F459801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 247 | 529 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10150684|Ga0111539_101506843 |
| Length | 364 |
| Sequence | VKRGVNPRVEEKQGMSTPTQPAPAPGKRLNRIGLEPIAYRGSKTTLCAGCGHNAITERIIDSFWELGISPEQVLKLSGIGCSSKSPAYFLSQSHGFNSVHGRMPSVATGAVVANRKMIAIGVSGDGDTGAIGIGQFVHLMRRNLPMVYIIEDNGCYGLTKGQFSPTADLGSKLKTGVINDLPPIDTCALAIELGASFVARSFSGDPKQLKAILKAALSHRGTAMIDVLSPCVTFNDHDGSTKSYSYAKDHEEPLSDVSFVPFFEDITIDYDPGTSTTVSLHDGSRIVLTKMTEDYNPTDRIRSLTLLRETARRNEFATGILYVEPDKPDFIDMLGLVDEPLAHLDESRTRPGKAALDEIMESFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 161 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 162 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 163 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 164 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 165 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 166 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 167 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 191 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 192 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 193 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 196 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 242 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 243 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 244 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 245 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.62 |
| Metatranscriptomes | 0.38 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.89 |
| Nodule | 0 |
| Rhizoplane | 6.43 |
| Rhizosphere | 90.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000423 | 3300000546 | Bacteria | 7491 |
| 2 | LJNas_1000739 | 3300000546 | Bacteria | 5456 |
| 3 | JGI25406J46586_10000120 | 3300003203 | Bacteria | 34396 |
| 4 | Ga0065704_10105622 | 3300005289 | Bacteria | 2090 |
| 5 | Ga0065712_10001052 | 3300005290 | Bacteria | 13561 |
| 6 | Ga0065712_10004968 | 3300005290 | Bacteria | 5409 |
| 7 | Ga0065712_10078549 | 3300005290 | Bacteria | 3331 |
| 8 | Ga0065715_10000269 | 3300005293 | Bacteria | 20304 |
| 9 | Ga0065715_10094426 | 3300005293 | Bacteria | 4344 |
| 10 | Ga0065715_10135686 | 3300005293 | Bacteria | 1934 |
| 11 | Ga0065707_10120897 | 3300005295 | Bacteria | 2112 |
| 12 | Ga0070658_10159524 | 3300005327 | Bacteria | 1892 |
| 13 | Ga0070676_10007368 | 3300005328 | Bacteria | 5903 |
| 14 | Ga0070676_10176049 | 3300005328 | Bacteria | 1387 |
| 15 | Ga0070683_100000500 | 3300005329 | Bacteria | 27695 |
| 16 | Ga0070683_100193003 | 3300005329 | Bacteria | 1934 |
| 17 | Ga0070690_100023258 | 3300005330 | Bacteria | 3800 |
| 18 | Ga0070670_100009228 | 3300005331 | Bacteria | 8427 |
