F459801

General Info

Members Datasets Scaffolds Average Seq Length
529 247 529 347

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10150684|Ga0111539_101506843
Length 364
Sequence VKRGVNPRVEEKQGMSTPTQPAPAPGKRLNRIGLEPIAYRGSKTTLCAGCGHNAITERIIDSFWELGISPEQVLKLSGIGCSSKSPAYFLSQSHGFNSVHGRMPSVATGAVVANRKMIAIGVSGDGDTGAIGIGQFVHLMRRNLPMVYIIEDNGCYGLTKGQFSPTADLGSKLKTGVINDLPPIDTCALAIELGASFVARSFSGDPKQLKAILKAALSHRGTAMIDVLSPCVTFNDHDGSTKSYSYAKDHEEPLSDVSFVPFFEDITIDYDPGTSTTVSLHDGSRIVLTKMTEDYNPTDRIRSLTLLRETARRNEFATGILYVEPDKPDFIDMLGLVDEPLAHLDESRTRPGKAALDEIMESFR

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
161 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 6.43
Rhizosphere 90.74
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000423 3300000546 Bacteria 7491
2 LJNas_1000739 3300000546 Bacteria 5456
3 JGI25406J46586_10000120 3300003203 Bacteria 34396
4 Ga0065704_10105622 3300005289 Bacteria 2090
5 Ga0065712_10001052 3300005290 Bacteria 13561
6 Ga0065712_10004968 3300005290 Bacteria 5409
7 Ga0065712_10078549 3300005290 Bacteria 3331
8 Ga0065715_10000269 3300005293 Bacteria 20304
9 Ga0065715_10094426 3300005293 Bacteria 4344
10 Ga0065715_10135686 3300005293 Bacteria 1934
11 Ga0065707_10120897 3300005295 Bacteria 2112
12 Ga0070658_10159524 3300005327 Bacteria 1892
13 Ga0070676_10007368 3300005328 Bacteria 5903
14 Ga0070676_10176049 3300005328 Bacteria 1387
15 Ga0070683_100000500 3300005329 Bacteria 27695
16 Ga0070683_100193003 3300005329 Bacteria 1934
17 Ga0070690_100023258 3300005330 Bacteria 3800
18 Ga0070670_100009228 3300005331 Bacteria 8427
19 Ga0070670_100035799 3300005331 Bacteria 4274
20 Ga0070670_100063835 3300005331 Bacteria 3160
21 Ga0070670_100096963 3300005331 Bacteria 2536
22 Ga0070670_100242154 3300005331 Bacteria 1570
23 Ga0070677_10001312 3300005333 Bacteria 7947
24 Ga0068869_100030640 3300005334 Bacteria 3778
25 Ga0068869_100059568 3300005334 Bacteria 2796
26 Ga0070666_10001844 3300005335 Bacteria 12917
27 Ga0070666_10028715 3300005335 Bacteria 3652
28 Ga0070666_10073997 3300005335 Bacteria 2321
29 Ga0070680_100115296 3300005336 Bacteria 2239
30 Ga0070682_100296611 3300005337 Bacteria 1184
31 Ga0070660_100187722 3300005339 Bacteria 1674
32 Ga0070689_100011278 3300005340 Bacteria 6398
33 Ga0070689_100030013 3300005340 Bacteria 4123
34 Ga0070689_100101741 3300005340 Bacteria 2275
35 Ga0070687_100015200 3300005343 Bacteria 3473
36 Ga0070668_100070586 3300005347 Bacteria 2720
37 Ga0070668_100165941 3300005347 Bacteria 1794
38 Ga0070669_100016441 3300005353 Bacteria 5278
39 Ga0070669_100027792 3300005353 Bacteria 4071
40 Ga0070669_100057480 3300005353 Bacteria 2854
41 Ga0070669_100170841 3300005353 Bacteria 1695
42 Ga0070675_100017971 3300005354 Bacteria 5627
43 Ga0070675_100041501 3300005354 Bacteria 3758
44 Ga0070675_100143650 3300005354 Bacteria 2041
45 Ga0070675_100179372 3300005354 Bacteria 1831
46 Ga0070671_100014366 3300005355 Bacteria 6396
47 Ga0070671_100331668 3300005355 Bacteria 1297
48 Ga0070674_100003802 3300005356 Bacteria 8533
49 Ga0070674_100070771 3300005356 Bacteria 2465
50 Ga0070673_100005375 3300005364 Bacteria 8187
51 Ga0070673_100021855 3300005364 Bacteria 4648
52 Ga0070673_100031830 3300005364 Bacteria 3963
53 Ga0070673_100331249 3300005364 Bacteria 1347
54 Ga0070688_100020051 3300005365 Bacteria 3882
55 Ga0070688_100072787 3300005365 Bacteria 2203
56 Ga0070688_100188019 3300005365 Bacteria 1437
57 Ga0070659_100123168 3300005366 Bacteria 2102
58 Ga0070667_100000989 3300005367 Bacteria 26078
59 Ga0070667_100021437 3300005367 Bacteria 5365
60 Ga0070667_100119736 3300005367 Bacteria 2289
61 Ga0070667_100399131 3300005367 Bacteria 1251
62 Ga0070713_100008567 3300005436 Bacteria 7260
63 Ga0070710_10008097 3300005437 Bacteria 5111
64 Ga0070701_10021316 3300005438 Bacteria 3090
65 Ga0070700_100070430 3300005441 Bacteria 2230
66 Ga0070694_100011589 3300005444 Bacteria 5460
67 Ga0070663_100061488 3300005455 Bacteria 2705
68 Ga0070663_100088734 3300005455 Bacteria 2287
69 Ga0070678_100144994 3300005456 Bacteria 1905
70 Ga0070662_100006443 3300005457 Bacteria 7565
71 Ga0070681_10073144 3300005458 Bacteria 3390
72 Ga0070685_10012465 3300005466 Bacteria 4467
73 Ga0070685_10082546 3300005466 Bacteria 1929
74 Ga0070699_100008025 3300005518 Bacteria 9167
75 Ga0070699_100444028 3300005518 Bacteria 1176
76 Ga0070679_100005990 3300005530 Bacteria 11304
77 Ga0070679_100280651 3300005530 Bacteria 1618
78 Ga0070684_100001365 3300005535 Bacteria 17516
79 Ga0068853_100228297 3300005539 Bacteria 1702
80 Ga0068853_100397880 3300005539 Bacteria 1289
81 Ga0070672_100002598 3300005543 Bacteria 11535
82 Ga0070672_100014063 3300005543 Bacteria 5663
83 Ga0070672_100023539 3300005543 Bacteria 4542
84 Ga0070672_100032696 3300005543 Bacteria 3929
85 Ga0070672_100048247 3300005543 Bacteria 3308
86 Ga0070672_100139502 3300005543 Bacteria 1998
87 Ga0070672_100190193 3300005543 Bacteria 1713
88 Ga0070686_100015561 3300005544 Bacteria 4409
89 Ga0070695_100188016 3300005545 Bacteria 1468
90 Ga0070696_100081432 3300005546 Bacteria 2294
91 Ga0070665_100030190 3300005548 Bacteria 5455
92 Ga0070665_100054864 3300005548 Bacteria 3996
93 Ga0070665_100059083 3300005548 Bacteria 3844
94 Ga0070665_100539407 3300005548 Bacteria 1178
95 Ga0068855_100209254 3300005563 Bacteria 2193
96 Ga0070664_100008009 3300005564 Bacteria 8537
97 Ga0070664_100015875 3300005564 Bacteria 6166
98 Ga0070664_100016791 3300005564 Bacteria 6008
99 Ga0070664_100055676 3300005564 Bacteria 3359
100 Ga0068857_100037884 3300005577 Bacteria 4272
101 Ga0068857_100132802 3300005577 Bacteria 2246
102 Ga0068856_100006029 3300005614 Bacteria 11923
103 Ga0068859_100000645 3300005617 Bacteria 34867
104 Ga0068859_100084288 3300005617 Bacteria 3223
105 Ga0068859_100179315 3300005617 Bacteria 2201
106 Ga0068859_100206957 3300005617 Bacteria 2047
107 Ga0068864_100005866 3300005618 Bacteria 10062
108 Ga0068864_100016681 3300005618 Bacteria 6120
109 Ga0068864_100023937 3300005618 Bacteria 5132
110 Ga0068864_100227617 3300005618 Bacteria 1723
111 Ga0068864_100231356 3300005618 Bacteria 1709
112 Ga0068861_100011509 3300005719 Bacteria 6154
113 Ga0068861_100011576 3300005719 Bacteria 6137
114 Ga0068861_100028741 3300005719 Bacteria 4059
115 Ga0068861_100298921 3300005719 Bacteria 1393
116 Ga0068870_10027107 3300005840 Bacteria 2863
117 Ga0068863_100002061 3300005841 Bacteria 19922
118 Ga0068863_100002762 3300005841 Bacteria 17386
119 Ga0068863_100145040 3300005841 Bacteria 2270
120 Ga0068863_100276342 3300005841 Bacteria 1627
121 Ga0068863_100492124 3300005841 Bacteria 1207
122 Ga0068858_100021235 3300005842 Bacteria 6064
123 Ga0068858_100118421 3300005842 Bacteria 2476
124 Ga0068860_100010562 3300005843 Bacteria 9123
125 Ga0068860_100035124 3300005843 Bacteria 4810
126 Ga0068862_100013690 3300005844 Bacteria 6718
127 Ga0068862_100186042 3300005844 Bacteria 1866
128 Ga0068862_100205979 3300005844 Bacteria 1775
129 Ga0081539_10000024 3300005985 Bacteria 354702
130 Ga0081539_10000096 3300005985 Bacteria 204059
131 Ga0081539_10002353 3300005985 Bacteria 27164
132 Ga0075368_10041328 3300006042 Bacteria 1811
133 Ga0075366_10008607 3300006195 Bacteria 5682
134 Ga0097621_100005339 3300006237 Bacteria 9047
135 Ga0097621_100031081 3300006237 Bacteria 4234
136 Ga0097621_100045464 3300006237 Bacteria 3547
137 Ga0097621_100052224 3300006237 Bacteria 3330
138 Ga0097621_100077347 3300006237 Bacteria 2762
139 Ga0068871_100014012 3300006358 Bacteria 5966
140 Ga0068871_100059193 3300006358 Bacteria 3120
141 Ga0068871_100086372 3300006358 Bacteria 2606
142 Ga0068871_100133883 3300006358 Bacteria 2103
