
605 Ga0068855_100009733
606 Ga0068855_101084729
607 Ga0068857_100010280
608 Ga0068857_101107390
609 Ga0068854_100046585
610 Ga0068854_100102525
611 Ga0068854_100214226
612 Ga0068854_100336585
613 Ga0068854_101019087
614 Ga0068856_101684453
615 Ga0068856_102241729
616 Ga0068852_100250008
617 Ga0068852_100303983
618 Ga0068852_102066655
619 Ga0068859_100000787
620 Ga0068859_100010809
621 Ga0068859_100041916
622 Ga0068859_100804469
623 Ga0068864_100000041
624 Ga0068864_100000809
625 Ga0068864_100576393
626 Ga0068864_101114098
627 Ga0068861_100000094
628 Ga0068861_100002527
629 Ga0068861_100403221
630 Ga0068851_10018450
631 Ga0068851_10022324
632 Ga0068851_10088195
633 Ga0068863_100000035
634 Ga0068863_100000043
635 Ga0068863_100008510
636 Ga0068860_100018882
637 Ga0068862_100000042
638 Ga0068862_100000468
639 Ga0068862_100135638
640 Ga0068862_100187415
641 Ga0068862_100319331
642 Ga0068862_100405747
643 Ga0068862_101309562
644 Ga0081539_10013701
645 Ga0075363_100002692
646 Ga0075367_10000051
647 Ga0097621_100046877
648 Ga0068871_100807870
649 Ga0068871_101018119
650 Ga0075431_100009771
651 Ga0097620_100000787
652 Ga0097620_100010809
653 Ga0097620_100041917
654 Ga0097620_100804447
655 Ga0099826_10353641
656 Ga0105251_10000180
657 Ga0105240_10072045
658 Ga0105247_10002160
659 Ga0105247_10207779
660 Ga0105243_10233911
661 Ga0105243_10256761
662 Ga0105241_10473388
663 Ga0105242_10976958
664 Ga0105248_10000045
665 Ga0105248_10000296
666 Ga0105248_10108107
667 Ga0105248_10246547
668 Ga0105248_10479692
669 Ga0105237_10024202
670 Ga0105238_11751391
671 Ga0105249_10000055
672 Ga0105249_10024855
673 Ga0105239_10002689
674 Ga0105239_11148465
675 Ga0163162_10007008
676 Ga0163162_10016899
677 Ga0163162_10019966
678 Ga0157372_11550593
679 Ga0157375_10002847
680 Ga0163163_10608265
681 Ga0157380_10000606
682 Ga0157380_10932029
683 Ga0157379_10027204
684 Ga0157379_10028314
685 Ga0157379_10228446
686 Ga0163161_10014669
687 Ga0163161_10020336
688 Ga0163161_10179163
689 Ga0213874_10270176
690 Ga0209565_1000011
691 Ga0209673_1003868
692 Ga0207673_1003309
693 Ga0209758_1008619
694 Ga0209050_1000209
695 Ga0209050_1006138
696 Ga0209256_1000016
697 Ga0209257_1000027
698 Ga0209257_1006974
699 Ga0207697_10000442
700 Ga0207656_10009065
701 Ga0207713_1001001
702 Ga0207713_1014992
703 Ga0207710_10005275
704 Ga0207710_10209148
705 Ga0207680_10001461
706 Ga0207647_10342559
707 Ga0207705_10376076
708 Ga0207654_10163870
709 Ga0207707_10327945
710 Ga0207695_10017242
711 Ga0207695_10202888
712 Ga0207671_10001440
713 Ga0207657_10054497
714 Ga0207657_10331742
715 Ga0207649_10000089
716 Ga0207652_10115191
717 Ga0207646_10931621
718 Ga0207681_10000002
719 Ga0207681_10268125
720 Ga0207681_10408175
721 Ga0207694_10549781
722 Ga0207694_11111459
723 Ga0207650_10000238
724 Ga0207650_10015111
725 Ga0207650_10036067
726 Ga0207650_10197717
727 Ga0207659_10798266
728 Ga0207644_10000002
729 Ga0207644_10000077