| 19 | Ga0070670_100035799 | 3300005331 | Bacteria | 4274 |
| 20 | Ga0070670_100063835 | 3300005331 | Bacteria | 3160 |
| 21 | Ga0070670_100096963 | 3300005331 | Bacteria | 2536 |
| 22 | Ga0070670_100242154 | 3300005331 | Bacteria | 1570 |
| 23 | Ga0070677_10001312 | 3300005333 | Bacteria | 7947 |
| 24 | Ga0068869_100030640 | 3300005334 | Bacteria | 3778 |
| 25 | Ga0068869_100059568 | 3300005334 | Bacteria | 2796 |
| 26 | Ga0070666_10001844 | 3300005335 | Bacteria | 12917 |
| 27 | Ga0070666_10028715 | 3300005335 | Bacteria | 3652 |
| 28 | Ga0070666_10073997 | 3300005335 | Bacteria | 2321 |
| 29 | Ga0070680_100115296 | 3300005336 | Bacteria | 2239 |
| 30 | Ga0070682_100296611 | 3300005337 | Bacteria | 1184 |
| 31 | Ga0070660_100187722 | 3300005339 | Bacteria | 1674 |
| 32 | Ga0070689_100011278 | 3300005340 | Bacteria | 6398 |
| 33 | Ga0070689_100030013 | 3300005340 | Bacteria | 4123 |
| 34 | Ga0070689_100101741 | 3300005340 | Bacteria | 2275 |
| 35 | Ga0070687_100015200 | 3300005343 | Bacteria | 3473 |
| 36 | Ga0070668_100070586 | 3300005347 | Bacteria | 2720 |
| 37 | Ga0070668_100165941 | 3300005347 | Bacteria | 1794 |
| 38 | Ga0070669_100016441 | 3300005353 | Bacteria | 5278 |
| 39 | Ga0070669_100027792 | 3300005353 | Bacteria | 4071 |
| 40 | Ga0070669_100057480 | 3300005353 | Bacteria | 2854 |
| 41 | Ga0070669_100170841 | 3300005353 | Bacteria | 1695 |
| 42 | Ga0070675_100017971 | 3300005354 | Bacteria | 5627 |
| 43 | Ga0070675_100041501 | 3300005354 | Bacteria | 3758 |
| 44 | Ga0070675_100143650 | 3300005354 | Bacteria | 2041 |
| 45 | Ga0070675_100179372 | 3300005354 | Bacteria | 1831 |
| 46 | Ga0070671_100014366 | 3300005355 | Bacteria | 6396 |
| 47 | Ga0070671_100331668 | 3300005355 | Bacteria | 1297 |
| 48 | Ga0070674_100003802 | 3300005356 | Bacteria | 8533 |
| 49 | Ga0070674_100070771 | 3300005356 | Bacteria | 2465 |
| 50 | Ga0070673_100005375 | 3300005364 | Bacteria | 8187 |
| 51 | Ga0070673_100021855 | 3300005364 | Bacteria | 4648 |
| 52 | Ga0070673_100031830 | 3300005364 | Bacteria | 3963 |
| 53 | Ga0070673_100331249 | 3300005364 | Bacteria | 1347 |
| 54 | Ga0070688_100020051 | 3300005365 | Bacteria | 3882 |
| 55 | Ga0070688_100072787 | 3300005365 | Bacteria | 2203 |
| 56 | Ga0070688_100188019 | 3300005365 | Bacteria | 1437 |
| 57 | Ga0070659_100123168 | 3300005366 | Bacteria | 2102 |
| 58 | Ga0070667_100000989 | 3300005367 | Bacteria | 26078 |
| 59 | Ga0070667_100021437 | 3300005367 | Bacteria | 5365 |
| 60 | Ga0070667_100119736 | 3300005367 | Bacteria | 2289 |
| 61 | Ga0070667_100399131 | 3300005367 | Bacteria | 1251 |
| 62 | Ga0070713_100008567 | 3300005436 | Bacteria | 7260 |
| 63 | Ga0070710_10008097 | 3300005437 | Bacteria | 5111 |
| 64 | Ga0070701_10021316 | 3300005438 | Bacteria | 3090 |