143 Ga0075428_100000108 3300006844 Bacteria 70319
144 Ga0075428_100004648 3300006844 Bacteria 15196
145 Ga0075428_100098297 3300006844 Bacteria 3191
146 Ga0075428_100178684 3300006844 Bacteria 2298
147 Ga0075430_100019579 3300006846 Bacteria 5758
148 Ga0075430_100043749 3300006846 Bacteria 3786
149 Ga0075431_100001687 3300006847 Bacteria 20728
150 Ga0075431_100020699 3300006847 Bacteria 6722
151 Ga0075431_100356979 3300006847 Bacteria 1469
152 Ga0075433_10000839 3300006852 Bacteria 21522
153 Ga0075433_10020584 3300006852 Bacteria 5521
154 Ga0075433_10130467 3300006852 Bacteria 2233
155 Ga0075433_10169105 3300006852 Bacteria 1945
156 Ga0075433_10189122 3300006852 Bacteria 1832
157 Ga0075433_10236375 3300006852 Bacteria 1622
158 Ga0075434_100001347 3300006871 Bacteria 20612
159 Ga0075434_100071301 3300006871 Unclassified 3466
160 Ga0075434_100125622 3300006871 Bacteria 2582
161 Ga0075434_100173984 3300006871 Bacteria 2173
162 Ga0075434_100178425 3300006871 Bacteria 2144
163 Ga0075429_100014281 3300006880 Bacteria 6888
164 Ga0075429_100143545 3300006880 Bacteria 2090
165 Ga0068865_100158037 3300006881 Bacteria 1726
166 Ga0068865_100186468 3300006881 Bacteria 1601
167 Ga0075436_100000671 3300006914 Bacteria 22502
168 Ga0075436_100244931 3300006914 Bacteria 1275
169 Ga0097620_100000645 3300006931 Bacteria 34867
170 Ga0097620_100053081 3300006931 Bacteria 4076
171 Ga0097620_100084282 3300006931 Bacteria 3223
172 Ga0097620_100179304 3300006931 Bacteria 2201
173 Ga0097620_100206945 3300006931 Bacteria 2047
174 Ga0075435_100006980 3300007076 Bacteria 8018
175 Ga0075435_100051099 3300007076 Bacteria 3329
176 Ga0105240_10120425 3300009093 Bacteria 3160
177 Ga0111539_10000001 3300009094 Bacteria 1035431
178 Ga0111539_10001789 3300009094 Bacteria 28570
179 Ga0111539_10002263 3300009094 Bacteria 25652
180 Ga0111539_10002439 3300009094 Bacteria 24735
181 Ga0111539_10010482 3300009094 Bacteria 11661
182 Ga0111539_10015398 3300009094 Bacteria 9516
183 Ga0111539_10028916 3300009094 Bacteria 6758
184 Ga0111539_10106604 3300009094 Bacteria 3287
185 Ga0111539_10150684 3300009094 Bacteria 2722
186 Ga0111539_10183879 3300009094 Bacteria 2441
187 Ga0111539_10258764 3300009094 Bacteria 2026
188 Ga0111539_10559582 3300009094 Bacteria 1332
189 Ga0105245_10153449 3300009098 Bacteria 2180
190 Ga0105245_10336731 3300009098 Bacteria 1491
191 Ga0114129_10000174 3300009147 Bacteria 70648
192 Ga0114129_10003221 3300009147 Bacteria 22900
193 Ga0114129_10007540 3300009147 Bacteria 15491
194 Ga0114129_10025369 3300009147 Bacteria 8400
195 Ga0114129_10030336 3300009147 Bacteria 7652
196 Ga0114129_10320019 3300009147 Bacteria 2062
197 Ga0105242_10194146 3300009176 Bacteria 1799
198 Ga0105248_10021539 3300009177 Bacteria 7139
199 Ga0105248_10026112 3300009177 Bacteria 6498
200 Ga0105248_10061095 3300009177 Bacteria 4230
201 Ga0105248_10078331 3300009177 Bacteria 3715
202 Ga0105248_10082480 3300009177 Bacteria 3616
203 Ga0105248_10779426 3300009177 Bacteria 1079
204 Ga0105237_10426864 3300009545 Bacteria 1331
205 Ga0105249_10001517 3300009553 Bacteria 20379
206 Ga0105249_10107994 3300009553 Bacteria 2626
207 Ga0105249_10199642 3300009553 Bacteria 1957
208 Ga0105246_10025235 3300011119 Bacteria 3873
209 Ga0157371_10145906 3300013102 Bacteria 1686
210 Ga0157370_10137425 3300013104 Bacteria 2277
211 Ga0157369_10190988 3300013105 Bacteria 2152
212 Ga0157374_10043570 3300013296 Bacteria 4146
213 Ga0157374_10083973 3300013296 Bacteria 3026
214 Ga0157374_10100314 3300013296 Bacteria 2775
215 Ga0157374_10295934 3300013296 Bacteria 1601
216 Ga0157378_10025354 3300013297 Bacteria 5222
217 Ga0157378_10265204 3300013297 Bacteria 1649
218 Ga0163162_10031787 3300013306 Bacteria 5238
219 Ga0163162_10068321 3300013306 Bacteria 3605
220 Ga0163162_10298596 3300013306 Bacteria 1743
221 Ga0157375_10001332 3300013308 Bacteria 21293
222 Ga0157375_10024925 3300013308 Bacteria 5546
223 Ga0157375_10046551 3300013308 Bacteria 4231
224 Ga0157375_10072570 3300013308 Bacteria 3459
225 Ga0157375_10112204 3300013308 Bacteria 2826
226 Ga0157375_10241713 3300013308 Bacteria 1965
227 Ga0163163_10000017 3300014325 Bacteria 208781
228 Ga0163163_10128873 3300014325 Bacteria 2569
229 Ga0163163_10378098 3300014325 Bacteria 1474
230 Ga0157380_10017590 3300014326 Bacteria 5290
231 Ga0157380_10076073 3300014326 Bacteria 2730
232 Ga0157380_10417945 3300014326 Bacteria 1278
233 Ga0157377_10125469 3300014745 Bacteria 1561
234 Ga0157379_10034512 3300014968 Bacteria 4510
235 Ga0157376_10010121 3300014969 Bacteria 6887
236 Ga0157376_10037777 3300014969 Bacteria 3924
237 Ga0163161_10029497 3300017792 Bacteria 3900
238 Ga0224712_10040484 3300022467 Bacteria 1754
239 Ga0207697_10010226 3300025315 Bacteria 4019
240 Ga0207697_10100831 3300025315 Bacteria 1230
241 Ga0207682_10003116 3300025893 Bacteria 7262
242 Ga0207682_10003998 3300025893 Bacteria 6275
243 Ga0207692_10015489 3300025898 Bacteria 3356
244 Ga0207688_10006597 3300025901 Bacteria 6313
245 Ga0207688_10010284 3300025901 Bacteria 5092
246 Ga0207647_10002036 3300025904 Bacteria 15455
247 Ga0207645_10013270 3300025907 Bacteria 5558
248 Ga0207645_10020774 3300025907 Bacteria 4292
249 Ga0207645_10106312 3300025907 Bacteria 1814
250 Ga0207643_10000719 3300025908 Bacteria 20342
251 Ga0207643_10006147 3300025908 Bacteria 6423
252 Ga0207643_10063566 3300025908 Bacteria 2111
253 Ga0207707_10158044 3300025912 Bacteria 1982
254 Ga0207695_10389317 3300025913 Bacteria 1279
255 Ga0207660_10143056 3300025917 Bacteria 1830
256 Ga0207662_10013224 3300025918 Bacteria 4613
257 Ga0207657_10160399 3300025919 Bacteria 1827
258 Ga0207652_10042033 3300025921 Bacteria 3889
259 Ga0207681_10329861 3300025923 Bacteria 1216
260 Ga0207650_10011577 3300025925 Bacteria 6074
261 Ga0207650_10019377 3300025925 Bacteria 4780
262 Ga0207650_10027932 3300025925 Bacteria 4042
263 Ga0207650_10069414 3300025925 Bacteria 2648
264 Ga0207650_10311843 3300025925 Bacteria 1287
265 Ga0207659_10004886 3300025926 Bacteria 8120
266 Ga0207659_10023305 3300025926 Bacteria 4130
267 Ga0207659_10033346 3300025926 Bacteria 3543
268 Ga0207700_10220589 3300025928 Bacteria 1607
269 Ga0207664_10025948 3300025929 Bacteria 4422
270 Ga0207706_10054786 3300025933 Bacteria 3519
271 Ga0207706_10225391 3300025933 Bacteria 1641
272 Ga0207670_10043647 3300025936 Bacteria 2963
273 Ga0207669_10005017 3300025937 Bacteria 5887
274 Ga0207669_10143478 3300025937 Bacteria 1661
275 Ga0207704_10019970 3300025938 Bacteria 3533
276 Ga0207691_10002949 3300025940 Bacteria 16607
277 Ga0207691_10038899 3300025940 Bacteria 4401
278 Ga0207691_10042995 3300025940 Bacteria 4165
279 Ga0207691_10042996 3300025940 Bacteria 4165
280 Ga0207691_10046064 3300025940 Bacteria 4010
281 Ga0207691_10059785 3300025940 Bacteria 3464
282 Ga0207691_10125234 3300025940 Bacteria 2274
283 Ga0207711_10000511 3300025941 Bacteria 39835
284 Ga0207689_10011973 3300025942 Bacteria 7435
285 Ga0207689_10034173 3300025942 Bacteria 4223
286 Ga0207689_10055184 3300025942 Bacteria 3271
287 Ga0207689_10075399 3300025942 Bacteria 2772
288 Ga0207661_10005594 3300025944 Bacteria 8861
289 Ga0207679_10007747 3300025945 Bacteria 6824
290 Ga0207667_10195119 3300025949 Bacteria 2077
291 Ga0207651_10007460 3300025960 Bacteria 5828
292 Ga0207651_10034440 3300025960 Bacteria 3280
293 Ga0207712_10022729 3300025961 Bacteria 4134
294 Ga0207712_10301351 3300025961 Bacteria 1315
295 Ga0207668_10145049 3300025972 Bacteria 1831
296 Ga0207668_10197196 3300025972 Bacteria 1600
297 Ga0207668_10278611 3300025972 Bacteria 1370
298 Ga0207658_10028612 3300025986 Bacteria 3926