730 Ga0207644_10532757
731 Ga0207644_10666886
732 Ga0207644_10669787
733 Ga0207686_10511013
734 Ga0207709_10224778
735 Ga0207691_10125090
736 Ga0207691_10883584
737 Ga0207711_10000027
738 Ga0207711_10000251
739 Ga0207711_10122361
740 Ga0207711_10264875
741 Ga0207711_10278727
742 Ga0207661_10410439
743 Ga0207661_10642839
744 Ga0207667_10031117
745 Ga0207667_10048527
746 Ga0207651_10986718
747 Ga0207712_10000262
748 Ga0207712_10039787
749 Ga0207712_10092327
750 Ga0207712_10429354
751 Ga0207668_10000068
752 Ga0207668_10001858
753 Ga0207668_10003466
754 Ga0207668_10077524
755 Ga0207640_10040236
756 Ga0207640_10194062
757 Ga0207640_10247385
758 Ga0207658_10000362
759 Ga0207658_10024359
760 Ga0207658_10435562
761 Ga0207703_10040742
762 Ga0207639_10014011
763 Ga0207639_11208503
764 Ga0207678_10000068
765 Ga0207702_11476383
766 Ga0207702_11846804
767 Ga0207641_10000031
768 Ga0207641_10000041
769 Ga0207641_10048450
770 Ga0207648_10682826
771 Ga0207676_10000039
772 Ga0207676_10000383
773 Ga0207676_10123464
774 Ga0207676_10944673
775 Ga0207674_10000811
776 Ga0207675_100000041
777 Ga0207675_100005628
778 Ga0207675_100312728
779 Ga0207698_10258887
780 Ga0207698_10688419
781 Ga0209970_1100606
782 Ga0209813_10000172
783 Ga0209974_10008028
784 Ga0268266_10019585
785 Ga0268266_11132404
786 Ga0268265_10000061
787 Ga0268265_10001875
788 Ga0268265_10058781
789 Ga0268265_10078398
790 Ga0268265_10099240
791 Ga0268265_10128782
792 Ga0268265_10546329
793 Ga0268265_12490559
794 Ga0268264_10000071
795 Ga0268264_10016671
796 Ga0307517_10014909
797 Ga0316177_1010467
798 Ga0316178_1151566
799 Ga0316180_1187281
800 Ga0316183_1180393
801 Ga0316182_1153558
802 Ga0265327_10055612
803 Ga0307513_10632148
804 Ga0307408_100011557
805 Ga0307408_100051480
806 Ga0307408_100117628
807 Ga0307408_100265169
808 Ga0307408_100335925
809 Ga0307408_100396029
810 Ga0307408_101078937
811 Ga0307408_101238090
812 Ga0307408_101975026
813 Ga0307405_10023829
814 Ga0307405_10039398
815 Ga0307405_10067552
816 Ga0307405_10114949
817 Ga0307405_10131803
818 Ga0307405_10219714
819 Ga0307405_10243906
820 Ga0307405_10298729
821 Ga0307405_10619945
822 Ga0307405_11323257
823 Ga0307405_11559296
824 Ga0307413_10009505
825 Ga0307413_10013310
826 Ga0307413_10060608
827 Ga0307413_10062284
828 Ga0307413_10238653
829 Ga0307413_10295783
830 Ga0307413_10314509
831 Ga0307413_10344969
832 Ga0307413_10784987
833 Ga0307413_11350426
834 Ga0307413_11437520
835 Ga0307410_10025503
836 Ga0307410_10129911
837 Ga0307410_10231238
838 Ga0307410_10247483
839 Ga0307410_10270282
840 Ga0307410_10394589
841 Ga0307410_10475997
842 Ga0307410_10485635
843 Ga0307410_11226445
844 Ga0307406_10006284
845 Ga0307406_10036022
846 Ga0307406_10061761
847 Ga0307406_10132577
848 Ga0307406_10181581
849 Ga0307406_10311608
850 Ga0307406_10397440
851 Ga0307406_10441583
852 Ga0307406_10543634
853 Ga0307406_10652952
854 Ga0307406_11326436
855 Ga0307407_10003784
856 Ga0307407_10024854