| 65 | Ga0070700_100070430 | 3300005441 | Bacteria | 2230 |
| 66 | Ga0070694_100011589 | 3300005444 | Bacteria | 5460 |
| 67 | Ga0070663_100061488 | 3300005455 | Bacteria | 2705 |
| 68 | Ga0070663_100088734 | 3300005455 | Bacteria | 2287 |
| 69 | Ga0070678_100144994 | 3300005456 | Bacteria | 1905 |
| 70 | Ga0070662_100006443 | 3300005457 | Bacteria | 7565 |
| 71 | Ga0070681_10073144 | 3300005458 | Bacteria | 3390 |
| 72 | Ga0070685_10012465 | 3300005466 | Bacteria | 4467 |
| 73 | Ga0070685_10082546 | 3300005466 | Bacteria | 1929 |
| 74 | Ga0070699_100008025 | 3300005518 | Bacteria | 9167 |
| 75 | Ga0070699_100444028 | 3300005518 | Bacteria | 1176 |
| 76 | Ga0070679_100005990 | 3300005530 | Bacteria | 11304 |
| 77 | Ga0070679_100280651 | 3300005530 | Bacteria | 1618 |
| 78 | Ga0070684_100001365 | 3300005535 | Bacteria | 17516 |
| 79 | Ga0068853_100228297 | 3300005539 | Bacteria | 1702 |
| 80 | Ga0068853_100397880 | 3300005539 | Bacteria | 1289 |
| 81 | Ga0070672_100002598 | 3300005543 | Bacteria | 11535 |
| 82 | Ga0070672_100014063 | 3300005543 | Bacteria | 5663 |
| 83 | Ga0070672_100023539 | 3300005543 | Bacteria | 4542 |
| 84 | Ga0070672_100032696 | 3300005543 | Bacteria | 3929 |
| 85 | Ga0070672_100048247 | 3300005543 | Bacteria | 3308 |
| 86 | Ga0070672_100139502 | 3300005543 | Bacteria | 1998 |
| 87 | Ga0070672_100190193 | 3300005543 | Bacteria | 1713 |
| 88 | Ga0070686_100015561 | 3300005544 | Bacteria | 4409 |
| 89 | Ga0070695_100188016 | 3300005545 | Bacteria | 1468 |
| 90 | Ga0070696_100081432 | 3300005546 | Bacteria | 2294 |
| 91 | Ga0070665_100030190 | 3300005548 | Bacteria | 5455 |
| 92 | Ga0070665_100054864 | 3300005548 | Bacteria | 3996 |
| 93 | Ga0070665_100059083 | 3300005548 | Bacteria | 3844 |
| 94 | Ga0070665_100539407 | 3300005548 | Bacteria | 1178 |
| 95 | Ga0068855_100209254 | 3300005563 | Bacteria | 2193 |
| 96 | Ga0070664_100008009 | 3300005564 | Bacteria | 8537 |
| 97 | Ga0070664_100015875 | 3300005564 | Bacteria | 6166 |
| 98 | Ga0070664_100016791 | 3300005564 | Bacteria | 6008 |
| 99 | Ga0070664_100055676 | 3300005564 | Bacteria | 3359 |
| 100 | Ga0068857_100037884 | 3300005577 | Bacteria | 4272 |
| 101 | Ga0068857_100132802 | 3300005577 | Bacteria | 2246 |
| 102 | Ga0068856_100006029 | 3300005614 | Bacteria | 11923 |
| 103 | Ga0068859_100000645 | 3300005617 | Bacteria | 34867 |
| 104 | Ga0068859_100084288 | 3300005617 | Bacteria | 3223 |
| 105 | Ga0068859_100179315 | 3300005617 | Bacteria | 2201 |
| 106 | Ga0068859_100206957 | 3300005617 | Bacteria | 2047 |
| 107 | Ga0068864_100005866 | 3300005618 | Bacteria | 10062 |
| 108 | Ga0068864_100016681 | 3300005618 | Bacteria | 6120 |
| 109 | Ga0068864_100023937 | 3300005618 | Bacteria | 5132 |