299 Ga0207658_10049176 3300025986 Bacteria 3097
300 Ga0207658_10073613 3300025986 Bacteria 2593
301 Ga0207678_10087667 3300026067 Bacteria 2660
302 Ga0207678_10181110 3300026067 Bacteria 1799
303 Ga0207678_10194996 3300026067 Bacteria 1731
304 Ga0207708_10023376 3300026075 Bacteria 4671
305 Ga0207708_10097167 3300026075 Bacteria 2276
306 Ga0207641_10110284 3300026088 Bacteria 2438
307 Ga0207641_10285838 3300026088 Bacteria 1553
308 Ga0207648_10017784 3300026089 Bacteria 6454
309 Ga0207648_10081129 3300026089 Bacteria 2830
310 Ga0207648_10266495 3300026089 Bacteria 1529
311 Ga0207676_10016426 3300026095 Bacteria 5361
312 Ga0207676_10045247 3300026095 Bacteria 3400
313 Ga0207676_10045901 3300026095 Bacteria 3378
314 Ga0207674_10017928 3300026116 Bacteria 7716
315 Ga0207674_10423926 3300026116 Bacteria 1286
316 Ga0207675_100012281 3300026118 Bacteria 8002
317 Ga0207675_100084735 3300026118 Bacteria 2974
318 Ga0207675_100311116 3300026118 Bacteria 1536
319 Ga0207683_10012400 3300026121 Bacteria 7274
320 Ga0207683_10230455 3300026121 Bacteria 1689
321 Ga0207698_10136072 3300026142 Bacteria 2108
322 Ga0207428_10000002 3300027907 Bacteria 854851
323 Ga0207428_10000849 3300027907 Bacteria 34443
324 Ga0207428_10004387 3300027907 Bacteria 13451
325 Ga0207428_10010923 3300027907 Bacteria 8082
326 Ga0207428_10011180 3300027907 Bacteria 7961
327 Ga0207428_10025773 3300027907 Bacteria 4916
328 Ga0207428_10209042 3300027907 Bacteria 1467
329 Ga0268266_10035802 3300028379 Bacteria 4222
330 Ga0268266_10140740 3300028379 Bacteria 2165
331 Ga0268266_10143107 3300028379 Bacteria 2147
332 Ga0268265_10011891 3300028380 Bacteria 5886
333 Ga0268265_10062247 3300028380 Bacteria 2866
334 Ga0268265_10306804 3300028380 Bacteria 1431
335 Ga0268264_10039306 3300028381 Bacteria 3908
336 Ga0268264_10175418 3300028381 Bacteria 1942
337 Ga0265336_10001878 3300028666 Bacteria 9085
338 Ga0265760_10014625 3300031090 Bacteria 2249
339 Ga0265316_10001007 3300031344 Bacteria 30605
340 Ga0307408_100270180 3300031548 Bacteria 1411
341 Ga0307405_10204809 3300031731 Bacteria 1436
342 Ga0307410_10158330 3300031852 Bacteria 1694
343 Ga0307410_10191713 3300031852 Bacteria 1555
344 Ga0307411_10276059 3300032005 Bacteria 1335
345 Ga0373934_0007068 3300035086 Bacteria 4165
346 Ga0373932_0050832 3300035112 Bacteria 1229
347 Ga0373927_0010876 3300035695 Bacteria 6060
348 Ga0373933_0023125 3300035724 Bacteria 3548
349 Ga0373933_0253838 3300035724 Bacteria 1133
350 Ga0373947_0000399 3300035725 Bacteria 24491
351 Ga0373937_0000499 3300036401 Bacteria 35871
352 Ga0373937_0001949 3300036401 Bacteria 17281
353 Ga0373937_0087881 3300036401 Bacteria 2877
354 Ga0373925_0001209 3300037068 Bacteria 22767
355 Ga0395905_0068804 3300037471 Bacteria 3316
356 Ga0395905_0093407 3300037471 Bacteria 2822
357 Ga0436364_0347559 3300037853 Bacteria 1247
358 Ga0436363_0210429 3300039450 Bacteria 1639
359 Ga0436363_0622237 3300039450 Bacteria 2167
360 Ga0436363_0869569 3300039450 Bacteria 2081
361 Ga0436363_1537631 3300039450 Bacteria 1981
362 Ga0450894_001200 3300042131 Bacteria 3841
363 Ga0450908_010797 3300042184 Bacteria 1681
364 Ga0439435_0030075 3300042436 Bacteria 1470
365 Ga0439464_0036666 3300042439 Bacteria 1388
366 Ga0439464_0043567 3300042439 Bacteria 1284
367 Ga0453683_0135390 3300044673 Bacteria 1554
368 Ga0466963_0067333 3300044694 Bacteria 2403
369 Ga0453684_0084396 3300044712 Bacteria 3950
370 Ga0453684_0723447 3300044712 Bacteria 1080
371 Ga0451576_0008042 3300045051 Bacteria 12447
372 Ga0451576_0022914 3300045051 Bacteria 6767
373 Ga0451576_0025872 3300045051 Bacteria 6319
374 Ga0451576_0123792 3300045051 Bacteria 2693
375 Ga0451576_0298918 3300045051 Bacteria 1683
376 Ga0495629_0105033 3300046459 Bacteria 1970
377 Ga0495638_0007866 3300046460 Bacteria 7605
378 Ga0495651_0026908 3300046462 Bacteria 4479
379 Ga0495653_0019761 3300046463 Bacteria 5462
380 Ga0495665_0035412 3300046531 Bacteria 2667
381 Ga0495645_0100539 3300046543 Bacteria 2056
382 Ga0495599_0038251 3300046678 Bacteria 3015
383 Ga0495599_0096900 3300046678 Bacteria 1839
384 Ga0495647_0003002 3300046681 Bacteria 5369
385 Ga0495658_0023673 3300046683 Bacteria 3263
386 Ga0495613_0099408 3300046689 Bacteria 2102
387 Ga0495613_0166662 3300046689 Bacteria 1565
388 Ga0495680_0130878 3300047322 Bacteria 1844
389 Ga0495684_0032654 3300047471 Bacteria 3997
390 Ga0495684_0035673 3300047471 Bacteria 3813
391 Ga0495684_0057472 3300047471 Bacteria 2965
392 Ga0495684_0105529 3300047471 Bacteria 2129
393 Ga0496100_0006282 3300048903 Bacteria 6471
394 Ga0496100_0045682 3300048903 Bacteria 2812
395 Ga0496100_0188772 3300048903 Bacteria 1495
396 Ga0496101_0000222 3300048904 Bacteria 42490
397 Ga0496102_0017609 3300048905 Bacteria 6260
398 Ga0496102_0106816 3300048905 Bacteria 2606
399 Ga0496103_0039199 3300048906 Bacteria 2911
400 Ga0496104_0001478 3300048907 Bacteria 20272
401 Ga0496104_0016812 3300048907 Bacteria 6648
402 Ga0496104_0044478 3300048907 Bacteria 4172
403 Ga0496105_0016285 3300048908 Bacteria 5934
404 Ga0496105_0246966 3300048908 Bacteria 1447
405 Ga0496106_0000977 3300048909 Bacteria 20836
406 Ga0496107_0218165 3300048910 Bacteria 1419
407 Ga0496108_0119269 3300048911 Bacteria 2262
408 Ga0496109_0001591 3300048912 Bacteria 18936
409 Ga0496109_0002883 3300048912 Bacteria 14395
410 Ga0496109_0006323 3300048912 Bacteria 9976
411 Ga0496110_0003223 3300048913 Bacteria 12429
412 Ga0496110_0189705 3300048913 Bacteria 1867
413 Ga0496110_0246176 3300048913 Bacteria 1627
414 Ga0496111_0089134 3300048914 Bacteria 2259
415 Ga0496111_0118267 3300048914 Bacteria 1956
416 Ga0496111_0324024 3300048914 Bacteria 1141
417 Ga0496112_0000913 3300048915 Bacteria 21318
418 Ga0496112_0001633 3300048915 Bacteria 17370
419 Ga0496112_0090896 3300048915 Bacteria 3022
420 Ga0496112_0155496 3300048915 Bacteria 2253
421 Ga0496113_0167260 3300048916 Bacteria 1740
422 Ga0496113_0480121 3300048916 Bacteria 998
423 Ga0496114_0000416 3300048917 Bacteria 31603
424 Ga0496114_0001016 3300048917 Bacteria 21060
425 Ga0496114_0039519 3300048917 Bacteria 3904
426 Ga0496115_0020221 3300048918 Bacteria 5133
427 Ga0501031_0010042 3300049568 Bacteria 6166
428 Ga0501032_0038195 3300049569 Bacteria 3271
429 Ga0501033_0072609 3300049570 Bacteria 2526
430 Ga0501033_0119413 3300049570 Bacteria 1914
431 Ga0501034_0009195 3300049571 Bacteria 10366
432 Ga0501036_0002069 3300049572 Bacteria 15647
433 Ga0501036_0047506 3300049572 Bacteria 3634
434 Ga0501037_0006174 3300049573 Bacteria 8757
435 Ga0501038_0015045 3300049574 Bacteria 7047
436 Ga0501039_0011230 3300049575 Bacteria 6825
437 Ga0501039_0082901 3300049575 Bacteria 2497
438 Ga0501040_0041322 3300049576 Bacteria 3141
439 Ga0501040_0052315 3300049576 Bacteria 2795
440 Ga0501041_0030537 3300049577 Bacteria 3253
441 Ga0501042_0009454 3300049578 Bacteria 6496
442 Ga0501042_0183726 3300049578 Bacteria 1508
443 Ga0501043_0003896 3300049579 Bacteria 12248
444 Ga0501046_0060979 3300049580 Bacteria 2951
445 Ga0501046_0068737 3300049580 Bacteria 2756
446 Ga0501047_0003720 3300049581 Bacteria 14361
447 Ga0501048_0148192 3300049582 Bacteria 1659
448 Ga0501067_0004090 3300049583 Bacteria 8044
449 Ga0501068_0014774 3300049584 Bacteria 4468
450 Ga0501069_0009417 3300049585 Bacteria 5153
451 Ga0501069_0029616 3300049585 Bacteria 3004
452 Ga0501070_0180591 3300049586 Bacteria 1737
453 Ga0501070_0222497 3300049586 Bacteria 1547
454 Ga0501071_0074314 3300049587 Bacteria 2480
455 Ga0501071_0159208 3300049587 Bacteria 1687
456 Ga0501073_0002590 3300049589 Bacteria 13524
457 Ga0501073_0101130 3300049589 Bacteria 2001