857 Ga0307407_10111121
858 Ga0307407_10118948
859 Ga0307407_10194740
860 Ga0307407_10278637
861 Ga0307407_10781101
862 Ga0307412_10001563
863 Ga0307412_10046826
864 Ga0307412_10059289
865 Ga0307412_10084975
866 Ga0307412_10134960
867 Ga0307412_10163373
868 Ga0307412_10187660
869 Ga0307412_10674097
870 Ga0307412_10700166
871 Ga0307412_10842715
872 Ga0307409_100007148
873 Ga0307409_100022526
874 Ga0307409_100064682
875 Ga0307409_100076623
876 Ga0307409_100113522
877 Ga0307409_100877530
878 Ga0307409_100950883
879 Ga0307409_101039404
880 Ga0307409_101569545
881 Ga0307409_101696636
882 Ga0307416_100036866
883 Ga0307416_100037872
884 Ga0307416_100045139
885 Ga0307416_100049966
886 Ga0307416_100541482
887 Ga0307416_100721329
888 Ga0307416_100810385
889 Ga0307416_100904890
890 Ga0307416_100905187
891 Ga0307416_100997021
892 Ga0307416_101560537
893 Ga0307414_10000308
894 Ga0307414_10005443
895 Ga0307414_10018974
896 Ga0307414_10020384
897 Ga0307414_10020899
898 Ga0307414_10128427
899 Ga0307414_10141905
900 Ga0307414_10155110
901 Ga0307414_10215528
902 Ga0307414_10263575
903 Ga0307414_10269538
904 Ga0307414_10314894
905 Ga0307414_10335293
906 Ga0307414_10355085
907 Ga0307414_10365094
908 Ga0307414_10443906
909 Ga0307414_10783788
910 Ga0307414_10895018
911 Ga0307414_10899357
912 Ga0307414_10921993
913 Ga0307414_11471032
914 Ga0307414_11553035
915 Ga0307414_12044263
916 Ga0307411_10000768
917 Ga0307411_10012845
918 Ga0307411_10040468
919 Ga0307411_10050922
920 Ga0307411_10122066
921 Ga0307411_10134325
922 Ga0307411_10245497
923 Ga0307411_11421177
924 Ga0307411_11568581
925 Ga0307415_100038354
926 Ga0307415_100100707
927 Ga0307415_100102552
928 Ga0307415_100125483
929 Ga0307415_100659027
930 Ga0307415_102073081
931 Ga0307510_10197820
932 Ga0395905_0940862
933 Ga0436363_0627825
934 Ga0439465_0127568
935 Ga0451802_1555010
936 Ga0451853_2068090
937 Ga0439446_0154201
938 Ga0439464_0006676
939 Ga0466970_0785228
940 Ga0466960_0294412
941 Ga0495627_087003
942 Ga0495590_0364812
943 Ga0495638_0039054
944 Ga0495638_0220978
945 Ga0495650_0138866
946 Ga0495650_0247932
947 Ga0495616_0000007
948 Ga0495642_0134181
949 Ga0495621_0005871
950 Ga0495621_0355868
951 Ga0495669_0008391
952 Ga0495670_0430653
953 Ga0495671_0048528
954 Ga0495686_0000262
955 Ga0495686_0000834
956 Ga0495686_0458241
957 Ga0496101_0199974
958 Ga0496102_1006514
959 Ga0496103_0026623
960 Ga0496103_0158571
961 Ga0496107_0081724
962 Ga0496108_0157347
963 Ga0496108_0380922
964 Ga0496109_0276936
965 Ga0496109_1087582
966 Ga0496110_0007823
967 Ga0496111_0054410
968 Ga0496114_0009716
969 Ga0496116_0170115
970 Ga0496117_0005718
971 Ga0496117_0030629
972 Ga0496117_0061445
973 Ga0496118_0000493
974 Ga0496118_0001107
975 Ga0496118_0037508
976 Ga0496118_0045558
977 Ga0496121_0001342
978 Ga0496121_0098057
979 Ga0496121_0126319
980 Ga0496121_0463062
981 Ga0496122_0000306
982 Ga0496122_0030304
983 Ga0496123_0001592
984 Ga0496124_0077370