| 110 | Ga0068864_100227617 | 3300005618 | Bacteria | 1723 |
| 111 | Ga0068864_100231356 | 3300005618 | Bacteria | 1709 |
| 112 | Ga0068861_100011509 | 3300005719 | Bacteria | 6154 |
| 113 | Ga0068861_100011576 | 3300005719 | Bacteria | 6137 |
| 114 | Ga0068861_100028741 | 3300005719 | Bacteria | 4059 |
| 115 | Ga0068861_100298921 | 3300005719 | Bacteria | 1393 |
| 116 | Ga0068870_10027107 | 3300005840 | Bacteria | 2863 |
| 117 | Ga0068863_100002061 | 3300005841 | Bacteria | 19922 |
| 118 | Ga0068863_100002762 | 3300005841 | Bacteria | 17386 |
| 119 | Ga0068863_100145040 | 3300005841 | Bacteria | 2270 |
| 120 | Ga0068863_100276342 | 3300005841 | Bacteria | 1627 |
| 121 | Ga0068863_100492124 | 3300005841 | Bacteria | 1207 |
| 122 | Ga0068858_100021235 | 3300005842 | Bacteria | 6064 |
| 123 | Ga0068858_100118421 | 3300005842 | Bacteria | 2476 |
| 124 | Ga0068860_100010562 | 3300005843 | Bacteria | 9123 |
| 125 | Ga0068860_100035124 | 3300005843 | Bacteria | 4810 |
| 126 | Ga0068862_100013690 | 3300005844 | Bacteria | 6718 |
| 127 | Ga0068862_100186042 | 3300005844 | Bacteria | 1866 |
| 128 | Ga0068862_100205979 | 3300005844 | Bacteria | 1775 |
| 129 | Ga0081539_10000024 | 3300005985 | Bacteria | 354702 |
| 130 | Ga0081539_10000096 | 3300005985 | Bacteria | 204059 |
| 131 | Ga0081539_10002353 | 3300005985 | Bacteria | 27164 |
| 132 | Ga0075368_10041328 | 3300006042 | Bacteria | 1811 |
| 133 | Ga0075366_10008607 | 3300006195 | Bacteria | 5682 |
| 134 | Ga0097621_100005339 | 3300006237 | Bacteria | 9047 |
| 135 | Ga0097621_100031081 | 3300006237 | Bacteria | 4234 |
| 136 | Ga0097621_100045464 | 3300006237 | Bacteria | 3547 |
| 137 | Ga0097621_100052224 | 3300006237 | Bacteria | 3330 |
| 138 | Ga0097621_100077347 | 3300006237 | Bacteria | 2762 |
| 139 | Ga0068871_100014012 | 3300006358 | Bacteria | 5966 |
| 140 | Ga0068871_100059193 | 3300006358 | Bacteria | 3120 |
| 141 | Ga0068871_100086372 | 3300006358 | Bacteria | 2606 |
| 142 | Ga0068871_100133883 | 3300006358 | Bacteria | 2103 |
| 143 | Ga0075428_100000108 | 3300006844 | Bacteria | 70319 |
| 144 | Ga0075428_100004648 | 3300006844 | Bacteria | 15196 |
| 145 | Ga0075428_100098297 | 3300006844 | Bacteria | 3191 |
| 146 | Ga0075428_100178684 | 3300006844 | Bacteria | 2298 |
| 147 | Ga0075430_100019579 | 3300006846 | Bacteria | 5758 |
| 148 | Ga0075430_100043749 | 3300006846 | Bacteria | 3786 |
| 149 | Ga0075431_100001687 | 3300006847 | Bacteria | 20728 |
| 150 | Ga0075431_100020699 | 3300006847 | Bacteria | 6722 |
| 151 | Ga0075431_100356979 | 3300006847 | Bacteria | 1469 |
| 152 | Ga0075433_10000839 | 3300006852 | Bacteria | 21522 |
| 153 | Ga0075433_10020584 | 3300006852 | Bacteria | 5521 |
| 154 | Ga0075433_10130467 | 3300006852 | Bacteria | 2233 |