458 Ga0501074_0020019 3300049590 Bacteria 4863
459 Ga0501074_0027557 3300049590 Bacteria 4119
460 Ga0501074_0299895 3300049590 Bacteria 1141
461 Ga0501075_0037535 3300049591 Bacteria 3620
462 Ga0501075_0068544 3300049591 Bacteria 2680
463 Ga0501075_0179191 3300049591 Bacteria 1617
464 Ga0501079_0038052 3300049741 Bacteria 3710
465 Ga0501080_0060984 3300049742 Bacteria 3512
466 Ga0501080_0156288 3300049742 Bacteria 2106
467 Ga0501083_0011332 3300049744 Bacteria 6253
468 Ga0501273_006719 3300049770 Bacteria 1339
469 Ga0501035_0057778 3300049822 Bacteria 3458
470 Ga0501035_0137770 3300049822 Bacteria 2123
471 Ga0501044_0099869 3300049823 Bacteria 2920
472 Ga0501045_0127805 3300049824 Bacteria 1888
473 nmdc:mga00v17_134312_c1 3300050491 Bacteria 1583
474 nmdc:mga06z11_77406_c1 3300050494 Bacteria 1776
475 nmdc:mga07m45_89282_c1 3300050496 Bacteria 1765
476 nmdc:mga05p37_124034_c1 3300050507 Bacteria 3173
477 nmdc:mga05p37_204_c1 3300050507 Bacteria 59503
478 nmdc:mga05p37_21801_c1 3300050507 Bacteria 7760
479 nmdc:mga05p37_31808_c1 3300050507 Bacteria 6447
480 nmdc:mga05p37_7226_c1 3300050507 Bacteria 13099
481 nmdc:mga09592_117816_c1 3300050508 Bacteria 2279
482 nmdc:mga09592_14652_c1 3300050508 Bacteria 6397
483 nmdc:mga0qj67_1031_c1 3300050509 Bacteria 19266
484 nmdc:mga0qj67_126273_c1 3300050509 Bacteria 2070
485 nmdc:mga0qj67_16036_c1 3300050509 Bacteria 5675
486 nmdc:mga0qj67_31718_c1 3300050509 Bacteria 4118
487 nmdc:mga0qj67_3991_c1 3300050509 Bacteria 10683
488 nmdc:mga06r32_133540_c1 3300050510 Bacteria 2456
489 nmdc:mga06r32_2396_c1 3300050510 Bacteria 16781
490 nmdc:mga06r32_38284_c1 3300050510 Bacteria 4542
491 nmdc:mga06r32_74634_c1 3300050510 Bacteria 3288
492 nmdc:mga06r32_95014_c1 3300050510 Bacteria 2917
493 nmdc:mga08y16_15221_c1 3300050511 Bacteria 8091
494 nmdc:mga08y16_175386_c1 3300050511 Bacteria 2226
495 nmdc:mga08y16_257149_c1 3300050511 Bacteria 1804
496 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
497 nmdc:mga08y16_49622_c1 3300050511 Bacteria 4392
498 nmdc:mga08y16_66229_c1 3300050511 Bacteria 3770
499 nmdc:mga08y16_8329_c1 3300050511 Bacteria 10851
500 nmdc:mga0n895_265611_c1 3300050512 Bacteria 1741
501 nmdc:mga0n895_28663_c1 3300050512 Bacteria 5300
502 nmdc:mga0n895_47349_c1 3300050512 Bacteria 4203
503 nmdc:mga0n895_477_c1 3300050512 Bacteria 26935
504 nmdc:mga0n895_75379_c1 3300050512 Bacteria 3353
505 nmdc:mga0rr50_152554_c1 3300050513 Bacteria 1868
506 nmdc:mga0rr50_89900_c1 3300050513 Bacteria 2388
507 nmdc:mga08x19_31958_c1 3300050514 Bacteria 3316
508 nmdc:mga08x19_8005_c1 3300050514 Bacteria 6281
509 nmdc:mga0a205_103159_c1 3300050515 Bacteria 2750
510 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
511 nmdc:mga0a205_172_c1 3300050515 Bacteria 43386
512 nmdc:mga0a205_255771_c1 3300050515 Bacteria 1630
513 nmdc:mga0a205_43164_c1 3300050515 Bacteria 4348
514 nmdc:mga0a205_53455_c1 3300050515 Bacteria 3898
515 nmdc:mga0a205_646_c1 3300050515 Bacteria 27674
516 nmdc:mga0a205_81371_c1 3300050515 Bacteria 3129
517 Ga0495601_0014121 3300053077 Bacteria 4812
518 Ga0495601_0109654 3300053077 Bacteria 1787
519 Ga0495619_0005774 3300053085 Bacteria 7843
520 Ga0500555_000738 3300053103 Bacteria 12099
521 Ga0500592_012087 3300053116 Bacteria 1380
522 Ga0500616_0000167 3300053153 Bacteria 109823
523 Ga0500645_000021 3300053730 Bacteria 133415
524 Ga0500599_008481 3300053736 Bacteria 1336
525 Ga0501084_0008305 3300054114 Bacteria 8569
526 Ga0501084_0029452 3300054114 Bacteria 4592
527 Ga0501082_0003223 3300060353 Bacteria 14224
528 Ga0501082_0109866 3300060353 Bacteria 2387
529 Ga0530510_0011389 3300061734 Bacteria 6239

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0035412 Ga0495665_0035412_1776_2657 293
2 3300035724 Ga0373933_0253838 Ga0373933_0253838_219_1118 299
3 3300037853 Ga0436364_0347559 Ga0436364_0347559_333_1232 299
4 3300049586 Ga0501070_0180591 Ga0501070_0180591_822_1721 299
5 3300048916 Ga0496113_0480121 Ga0496113_0480121_28_936 302
6 3300025972 Ga0207668_10145049 Ga0207668_101450492 322
7 3300050515 nmdc:mga0a205_172_c1 nmdc:mga0a205_172_c1_1863_2864 333
8 3300050512 nmdc:mga0n895_28663_c1 nmdc:mga0n895_28663_c1_4200_5210 336
9 3300050515 nmdc:mga0a205_81371_c1 nmdc:mga0a205_81371_c1_1032_2042 336
10 3300039450 Ga0436363_1537631 Ga0436363_1537631_664_1707 338
11 3300005331 Ga0070670_100035799 Ga0070670_1000357992 339
12 3300005336 Ga0070680_100115296 Ga0070680_1001152962 339
13 3300005518 Ga0070699_100444028 Ga0070699_1004440281 339
14 3300005577 Ga0068857_100037884 Ga0068857_1000378844 339
15 3300025925 Ga0207650_10069414 Ga0207650_100694142 339
16 3300026116 Ga0207674_10017928 Ga0207674_100179283 339
17 3300036401 Ga0373937_0001949 Ga0373937_0001949_5937_6959 339
18 3300039450 Ga0436363_0622237 Ga0436363_0622237_288_1310 339
19 3300005293 Ga0065715_10135686 Ga0065715_101356862 340
20 3300005340 Ga0070689_100030013 Ga0070689_1000300132 340
21 3300005365 Ga0070688_100188019 Ga0070688_1001880192 340
22 3300005437 Ga0070710_10008097 Ga0070710_100080973 340
23 3300005543 Ga0070672_100002598 Ga0070672_1000025988 340
24 3300005844 Ga0068862_100186042 Ga0068862_1001860422 340
25 3300006237 Ga0097621_100005339 Ga0097621_1000053393 340
26 3300006358 Ga0068871_100086372 Ga0068871_1000863722 340
27 3300006871 Ga0075434_100173984 Ga0075434_1001739841 340
28 3300007076 Ga0075435_100006980 Ga0075435_1000069802 340
29 3300013296 Ga0157374_10083973 Ga0157374_100839732 340
30 3300014325 Ga0163163_10128873 Ga0163163_101288732 340
31 3300014969 Ga0157376_10037777 Ga0157376_100377773 340
32 3300025898 Ga0207692_10015489 Ga0207692_100154893 340
33 3300025904 Ga0207647_10002036 Ga0207647_100020365 340
34 3300031090 Ga0265760_10014625 Ga0265760_100146252 340
35 3300048903 Ga0496100_0006282 Ga0496100_0006282_1158_2180 340
36 3300048903 Ga0496100_0188772 Ga0496100_0188772_227_1288 340
37 3300048904 Ga0496101_0000222 Ga0496101_0000222_1508_2530 340
38 3300048907 Ga0496104_0001478 Ga0496104_0001478_16310_17332 340
39 3300048912 Ga0496109_0006323 Ga0496109_0006323_8218_9279 340
40 3300048913 Ga0496110_0246176 Ga0496110_0246176_17_1078 340
41 3300048914 Ga0496111_0324024 Ga0496111_0324024_69_1097 340
42 3300048915 Ga0496112_0155496 Ga0496112_0155496_1091_2152 340
43 3300048916 Ga0496113_0167260 Ga0496113_0167260_18_1079 340
44 3300048917 Ga0496114_0000416 Ga0496114_0000416_24392_25414 340
45 3300049572 Ga0501036_0047506 Ga0501036_0047506_1127_2188 340
46 3300049585 Ga0501069_0029616 Ga0501069_0029616_333_1388 340
47 3300049590 Ga0501074_0020019 Ga0501074_0020019_571_1632 340
48 3300049744 Ga0501083_0011332 Ga0501083_0011332_2347_3408 340
49 3300049822 Ga0501035_0057778 Ga0501035_0057778_277_1338 340
50 3300050511 nmdc:mga08y16_49622_c1 nmdc:mga08y16_49622_c1_1703_2728 340
51 3300050512 nmdc:mga0n895_47349_c1 nmdc:mga0n895_47349_c1_2552_3574 340
52 3300050513 nmdc:mga0rr50_89900_c1 nmdc:mga0rr50_89900_c1_483_1505 340
53 3300053116 Ga0500592_012087 Ga0500592_012087_124_1221 340
54 3300006844 Ga0075428_100000108 Ga0075428_10000010835 341
55 3300006852 Ga0075433_10236375 Ga0075433_102363752 341
56 3300006871 Ga0075434_100125622 Ga0075434_1001256221 341
57 3300009094 Ga0111539_10000001 Ga0111539_10000001232 341
58 3300025933 Ga0207706_10225391 Ga0207706_102253912 341
59 3300026089 Ga0207648_10266495 Ga0207648_102664952 341
60 3300027907 Ga0207428_10000002 Ga0207428_10000002245 341
61 3300032005 Ga0307411_10276059 Ga0307411_102760592 341
62 3300048910 Ga0496107_0218165 Ga0496107_0218165_291_1319 341
63 3300049568 Ga0501031_0010042 Ga0501031_0010042_4650_5711 341
64 3300049569 Ga0501032_0038195 Ga0501032_0038195_969_2030 341