985 Ga0496125_0017748
986 Ga0496125_0018638
987 Ga0496125_0211088
988 Ga0496125_0278917
989 Ga0496125_0473182
990 Ga0496126_0111938
991 Ga0496126_0161083
992 Ga0501292_000022
993 Ga0501294_000093
994 Ga0501033_0046394
995 Ga0501034_0064209
996 Ga0501043_0086941
997 Ga0501073_0414312
998 Ga0501198_006741
999 Ga0501202_227463
1000 Ga0501206_028555
1001 Ga0501222_000207
1002 Ga0501223_000599
1003 Ga0501223_000978
1004 Ga0501224_000006
1005 Ga0501224_000109
1006 Ga0501227_021759
1007 Ga0501233_000508
1008 Ga0501233_083091
1009 Ga0501235_002784
1010 Ga0501235_050002
1011 Ga0501236_043757
1012 Ga0501239_028127
1013 Ga0501259_000841
1014 Ga0501261_000075
1015 Ga0501225_0001785
1016 Ga0501225_0001860
1017 Ga0501229_076860
1018 Ga0501245_000635
1019 Ga0501268_009369
1020 Ga0501279_000012
1021 Ga0501279_095680
1022 Ga0501280_000005
1023 Ga0501281_00020
1024 Ga0501282_000176
1025 Ga0501044_0025435
1026 Ga0501226_000355
1027 nmdc:mga0qj67_824388_c1
1028 nmdc:mga06r32_53054_c1
1029 Ga0500643_000121
1030 Ga0500643_002760
1031 Ga0500643_016369
1032 Ga0500566_0079841
1033 Ga0500641_0173514
1034 Ga0500562_081465
1035 Ga0500592_000224
1036 Ga0500594_0005662
1037 Ga0500608_133899
1038 Ga0500658_0296373
1039 Ga0500559_0098159
1040 Ga0500559_0289904
1041 Ga0500577_0098457
1042 Ga0500604_0013225
1043 Ga0500616_0007857
1044 Ga0500616_0270272
1045 Ga0500624_000254
1046 Ga0500627_0000272
1047 Ga0500636_0006645
1048 Ga0500587_011857
1049 2778125494
1050 2809065332
1051 2809081276
1052 2809085641
1053 2880520824
1054 2885427275
1055 2885432386
1056 2896429262
1057 2919711202
1058 2984565093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

33

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8681 65 138
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.8465 65 138
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.7397 90 137
1dqw-assembly1.cif.gz_A crystal structure of orotidine 5'-phosphate decarboxylase 0.706 108 139
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7043 48 138
ID Description Score Start End Superfamily
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7813 66 137 3.30.420.270
2pfuA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.7722 66 137 3.30.420.270
af_Q55DS6_13_159_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7652 106 140 3.30.420.40
af_Q0JPY3_361_453_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7542 106 139 3.80.10.10
af_Q8IN10_6_181_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7258 104 139 3.40.50.2300
ID Description Score Start End GO Terms
AF-F0CAJ8-F1-model_v4 deleted 0.9406 66 138
AF-F0CAJ8-F1-model_v4 deleted 0.8836 66 138
AF-A0A0S7X6Y9-F1-model_v4 Biopolymer transporter ExbD 0.8814 61 141 GO:0005886
GO:0015031
GO:0022857
AF-A0A7Z2ZJG0-F1-model_v4 Biopolymer transporter ExbD 0.8541 48 138 GO:0005886
GO:0015031
GO:0022857
AF-A0A3M1K2I6-F1-model_v4 Protein TolR 0.8444 69 146 GO:0005886
GO:0015031
GO:0022857

Map