| 155 | Ga0075433_10169105 | 3300006852 | Bacteria | 1945 |
| 156 | Ga0075433_10189122 | 3300006852 | Bacteria | 1832 |
| 157 | Ga0075433_10236375 | 3300006852 | Bacteria | 1622 |
| 158 | Ga0075434_100001347 | 3300006871 | Bacteria | 20612 |
| 159 | Ga0075434_100071301 | 3300006871 | Unclassified | 3466 |
| 160 | Ga0075434_100125622 | 3300006871 | Bacteria | 2582 |
| 161 | Ga0075434_100173984 | 3300006871 | Bacteria | 2173 |
| 162 | Ga0075434_100178425 | 3300006871 | Bacteria | 2144 |
| 163 | Ga0075429_100014281 | 3300006880 | Bacteria | 6888 |
| 164 | Ga0075429_100143545 | 3300006880 | Bacteria | 2090 |
| 165 | Ga0068865_100158037 | 3300006881 | Bacteria | 1726 |
| 166 | Ga0068865_100186468 | 3300006881 | Bacteria | 1601 |
| 167 | Ga0075436_100000671 | 3300006914 | Bacteria | 22502 |
| 168 | Ga0075436_100244931 | 3300006914 | Bacteria | 1275 |
| 169 | Ga0097620_100000645 | 3300006931 | Bacteria | 34867 |
| 170 | Ga0097620_100053081 | 3300006931 | Bacteria | 4076 |
| 171 | Ga0097620_100084282 | 3300006931 | Bacteria | 3223 |
| 172 | Ga0097620_100179304 | 3300006931 | Bacteria | 2201 |
| 173 | Ga0097620_100206945 | 3300006931 | Bacteria | 2047 |
| 174 | Ga0075435_100006980 | 3300007076 | Bacteria | 8018 |
| 175 | Ga0075435_100051099 | 3300007076 | Bacteria | 3329 |
| 176 | Ga0105240_10120425 | 3300009093 | Bacteria | 3160 |
| 177 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 178 | Ga0111539_10001789 | 3300009094 | Bacteria | 28570 |
| 179 | Ga0111539_10002263 | 3300009094 | Bacteria | 25652 |
| 180 | Ga0111539_10002439 | 3300009094 | Bacteria | 24735 |
| 181 | Ga0111539_10010482 | 3300009094 | Bacteria | 11661 |
| 182 | Ga0111539_10015398 | 3300009094 | Bacteria | 9516 |
| 183 | Ga0111539_10028916 | 3300009094 | Bacteria | 6758 |
| 184 | Ga0111539_10106604 | 3300009094 | Bacteria | 3287 |
| 185 | Ga0111539_10150684 | 3300009094 | Bacteria | 2722 |
| 186 | Ga0111539_10183879 | 3300009094 | Bacteria | 2441 |
| 187 | Ga0111539_10258764 | 3300009094 | Bacteria | 2026 |
| 188 | Ga0111539_10559582 | 3300009094 | Bacteria | 1332 |
| 189 | Ga0105245_10153449 | 3300009098 | Bacteria | 2180 |
| 190 | Ga0105245_10336731 | 3300009098 | Bacteria | 1491 |
| 191 | Ga0114129_10000174 | 3300009147 | Bacteria | 70648 |
| 192 | Ga0114129_10003221 | 3300009147 | Bacteria | 22900 |
| 193 | Ga0114129_10007540 | 3300009147 | Bacteria | 15491 |
| 194 | Ga0114129_10025369 | 3300009147 | Bacteria | 8400 |
| 195 | Ga0114129_10030336 | 3300009147 | Bacteria | 7652 |
| 196 | Ga0114129_10320019 | 3300009147 | Bacteria | 2062 |
| 197 | Ga0105242_10194146 | 3300009176 | Bacteria | 1799 |
| 198 | Ga0105248_10021539 | 3300009177 | Bacteria | 7139 |
| 199 | Ga0105248_10026112 | 3300009177 | Bacteria | 6498 |