65 3300049570 Ga0501033_0072609 Ga0501033_0072609_1114_2175 341
66 3300049572 Ga0501036_0002069 Ga0501036_0002069_2430_3491 341
67 3300049573 Ga0501037_0006174 Ga0501037_0006174_2387_3448 341
68 3300049574 Ga0501038_0015045 Ga0501038_0015045_1242_2303 341
69 3300049575 Ga0501039_0011230 Ga0501039_0011230_4494_5555 341
70 3300049579 Ga0501043_0003896 Ga0501043_0003896_307_1368 341
71 3300049580 Ga0501046_0068737 Ga0501046_0068737_582_1643 341
72 3300049581 Ga0501047_0003720 Ga0501047_0003720_12994_14055 341
73 3300049582 Ga0501048_0148192 Ga0501048_0148192_509_1570 341
74 3300049583 Ga0501067_0004090 Ga0501067_0004090_2316_3377 341
75 3300049584 Ga0501068_0014774 Ga0501068_0014774_2197_3258 341
76 3300049585 Ga0501069_0009417 Ga0501069_0009417_465_1526 341
77 3300049587 Ga0501071_0074314 Ga0501071_0074314_89_1150 341
78 3300049589 Ga0501073_0002590 Ga0501073_0002590_11892_12953 341
79 3300049590 Ga0501074_0027557 Ga0501074_0027557_2396_3457 341
80 3300049741 Ga0501079_0038052 Ga0501079_0038052_2120_3181 341
81 3300049742 Ga0501080_0156288 Ga0501080_0156288_511_1572 341
82 3300049822 Ga0501035_0137770 Ga0501035_0137770_528_1589 341
83 3300049823 Ga0501044_0099869 Ga0501044_0099869_1114_2175 341
84 3300049824 Ga0501045_0127805 Ga0501045_0127805_544_1605 341
85 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_258203_259231 341
86 3300053103 Ga0500555_000738 Ga0500555_000738_5619_6674 341
87 3300053153 Ga0500616_0000167 Ga0500616_0000167_54578_55633 341
88 3300053730 Ga0500645_000021 Ga0500645_000021_10850_11905 341
89 3300053736 Ga0500599_008481 Ga0500599_008481_212_1267 341
90 3300054114 Ga0501084_0008305 Ga0501084_0008305_5318_6379 341
91 3300060353 Ga0501082_0003223 Ga0501082_0003223_2839_3900 341
92 3300005530 Ga0070679_100005990 Ga0070679_1000059907 342
93 3300005577 Ga0068857_100132802 Ga0068857_1001328022 342
94 3300025921 Ga0207652_10042033 Ga0207652_100420332 342
95 3300048915 Ga0496112_0090896 Ga0496112_0090896_1883_2935 342
96 3300005290 Ga0065712_10001052 Ga0065712_100010527 343
97 3300005293 Ga0065715_10000269 Ga0065715_1000026912 343
98 3300005330 Ga0070690_100023258 Ga0070690_1000232582 343
99 3300005331 Ga0070670_100009228 Ga0070670_1000092287 343
100 3300005334 Ga0068869_100059568 Ga0068869_1000595685 343
101 3300005335 Ga0070666_10001844 Ga0070666_100018449 343
102 3300005353 Ga0070669_100170841 Ga0070669_1001708412 343
103 3300005365 Ga0070688_100072787 Ga0070688_1000727871 343
104 3300005367 Ga0070667_100000989 Ga0070667_1000009893 343
105 3300005367 Ga0070667_100119736 Ga0070667_1001197362 343
106 3300005466 Ga0070685_10082546 Ga0070685_100825462 343
107 3300005518 Ga0070699_100008025 Ga0070699_10000802510 343
108 3300005539 Ga0068853_100397880 Ga0068853_1003978801 343
109 3300005543 Ga0070672_100139502 Ga0070672_1001395023 343
110 3300005548 Ga0070665_100059083 Ga0070665_1000590833 343
111 3300005614 Ga0068856_100006029 Ga0068856_1000060298 343
112 3300005617 Ga0068859_100000645 Ga0068859_10000064515 343
113 3300005617 Ga0068859_100179315 Ga0068859_1001793152 343
114 3300005618 Ga0068864_100023937 Ga0068864_1000239376 343
115 3300005842 Ga0068858_100021235 Ga0068858_1000212353 343
116 3300005843 Ga0068860_100010562 Ga0068860_1000105625 343
117 3300005985 Ga0081539_10000096 Ga0081539_1000009693 343
118 3300005985 Ga0081539_10002353 Ga0081539_1000235323 343
119 3300006237 Ga0097621_100045464 Ga0097621_1000454642 343
120 3300006237 Ga0097621_100077347 Ga0097621_1000773472 343
121 3300006358 Ga0068871_100059193 Ga0068871_1000591932 343
122 3300006844 Ga0075428_100098297 Ga0075428_1000982973 343
123 3300006852 Ga0075433_10000839 Ga0075433_1000083910 343
124 3300006852 Ga0075433_10130467 Ga0075433_101304672 343
125 3300006852 Ga0075433_10189122 Ga0075433_101891222 343
126 3300006871 Ga0075434_100001347 Ga0075434_1000013479 343
127 3300006871 Ga0075434_100178425 Ga0075434_1001784252 343
128 3300006881 Ga0068865_100186468 Ga0068865_1001864682 343
129 3300006931 Ga0097620_100000645 Ga0097620_10000064515 343
130 3300006931 Ga0097620_100179304 Ga0097620_1001793044 343
131 3300009094 Ga0111539_10001789 Ga0111539_1000178924 343
132 3300009094 Ga0111539_10010482 Ga0111539_100104825 343
133 3300009177 Ga0105248_10026112 Ga0105248_100261124 343
134 3300009553 Ga0105249_10107994 Ga0105249_101079942 343
135 3300013308 Ga0157375_10001332 Ga0157375_100013324 343
136 3300013308 Ga0157375_10072570 Ga0157375_100725704 343
137 3300014325 Ga0163163_10000017 Ga0163163_1000001775 343
138 3300014968 Ga0157379_10034512 Ga0157379_100345122 343
139 3300025925 Ga0207650_10027932 Ga0207650_100279326 343
140 3300025938 Ga0207704_10019970 Ga0207704_100199702 343
141 3300025940 Ga0207691_10042995 Ga0207691_100429954 343
142 3300025941 Ga0207711_10000511 Ga0207711_1000051133 343
143 3300025961 Ga0207712_10022729 Ga0207712_100227295 343
144 3300025972 Ga0207668_10278611 Ga0207668_102786112 343
145 3300025986 Ga0207658_10049176 Ga0207658_100491762 343
146 3300025986 Ga0207658_10073613 Ga0207658_100736132 343
147 3300026075 Ga0207708_10097167 Ga0207708_100971672 343
148 3300026088 Ga0207641_10110284 Ga0207641_101102842 343
149 3300026095 Ga0207676_10016426 Ga0207676_100164266 343
150 3300027907 Ga0207428_10000849 Ga0207428_1000084911 343
151 3300027907 Ga0207428_10209042 Ga0207428_102090422 343
152 3300028379 Ga0268266_10035802 Ga0268266_100358022 343
153 3300028379 Ga0268266_10143107 Ga0268266_101431074 343
154 3300028381 Ga0268264_10175418 Ga0268264_101754182 343
155 3300035086 Ga0373934_0007068 Ga0373934_0007068_749_1789 343
156 3300035695 Ga0373927_0010876 Ga0373927_0010876_2833_3873 343
157 3300035724 Ga0373933_0023125 Ga0373933_0023125_1053_2093 343
158 3300035725 Ga0373947_0000399 Ga0373947_0000399_9429_10469 343
159 3300036401 Ga0373937_0000499 Ga0373937_0000499_22013_23053 343
160 3300037068 Ga0373925_0001209 Ga0373925_0001209_10340_11380 343
161 3300044712 Ga0453684_0723447 Ga0453684_0723447_17_1057 343
162 3300045051 Ga0451576_0008042 Ga0451576_0008042_8395_9435 343
163 3300045051 Ga0451576_0298918 Ga0451576_0298918_433_1473 343
164 3300046462 Ga0495651_0026908 Ga0495651_0026908_1478_2518 343
165 3300048903 Ga0496100_0045682 Ga0496100_0045682_1726_2802 343
166 3300048905 Ga0496102_0017609 Ga0496102_0017609_1101_2177 343
167 3300048906 Ga0496103_0039199 Ga0496103_0039199_171_1247 343
168 3300048907 Ga0496104_0044478 Ga0496104_0044478_1879_2925 343
169 3300048909 Ga0496106_0000977 Ga0496106_0000977_2513_3589 343
170 3300048911 Ga0496108_0119269 Ga0496108_0119269_342_1388 343
171 3300048912 Ga0496109_0001591 Ga0496109_0001591_15098_16144 343
172 3300048913 Ga0496110_0003223 Ga0496110_0003223_9360_10406 343
173 3300048914 Ga0496111_0089134 Ga0496111_0089134_987_2033 343
174 3300048914 Ga0496111_0118267 Ga0496111_0118267_859_1935 343
175 3300048915 Ga0496112_0001633 Ga0496112_0001633_9858_10904 343
176 3300050511 nmdc:mga08y16_175386_c1 nmdc:mga08y16_175386_c1_656_1699 343
177 3300050511 nmdc:mga08y16_257149_c1 nmdc:mga08y16_257149_c1_468_1508 343
178 3300050511 nmdc:mga08y16_8329_c1 nmdc:mga08y16_8329_c1_7512_8552 343
179 3300050512 nmdc:mga0n895_265611_c1 nmdc:mga0n895_265611_c1_624_1664 343
180 3300050512 nmdc:mga0n895_477_c1 nmdc:mga0n895_477_c1_14565_15605 343
181 3300050515 nmdc:mga0a205_255771_c1 nmdc:mga0a205_255771_c1_201_1241 343
182 3300050515 nmdc:mga0a205_53455_c1 nmdc:mga0a205_53455_c1_436_1476 343
183 3300050515 nmdc:mga0a205_646_c1 nmdc:mga0a205_646_c1_22781_23821 343
184 3300053077 Ga0495601_0109654 Ga0495601_0109654_510_1550 343
185 3300003203 JGI25406J46586_10000120 JGI25406J46586_1000012025 344
186 3300005289 Ga0065704_10105622 Ga0065704_101056222 344
187 3300005290 Ga0065712_10004968 Ga0065712_100049685 344
188 3300005290 Ga0065712_10078549 Ga0065712_100785494 344
189 3300005293 Ga0065715_10094426 Ga0065715_100944261 344
190 3300005295 Ga0065707_10120897 Ga0065707_101208971 344
191 3300005328 Ga0070676_10007368 Ga0070676_100073682 344
192 3300005329 Ga0070683_100000500 Ga0070683_10000050020 344
193 3300005329 Ga0070683_100193003 Ga0070683_1001930032 344
194 3300005331 Ga0070670_100063835 Ga0070670_1000638352 344
195 3300005331 Ga0070670_100096963 Ga0070670_1000969632 344
196 3300005331 Ga0070670_100242154 Ga0070670_1002421542 344
197 3300005333 Ga0070677_10001312 Ga0070677_100013124 344
198 3300005334 Ga0068869_100030640 Ga0068869_1000306404 344
199 3300005335 Ga0070666_10028715 Ga0070666_100287152 344
200 3300005335 Ga0070666_10073997 Ga0070666_100739972 344
201 3300005340 Ga0070689_100011278 Ga0070689_1000112782 344
202 3300005340 Ga0070689_100101741 Ga0070689_1001017412 344
203 3300005343 Ga0070687_100015200 Ga0070687_1000152005 344
204 3300005347 Ga0070668_100070586 Ga0070668_1000705862 344
205 3300005347 Ga0070668_100165941 Ga0070668_1001659412 344
206 3300005353 Ga0070669_100016441 Ga0070669_1000164412 344
207 3300005353 Ga0070669_100027792 Ga0070669_1000277922 344
208 3300005353 Ga0070669_100057480 Ga0070669_1000574802 344
209 3300005354 Ga0070675_100017971 Ga0070675_1000179714 344
210 3300005354 Ga0070675_100041501 Ga0070675_1000415013 344
211 3300005354 Ga0070675_100143650 Ga0070675_1001436502 344
212 3300005355 Ga0070671_100014366 Ga0070671_1000143662 344
213 3300005355 Ga0070671_100331668 Ga0070671_1003316682 344
214 3300005356 Ga0070674_100003802 Ga0070674_1000038023 344
215 3300005356 Ga0070674_100070771 Ga0070674_1000707714 344
216 3300005364 Ga0070673_100021855 Ga0070673_1000218552 344
217 3300005364 Ga0070673_100031830 Ga0070673_1000318305 344
218 3300005365 Ga0070688_100020051 Ga0070688_1000200512 344
219 3300005366 Ga0070659_100123168 Ga0070659_1001231682 344
220 3300005367 Ga0070667_100021437 Ga0070667_1000214376 344
221 3300005367 Ga0070667_100399131 Ga0070667_1003991312 344
222 3300005438 Ga0070701_10021316 Ga0070701_100213162 344
223 3300005441 Ga0070700_100070430 Ga0070700_1000704301 344
224 3300005455 Ga0070663_100061488 Ga0070663_1000614883 344
225 3300005455 Ga0070663_100088734 Ga0070663_1000887342 344
226 3300005457 Ga0070662_100006443 Ga0070662_1000064432 344
227 3300005466 Ga0070685_10012465 Ga0070685_100124655 344
228 3300005535 Ga0070684_100001365 Ga0070684_1000013658 344
229 3300005539 Ga0068853_100228297 Ga0068853_1002282971 344
230 3300005543 Ga0070672_100023539 Ga0070672_1000235392 344
231 3300005543 Ga0070672_100032696 Ga0070672_1000326965 344
232 3300005543 Ga0070672_100190193 Ga0070672_1001901932 344
233 3300005544 Ga0070686_100015561 Ga0070686_1000155612 344
234 3300005548 Ga0070665_100030190 Ga0070665_1000301907 344
235 3300005548 Ga0070665_100054864 Ga0070665_1000548642 344
236 3300005564 Ga0070664_100008009 Ga0070664_1000080096 344
237 3300005564 Ga0070664_100015875 Ga0070664_1000158752 344
238 3300005564 Ga0070664_100016791 Ga0070664_1000167912 344
239 3300005617 Ga0068859_100206957 Ga0068859_1002069572 344
240 3300005618 Ga0068864_100016681 Ga0068864_1000166815 344
241 3300005618 Ga0068864_100227617 Ga0068864_1002276171 344
242 3300005618 Ga0068864_100231356 Ga0068864_1002313562 344
243 3300005719 Ga0068861_100011509 Ga0068861_1000115093 344
244 3300005719 Ga0068861_100028741 Ga0068861_1000287413 344
245 3300005719 Ga0068861_100298921 Ga0068861_1002989211 344
246 3300005840 Ga0068870_10027107 Ga0068870_100271074 344
247 3300005841 Ga0068863_100002061 Ga0068863_10000206114 344
248 3300005841 Ga0068863_100145040 Ga0068863_1001450402 344
249 3300005842 Ga0068858_100118421 Ga0068858_1001184212 344
250 3300005843 Ga0068860_100035124 Ga0068860_1000351242 344
251 3300005844 Ga0068862_100013690 Ga0068862_1000136905 344
252 3300005985 Ga0081539_10000024 Ga0081539_1000002430 344
253 3300006042 Ga0075368_10041328 Ga0075368_100413282 344
254 3300006195 Ga0075366_10008607 Ga0075366_100086072 344
255 3300006237 Ga0097621_100031081 Ga0097621_1000310812 344
256 3300006237 Ga0097621_100052224 Ga0097621_1000522242 344
257 3300006358 Ga0068871_100014012 Ga0068871_1000140124 344
258 3300006844 Ga0075428_100004648 Ga0075428_1000046483 344
259 3300006844 Ga0075428_100178684 Ga0075428_1001786842 344
260 3300006846 Ga0075430_100019579 Ga0075430_1000195795 344
261 3300006846 Ga0075430_100043749 Ga0075430_1000437492 344
262 3300006847 Ga0075431_100001687 Ga0075431_1000016879 344
263 3300006847 Ga0075431_100020699 Ga0075431_1000206993 344
264 3300006847 Ga0075431_100356979 Ga0075431_1003569791 344
265 3300006852 Ga0075433_10169105 Ga0075433_101691052 344
266 3300006880 Ga0075429_100014281 Ga0075429_1000142812 344
267 3300006880 Ga0075429_100143545 Ga0075429_1001435451 344
268 3300006881 Ga0068865_100158037 Ga0068865_1001580372 344
269 3300006931 Ga0097620_100053081 Ga0097620_1000530814 344
270 3300006931 Ga0097620_100206945 Ga0097620_1002069452 344
271 3300007076 Ga0075435_100051099 Ga0075435_1000510992 344
272 3300009094 Ga0111539_10002263 Ga0111539_1000226319 344
273 3300009094 Ga0111539_10002439 Ga0111539_100024398 344
274 3300009094 Ga0111539_10015398 Ga0111539_100153985 344
275 3300009094 Ga0111539_10028916 Ga0111539_100289161 344
276 3300009094 Ga0111539_10106604 Ga0111539_101066044 344
277 3300009094 Ga0111539_10150684 Ga0111539_101506843 344
278 3300009094 Ga0111539_10183879 Ga0111539_101838792 344
279 3300009094 Ga0111539_10258764 Ga0111539_102587642 344
280 3300009098 Ga0105245_10153449 Ga0105245_101534493 344
281 3300009098 Ga0105245_10336731 Ga0105245_103367311 344
282 3300009147 Ga0114129_10000174 Ga0114129_1000017461 344
283 3300009147 Ga0114129_10003221 Ga0114129_1000322112 344
284 3300009147 Ga0114129_10025369 Ga0114129_100253694 344
285 3300009147 Ga0114129_10030336 Ga0114129_100303367 344
286 3300009177 Ga0105248_10021539 Ga0105248_100215396 344
287 3300009177 Ga0105248_10061095 Ga0105248_100610953 344
288 3300009177 Ga0105248_10078331 Ga0105248_100783316 344
289 3300009177 Ga0105248_10779426 Ga0105248_107794261 344
290 3300009545 Ga0105237_10426864 Ga0105237_104268641 344
291 3300009553 Ga0105249_10001517 Ga0105249_1000151716 344
292 3300011119 Ga0105246_10025235 Ga0105246_100252352 344
293 3300013102 Ga0157371_10145906 Ga0157371_101459062 344
294 3300013296 Ga0157374_10100314 Ga0157374_101003142 344
295 3300013296 Ga0157374_10295934 Ga0157374_102959342 344
296 3300013297 Ga0157378_10265204 Ga0157378_102652042 344
297 3300013306 Ga0163162_10068321 Ga0163162_100683217 344
298 3300013308 Ga0157375_10046551 Ga0157375_100465513 344
299 3300013308 Ga0157375_10241713 Ga0157375_102417132 344
300 3300014325 Ga0163163_10378098 Ga0163163_103780981 344
301 3300014326 Ga0157380_10017590 Ga0157380_100175904 344
302 3300014326 Ga0157380_10417945 Ga0157380_104179451 344
303 3300014969 Ga0157376_10010121 Ga0157376_100101212 344
304 3300017792 Ga0163161_10029497 Ga0163161_100294972 344
305 3300025315 Ga0207697_10010226 Ga0207697_100102262 344
306 3300025315 Ga0207697_10100831 Ga0207697_101008311 344
307 3300025893 Ga0207682_10003116 Ga0207682_100031169 344
308 3300025893 Ga0207682_10003998 Ga0207682_100039983 344
309 3300025901 Ga0207688_10006597 Ga0207688_100065975 344
310 3300025901 Ga0207688_10010284 Ga0207688_100102842 344
311 3300025907 Ga0207645_10013270 Ga0207645_100132705 344
312 3300025907 Ga0207645_10020774 Ga0207645_100207742 344
313 3300025908 Ga0207643_10000719 Ga0207643_1000071914 344