| 200 | Ga0105248_10061095 | 3300009177 | Bacteria | 4230 |
| 201 | Ga0105248_10078331 | 3300009177 | Bacteria | 3715 |
| 202 | Ga0105248_10082480 | 3300009177 | Bacteria | 3616 |
| 203 | Ga0105248_10779426 | 3300009177 | Bacteria | 1079 |
| 204 | Ga0105237_10426864 | 3300009545 | Bacteria | 1331 |
| 205 | Ga0105249_10001517 | 3300009553 | Bacteria | 20379 |
| 206 | Ga0105249_10107994 | 3300009553 | Bacteria | 2626 |
| 207 | Ga0105249_10199642 | 3300009553 | Bacteria | 1957 |
| 208 | Ga0105246_10025235 | 3300011119 | Bacteria | 3873 |
| 209 | Ga0157371_10145906 | 3300013102 | Bacteria | 1686 |
| 210 | Ga0157370_10137425 | 3300013104 | Bacteria | 2277 |
| 211 | Ga0157369_10190988 | 3300013105 | Bacteria | 2152 |
| 212 | Ga0157374_10043570 | 3300013296 | Bacteria | 4146 |
| 213 | Ga0157374_10083973 | 3300013296 | Bacteria | 3026 |
| 214 | Ga0157374_10100314 | 3300013296 | Bacteria | 2775 |
| 215 | Ga0157374_10295934 | 3300013296 | Bacteria | 1601 |
| 216 | Ga0157378_10025354 | 3300013297 | Bacteria | 5222 |
| 217 | Ga0157378_10265204 | 3300013297 | Bacteria | 1649 |
| 218 | Ga0163162_10031787 | 3300013306 | Bacteria | 5238 |
| 219 | Ga0163162_10068321 | 3300013306 | Bacteria | 3605 |
| 220 | Ga0163162_10298596 | 3300013306 | Bacteria | 1743 |
| 221 | Ga0157375_10001332 | 3300013308 | Bacteria | 21293 |
| 222 | Ga0157375_10024925 | 3300013308 | Bacteria | 5546 |
| 223 | Ga0157375_10046551 | 3300013308 | Bacteria | 4231 |
| 224 | Ga0157375_10072570 | 3300013308 | Bacteria | 3459 |
| 225 | Ga0157375_10112204 | 3300013308 | Bacteria | 2826 |
| 226 | Ga0157375_10241713 | 3300013308 | Bacteria | 1965 |
| 227 | Ga0163163_10000017 | 3300014325 | Bacteria | 208781 |
| 228 | Ga0163163_10128873 | 3300014325 | Bacteria | 2569 |
| 229 | Ga0163163_10378098 | 3300014325 | Bacteria | 1474 |
| 230 | Ga0157380_10017590 | 3300014326 | Bacteria | 5290 |
| 231 | Ga0157380_10076073 | 3300014326 | Bacteria | 2730 |
| 232 | Ga0157380_10417945 | 3300014326 | Bacteria | 1278 |
| 233 | Ga0157377_10125469 | 3300014745 | Bacteria | 1561 |
| 234 | Ga0157379_10034512 | 3300014968 | Bacteria | 4510 |
| 235 | Ga0157376_10010121 | 3300014969 | Bacteria | 6887 |
| 236 | Ga0157376_10037777 | 3300014969 | Bacteria | 3924 |
| 237 | Ga0163161_10029497 | 3300017792 | Bacteria | 3900 |
| 238 | Ga0224712_10040484 | 3300022467 | Bacteria | 1754 |
| 239 | Ga0207697_10010226 | 3300025315 | Bacteria | 4019 |
| 240 | Ga0207697_10100831 | 3300025315 | Bacteria | 1230 |
| 241 | Ga0207682_10003116 | 3300025893 | Bacteria | 7262 |
| 242 | Ga0207682_10003998 | 3300025893 | Bacteria | 6275 |
| 243 | Ga0207692_10015489 | 3300025898 | Bacteria | 3356 |
| 244 | Ga0207688_10006597 | 3300025901 | Bacteria | 6313 |
| 245 | Ga0207688_10010284 | 3300025901 | Bacteria | 5092 |