314 3300025908 Ga0207643_10063566 Ga0207643_100635662 344
315 3300025918 Ga0207662_10013224 Ga0207662_100132242 344
316 3300025923 Ga0207681_10329861 Ga0207681_103298611 344
317 3300025925 Ga0207650_10011577 Ga0207650_100115773 344
318 3300025925 Ga0207650_10019377 Ga0207650_100193772 344
319 3300025925 Ga0207650_10311843 Ga0207650_103118431 344
320 3300025926 Ga0207659_10023305 Ga0207659_100233053 344
321 3300025926 Ga0207659_10033346 Ga0207659_100333463 344
322 3300025933 Ga0207706_10054786 Ga0207706_100547863 344
323 3300025936 Ga0207670_10043647 Ga0207670_100436474 344
324 3300025937 Ga0207669_10005017 Ga0207669_100050171 344
325 3300025940 Ga0207691_10038899 Ga0207691_100388991 344
326 3300025940 Ga0207691_10042996 Ga0207691_100429962 344
327 3300025940 Ga0207691_10046064 Ga0207691_100460645 344
328 3300025940 Ga0207691_10059785 Ga0207691_100597851 344
329 3300025940 Ga0207691_10125234 Ga0207691_101252342 344
330 3300025942 Ga0207689_10034173 Ga0207689_100341732 344
331 3300025942 Ga0207689_10055184 Ga0207689_100551842 344
332 3300025944 Ga0207661_10005594 Ga0207661_100055942 344
333 3300025945 Ga0207679_10007747 Ga0207679_100077476 344
334 3300025960 Ga0207651_10007460 Ga0207651_100074606 344
335 3300025960 Ga0207651_10034440 Ga0207651_100344402 344
336 3300025961 Ga0207712_10301351 Ga0207712_103013512 344
337 3300025986 Ga0207658_10028612 Ga0207658_100286123 344
338 3300026067 Ga0207678_10087667 Ga0207678_100876672 344
339 3300026067 Ga0207678_10181110 Ga0207678_101811102 344
340 3300026075 Ga0207708_10023376 Ga0207708_100233763 344
341 3300026088 Ga0207641_10285838 Ga0207641_102858382 344
342 3300026095 Ga0207676_10045247 Ga0207676_100452474 344
343 3300026095 Ga0207676_10045901 Ga0207676_100459012 344
344 3300026116 Ga0207674_10423926 Ga0207674_104239262 344
345 3300026118 Ga0207675_100012281 Ga0207675_1000122812 344
346 3300026118 Ga0207675_100084735 Ga0207675_1000847352 344
347 3300026121 Ga0207683_10012400 Ga0207683_100124003 344
348 3300027907 Ga0207428_10004387 Ga0207428_1000438711 344
349 3300027907 Ga0207428_10010923 Ga0207428_100109233 344
350 3300027907 Ga0207428_10011180 Ga0207428_100111803 344
351 3300027907 Ga0207428_10025773 Ga0207428_100257733 344
352 3300028379 Ga0268266_10140740 Ga0268266_101407402 344
353 3300028380 Ga0268265_10306804 Ga0268265_103068041 344
354 3300028666 Ga0265336_10001878 Ga0265336_100018782 344
355 3300031344 Ga0265316_10001007 Ga0265316_1000100717 344
356 3300031731 Ga0307405_10204809 Ga0307405_102048092 344
357 3300035112 Ga0373932_0050832 Ga0373932_0050832_71_1123 344
358 3300042436 Ga0439435_0030075 Ga0439435_0030075_300_1352 344
359 3300042439 Ga0439464_0036666 Ga0439464_0036666_287_1330 344
360 3300042439 Ga0439464_0043567 Ga0439464_0043567_101_1147 344
361 3300045051 Ga0451576_0025872 Ga0451576_0025872_343_1395 344
362 3300046460 Ga0495638_0007866 Ga0495638_0007866_1193_2236 344
363 3300046678 Ga0495599_0096900 Ga0495599_0096900_413_1474 344
364 3300046689 Ga0495613_0166662 Ga0495613_0166662_61_1122 344
365 3300047471 Ga0495684_0057472 Ga0495684_0057472_422_1465 344
366 3300047471 Ga0495684_0105529 Ga0495684_0105529_249_1310 344
367 3300048912 Ga0496109_0002883 Ga0496109_0002883_7510_8553 344
368 3300048915 Ga0496112_0000913 Ga0496112_0000913_12751_13794 344
369 3300049570 Ga0501033_0119413 Ga0501033_0119413_330_1376 344
370 3300049575 Ga0501039_0082901 Ga0501039_0082901_991_2037 344
371 3300049576 Ga0501040_0041322 Ga0501040_0041322_1086_2171 344
372 3300049576 Ga0501040_0052315 Ga0501040_0052315_1613_2659 344
373 3300049577 Ga0501041_0030537 Ga0501041_0030537_757_1803 344
374 3300049578 Ga0501042_0009454 Ga0501042_0009454_2591_3637 344
375 3300049578 Ga0501042_0183726 Ga0501042_0183726_343_1386 344
376 3300049580 Ga0501046_0060979 Ga0501046_0060979_412_1458 344
377 3300049586 Ga0501070_0222497 Ga0501070_0222497_299_1342 344
378 3300049587 Ga0501071_0159208 Ga0501071_0159208_530_1573 344
379 3300049589 Ga0501073_0101130 Ga0501073_0101130_435_1478 344
380 3300049590 Ga0501074_0299895 Ga0501074_0299895_15_1100 344
381 3300049591 Ga0501075_0037535 Ga0501075_0037535_2554_3600 344
382 3300049591 Ga0501075_0068544 Ga0501075_0068544_1451_2536 344
383 3300049591 Ga0501075_0179191 Ga0501075_0179191_51_1097 344
384 3300049742 Ga0501080_0060984 Ga0501080_0060984_1168_2253 344
385 3300050491 nmdc:mga00v17_134312_c1 nmdc:mga00v17_134312_c1_401_1441 344
386 3300050494 nmdc:mga06z11_77406_c1 nmdc:mga06z11_77406_c1_277_1317 344
387 3300050496 nmdc:mga07m45_89282_c1 nmdc:mga07m45_89282_c1_594_1634 344
388 3300050507 nmdc:mga05p37_124034_c1 nmdc:mga05p37_124034_c1_2024_3064 344
389 3300050507 nmdc:mga05p37_204_c1 nmdc:mga05p37_204_c1_9671_10714 344
390 3300050507 nmdc:mga05p37_31808_c1 nmdc:mga05p37_31808_c1_2223_3275 344
391 3300050507 nmdc:mga05p37_7226_c1 nmdc:mga05p37_7226_c1_5189_6235 344
392 3300050508 nmdc:mga09592_117816_c1 nmdc:mga09592_117816_c1_1059_2099 344
393 3300050508 nmdc:mga09592_14652_c1 nmdc:mga09592_14652_c1_4558_5610 344
394 3300050509 nmdc:mga0qj67_1031_c1 nmdc:mga0qj67_1031_c1_15663_16715 344
395 3300050509 nmdc:mga0qj67_126273_c1 nmdc:mga0qj67_126273_c1_840_1886 344
396 3300050509 nmdc:mga0qj67_16036_c1 nmdc:mga0qj67_16036_c1_804_1850 344
397 3300050509 nmdc:mga0qj67_31718_c1 nmdc:mga0qj67_31718_c1_459_1505 344
398 3300050509 nmdc:mga0qj67_3991_c1 nmdc:mga0qj67_3991_c1_2259_3299 344
399 3300050510 nmdc:mga06r32_133540_c1 nmdc:mga06r32_133540_c1_113_1153 344
400 3300050510 nmdc:mga06r32_2396_c1 nmdc:mga06r32_2396_c1_5814_6866 344
401 3300050510 nmdc:mga06r32_38284_c1 nmdc:mga06r32_38284_c1_1421_2467 344
402 3300050510 nmdc:mga06r32_74634_c1 nmdc:mga06r32_74634_c1_79_1125 344
403 3300050510 nmdc:mga06r32_95014_c1 nmdc:mga06r32_95014_c1_1664_2710 344
404 3300050511 nmdc:mga08y16_15221_c1 nmdc:mga08y16_15221_c1_4132_5175 344
405 3300050511 nmdc:mga08y16_66229_c1 nmdc:mga08y16_66229_c1_1971_3023 344
406 3300050513 nmdc:mga0rr50_152554_c1 nmdc:mga0rr50_152554_c1_567_1619 344
407 3300050515 nmdc:mga0a205_103159_c1 nmdc:mga0a205_103159_c1_539_1582 344
408 3300050515 nmdc:mga0a205_1627_c1 nmdc:mga0a205_1627_c1_7247_8299 344
409 3300054114 Ga0501084_0029452 Ga0501084_0029452_1993_3039 344
410 3300060353 Ga0501082_0109866 Ga0501082_0109866_1320_2366 344
411 3300061734 Ga0530510_0011389 Ga0530510_0011389_4929_5975 344
412 3300000546 LJNas_1000739 LJNas_10007392 345
413 3300005327 Ga0070658_10159524 Ga0070658_101595242 345
414 3300005328 Ga0070676_10176049 Ga0070676_101760491 345
415 3300005337 Ga0070682_100296611 Ga0070682_1002966111 345
416 3300005339 Ga0070660_100187722 Ga0070660_1001877222 345
417 3300005354 Ga0070675_100179372 Ga0070675_1001793722 345
418 3300005364 Ga0070673_100005375 Ga0070673_1000053757 345
419 3300005364 Ga0070673_100331249 Ga0070673_1003312492 345
420 3300005436 Ga0070713_100008567 Ga0070713_1000085677 345
421 3300005444 Ga0070694_100011589 Ga0070694_1000115892 345
422 3300005456 Ga0070678_100144994 Ga0070678_1001449942 345
423 3300005458 Ga0070681_10073144 Ga0070681_100731442 345
424 3300005543 Ga0070672_100014063 Ga0070672_1000140633 345
425 3300005543 Ga0070672_100048247 Ga0070672_1000482472 345
426 3300005545 Ga0070695_100188016 Ga0070695_1001880162 345
427 3300005546 Ga0070696_100081432 Ga0070696_1000814322 345
428 3300005548 Ga0070665_100539407 Ga0070665_1005394071 345
429 3300005564 Ga0070664_100055676 Ga0070664_1000556762 345
430 3300005617 Ga0068859_100084288 Ga0068859_1000842882 345
431 3300005618 Ga0068864_100005866 Ga0068864_10000586611 345
432 3300005719 Ga0068861_100011576 Ga0068861_1000115763 345