| 246 | Ga0207647_10002036 | 3300025904 | Bacteria | 15455 |
| 247 | Ga0207645_10013270 | 3300025907 | Bacteria | 5558 |
| 248 | Ga0207645_10020774 | 3300025907 | Bacteria | 4292 |
| 249 | Ga0207645_10106312 | 3300025907 | Bacteria | 1814 |
| 250 | Ga0207643_10000719 | 3300025908 | Bacteria | 20342 |
| 251 | Ga0207643_10006147 | 3300025908 | Bacteria | 6423 |
| 252 | Ga0207643_10063566 | 3300025908 | Bacteria | 2111 |
| 253 | Ga0207707_10158044 | 3300025912 | Bacteria | 1982 |
| 254 | Ga0207695_10389317 | 3300025913 | Bacteria | 1279 |
| 255 | Ga0207660_10143056 | 3300025917 | Bacteria | 1830 |
| 256 | Ga0207662_10013224 | 3300025918 | Bacteria | 4613 |
| 257 | Ga0207657_10160399 | 3300025919 | Bacteria | 1827 |
| 258 | Ga0207652_10042033 | 3300025921 | Bacteria | 3889 |
| 259 | Ga0207681_10329861 | 3300025923 | Bacteria | 1216 |
| 260 | Ga0207650_10011577 | 3300025925 | Bacteria | 6074 |
| 261 | Ga0207650_10019377 | 3300025925 | Bacteria | 4780 |
| 262 | Ga0207650_10027932 | 3300025925 | Bacteria | 4042 |
| 263 | Ga0207650_10069414 | 3300025925 | Bacteria | 2648 |
| 264 | Ga0207650_10311843 | 3300025925 | Bacteria | 1287 |
| 265 | Ga0207659_10004886 | 3300025926 | Bacteria | 8120 |
| 266 | Ga0207659_10023305 | 3300025926 | Bacteria | 4130 |
| 267 | Ga0207659_10033346 | 3300025926 | Bacteria | 3543 |
| 268 | Ga0207700_10220589 | 3300025928 | Bacteria | 1607 |
| 269 | Ga0207664_10025948 | 3300025929 | Bacteria | 4422 |
| 270 | Ga0207706_10054786 | 3300025933 | Bacteria | 3519 |
| 271 | Ga0207706_10225391 | 3300025933 | Bacteria | 1641 |
| 272 | Ga0207670_10043647 | 3300025936 | Bacteria | 2963 |
| 273 | Ga0207669_10005017 | 3300025937 | Bacteria | 5887 |
| 274 | Ga0207669_10143478 | 3300025937 | Bacteria | 1661 |
| 275 | Ga0207704_10019970 | 3300025938 | Bacteria | 3533 |
| 276 | Ga0207691_10002949 | 3300025940 | Bacteria | 16607 |
| 277 | Ga0207691_10038899 | 3300025940 | Bacteria | 4401 |
| 278 | Ga0207691_10042995 | 3300025940 | Bacteria | 4165 |
| 279 | Ga0207691_10042996 | 3300025940 | Bacteria | 4165 |
| 280 | Ga0207691_10046064 | 3300025940 | Bacteria | 4010 |
| 281 | Ga0207691_10059785 | 3300025940 | Bacteria | 3464 |
| 282 | Ga0207691_10125234 | 3300025940 | Bacteria | 2274 |
| 283 | Ga0207711_10000511 | 3300025941 | Bacteria | 39835 |
| 284 | Ga0207689_10011973 | 3300025942 | Bacteria | 7435 |
| 285 | Ga0207689_10034173 | 3300025942 | Bacteria | 4223 |
| 286 | Ga0207689_10055184 | 3300025942 | Bacteria | 3271 |
| 287 | Ga0207689_10075399 | 3300025942 | Bacteria | 2772 |
| 288 | Ga0207661_10005594 | 3300025944 | Bacteria | 8861 |
| 289 | Ga0207679_10007747 | 3300025945 | Bacteria | 6824 |
| 290 | Ga0207667_10195119 | 3300025949 | Bacteria | 2077 |