433 3300005841 Ga0068863_100002762 Ga0068863_10000276211 345
434 3300005841 Ga0068863_100276342 Ga0068863_1002763422 345
435 3300005841 Ga0068863_100492124 Ga0068863_1004921241 345
436 3300005844 Ga0068862_100205979 Ga0068862_1002059792 345
437 3300006358 Ga0068871_100133883 Ga0068871_1001338832 345
438 3300006852 Ga0075433_10020584 Ga0075433_100205843 345
439 3300006914 Ga0075436_100000671 Ga0075436_1000006716 345
440 3300006931 Ga0097620_100084282 Ga0097620_1000842823 345
441 3300009093 Ga0105240_10120425 Ga0105240_101204254 345
442 3300009094 Ga0111539_10559582 Ga0111539_105595821 345
443 3300009147 Ga0114129_10007540 Ga0114129_100075407 345
444 3300009176 Ga0105242_10194146 Ga0105242_101941462 345
445 3300009177 Ga0105248_10082480 Ga0105248_100824804 345
446 3300009553 Ga0105249_10199642 Ga0105249_101996421 345
447 3300013104 Ga0157370_10137425 Ga0157370_101374253 345
448 3300013296 Ga0157374_10043570 Ga0157374_100435702 345
449 3300013297 Ga0157378_10025354 Ga0157378_100253543 345
450 3300013306 Ga0163162_10031787 Ga0163162_100317875 345
451 3300013308 Ga0157375_10024925 Ga0157375_100249252 345
452 3300013308 Ga0157375_10112204 Ga0157375_101122044 345
453 3300014326 Ga0157380_10076073 Ga0157380_100760732 345
454 3300014745 Ga0157377_10125469 Ga0157377_101254692 345
455 3300022467 Ga0224712_10040484 Ga0224712_100404841 345
456 3300025907 Ga0207645_10106312 Ga0207645_101063122 345
457 3300025908 Ga0207643_10006147 Ga0207643_100061474 345
458 3300025912 Ga0207707_10158044 Ga0207707_101580443 345
459 3300025913 Ga0207695_10389317 Ga0207695_103893172 345
460 3300025919 Ga0207657_10160399 Ga0207657_101603992 345
461 3300025926 Ga0207659_10004886 Ga0207659_1000488610 345
462 3300025928 Ga0207700_10220589 Ga0207700_102205891 345
463 3300025929 Ga0207664_10025948 Ga0207664_100259482 345
464 3300025937 Ga0207669_10143478 Ga0207669_101434782 345
465 3300025940 Ga0207691_10002949 Ga0207691_100029491 345
466 3300025942 Ga0207689_10011973 Ga0207689_100119737 345
467 3300025942 Ga0207689_10075399 Ga0207689_100753992 345
468 3300025972 Ga0207668_10197196 Ga0207668_101971962 345
469 3300026089 Ga0207648_10017784 Ga0207648_100177844 345
470 3300026089 Ga0207648_10081129 Ga0207648_100811292 345
471 3300026118 Ga0207675_100311116 Ga0207675_1003111162 345
472 3300026121 Ga0207683_10230455 Ga0207683_102304551 345
473 3300026142 Ga0207698_10136072 Ga0207698_101360722 345
474 3300028380 Ga0268265_10011891 Ga0268265_100118911 345
475 3300028380 Ga0268265_10062247 Ga0268265_100622472 345
476 3300028381 Ga0268264_10039306 Ga0268264_100393061 345
477 3300031548 Ga0307408_100270180 Ga0307408_1002701802 345
478 3300031852 Ga0307410_10158330 Ga0307410_101583301 345
479 3300031852 Ga0307410_10191713 Ga0307410_101917132 345
480 3300036401 Ga0373937_0087881 Ga0373937_0087881_196_1239 345
481 3300039450 Ga0436363_0210429 Ga0436363_0210429_313_1368 345
482 3300042131 Ga0450894_001200 Ga0450894_001200_1420_2472 345
483 3300042184 Ga0450908_010797 Ga0450908_010797_445_1497 345
484 3300044712 Ga0453684_0084396 Ga0453684_0084396_748_1791 345
485 3300045051 Ga0451576_0022914 Ga0451576_0022914_169_1212 345
486 3300046459 Ga0495629_0105033 Ga0495629_0105033_390_1433 345
487 3300046463 Ga0495653_0019761 Ga0495653_0019761_778_1818 345
488 3300046678 Ga0495599_0038251 Ga0495599_0038251_817_1869 345
489 3300046681 Ga0495647_0003002 Ga0495647_0003002_3221_4282 345
490 3300046683 Ga0495658_0023673 Ga0495658_0023673_228_1271 345
491 3300046689 Ga0495613_0099408 Ga0495613_0099408_314_1357 345
492 3300047322 Ga0495680_0130878 Ga0495680_0130878_203_1246 345
493 3300047471 Ga0495684_0032654 Ga0495684_0032654_2785_3846 345
494 3300047471 Ga0495684_0035673 Ga0495684_0035673_1707_2759 345
495 3300048905 Ga0496102_0106816 Ga0496102_0106816_924_1970 345
496 3300048907 Ga0496104_0016812 Ga0496104_0016812_3469_4521 345
497 3300048908 Ga0496105_0016285 Ga0496105_0016285_1648_2700 345
498 3300048908 Ga0496105_0246966 Ga0496105_0246966_63_1115 345
499 3300048913 Ga0496110_0189705 Ga0496110_0189705_16_1059 345
500 3300048917 Ga0496114_0001016 Ga0496114_0001016_1691_2743 345
501 3300048917 Ga0496114_0039519 Ga0496114_0039519_1706_2758 345
502 3300048918 Ga0496115_0020221 Ga0496115_0020221_1975_3027 345
503 3300049571 Ga0501034_0009195 Ga0501034_0009195_655_1695 345
504 3300049770 Ga0501273_006719 Ga0501273_006719_164_1213 345
505 3300050507 nmdc:mga05p37_21801_c1 nmdc:mga05p37_21801_c1_967_2010 345
506 3300050512 nmdc:mga0n895_75379_c1 nmdc:mga0n895_75379_c1_2018_3061 345
507 3300050514 nmdc:mga08x19_31958_c1 nmdc:mga08x19_31958_c1_2061_3101 345
508 3300050514 nmdc:mga08x19_8005_c1 nmdc:mga08x19_8005_c1_950_1990 345
509 3300050515 nmdc:mga0a205_43164_c1 nmdc:mga0a205_43164_c1_972_2015 345
510 3300053077 Ga0495601_0014121 Ga0495601_0014121_2486_3538 345
511 3300053085 Ga0495619_0005774 Ga0495619_0005774_2292_3335 345
512 3300000546 LJNas_1000423 LJNas_10004236 346
513 3300005530 Ga0070679_100280651 Ga0070679_1002806512 346
514 3300005563 Ga0068855_100209254 Ga0068855_1002092542 346
515 3300006871 Ga0075434_100071301 Ga0075434_1000713012 346
516 3300006914 Ga0075436_100244931 Ga0075436_1002449312 346
517 3300009147 Ga0114129_10320019 Ga0114129_103200192 346
518 3300013105 Ga0157369_10190988 Ga0157369_101909881 346
519 3300013306 Ga0163162_10298596 Ga0163162_102985962 346
520 3300025917 Ga0207660_10143056 Ga0207660_101430561 346
521 3300025949 Ga0207667_10195119 Ga0207667_101951194 346
522 3300026067 Ga0207678_10194996 Ga0207678_101949962 346
523 3300037471 Ga0395905_0068804 Ga0395905_0068804_2063_3109 346
524 3300037471 Ga0395905_0093407 Ga0395905_0093407_1236_2282 346
525 3300039450 Ga0436363_0869569 Ga0436363_0869569_182_1228 346
526 3300044673 Ga0453683_0135390 Ga0453683_0135390_54_1097 346
527 3300044694 Ga0466963_0067333 Ga0466963_0067333_879_1934 346
528 3300045051 Ga0451576_0123792 Ga0451576_0123792_1361_2404 346
529 3300046543 Ga0495645_0100539 Ga0495645_0100539_898_1953 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

78

227

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cin-assembly3.cif.gz_F crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica 0.8236 53 210
6cio-assembly3.cif.gz_E pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound 0.822 53 210
6cip-assembly2.cif.gz_C pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound 0.8201 53 210
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.813 18 341
6cio-assembly3.cif.gz_F pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound 0.8005 53 210
ID Description Score Start End Superfamily
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8872 94 218 3.40.50.970
af_Q57714_86_295_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8327 99 210 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8277 88 231 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8184 87 236 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7977 87 236 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A3D0UTH0-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9302 80 211 GO:0016625
GO:0030976
AF-A0A0F8Y5H2-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9193 7 199 GO:0016625
GO:0030976
AF-A0A7C3GBX4-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9163 7 209 GO:0016625
GO:0030976
GO:0044281
AF-A0A535RG64-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9121 10 193 GO:0016625
GO:0030976
AF-A0A1Z8VLM2-F1-model_v4 2-oxoglutarate ferredoxin oxidoreductase subunit beta 0.9046 7 181 GO:0016625
GO:0030976
GO:0044281

Feature Viewer

pLDDT pTM Quality
81.85 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map