| 291 | Ga0207651_10007460 | 3300025960 | Bacteria | 5828 |
| 292 | Ga0207651_10034440 | 3300025960 | Bacteria | 3280 |
| 293 | Ga0207712_10022729 | 3300025961 | Bacteria | 4134 |
| 294 | Ga0207712_10301351 | 3300025961 | Bacteria | 1315 |
| 295 | Ga0207668_10145049 | 3300025972 | Bacteria | 1831 |
| 296 | Ga0207668_10197196 | 3300025972 | Bacteria | 1600 |
| 297 | Ga0207668_10278611 | 3300025972 | Bacteria | 1370 |
| 298 | Ga0207658_10028612 | 3300025986 | Bacteria | 3926 |
| 299 | Ga0207658_10049176 | 3300025986 | Bacteria | 3097 |
| 300 | Ga0207658_10073613 | 3300025986 | Bacteria | 2593 |
| 301 | Ga0207678_10087667 | 3300026067 | Bacteria | 2660 |
| 302 | Ga0207678_10181110 | 3300026067 | Bacteria | 1799 |
| 303 | Ga0207678_10194996 | 3300026067 | Bacteria | 1731 |
| 304 | Ga0207708_10023376 | 3300026075 | Bacteria | 4671 |
| 305 | Ga0207708_10097167 | 3300026075 | Bacteria | 2276 |
| 306 | Ga0207641_10110284 | 3300026088 | Bacteria | 2438 |
| 307 | Ga0207641_10285838 | 3300026088 | Bacteria | 1553 |
| 308 | Ga0207648_10017784 | 3300026089 | Bacteria | 6454 |
| 309 | Ga0207648_10081129 | 3300026089 | Bacteria | 2830 |
| 310 | Ga0207648_10266495 | 3300026089 | Bacteria | 1529 |
| 311 | Ga0207676_10016426 | 3300026095 | Bacteria | 5361 |
| 312 | Ga0207676_10045247 | 3300026095 | Bacteria | 3400 |
| 313 | Ga0207676_10045901 | 3300026095 | Bacteria | 3378 |
| 314 | Ga0207674_10017928 | 3300026116 | Bacteria | 7716 |
| 315 | Ga0207674_10423926 | 3300026116 | Bacteria | 1286 |
| 316 | Ga0207675_100012281 | 3300026118 | Bacteria | 8002 |
| 317 | Ga0207675_100084735 | 3300026118 | Bacteria | 2974 |
| 318 | Ga0207675_100311116 | 3300026118 | Bacteria | 1536 |
| 319 | Ga0207683_10012400 | 3300026121 | Bacteria | 7274 |
| 320 | Ga0207683_10230455 | 3300026121 | Bacteria | 1689 |
| 321 | Ga0207698_10136072 | 3300026142 | Bacteria | 2108 |
| 322 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 323 | Ga0207428_10000849 | 3300027907 | Bacteria | 34443 |
| 324 | Ga0207428_10004387 | 3300027907 | Bacteria | 13451 |
| 325 | Ga0207428_10010923 | 3300027907 | Bacteria | 8082 |
| 326 | Ga0207428_10011180 | 3300027907 | Bacteria | 7961 |
| 327 | Ga0207428_10025773 | 3300027907 | Bacteria | 4916 |
| 328 | Ga0207428_10209042 | 3300027907 | Bacteria | 1467 |
| 329 | Ga0268266_10035802 | 3300028379 | Bacteria | 4222 |
| 330 | Ga0268266_10140740 | 3300028379 | Bacteria | 2165 |
| 331 | Ga0268266_10143107 | 3300028379 | Bacteria | 2147 |
| 332 | Ga0268265_10011891 | 3300028380 | Bacteria | 5886 |
| 333 | Ga0268265_10062247 | 3300028380 | Bacteria | 2866 |
| 334 | Ga0268265_10306804 | 3300028380 | Bacteria | 1431 |
| 335 | Ga0268264_10039306 | 3300028381 | Bacteria | 3908 |
| 336 | Ga0268264_10175418 | 3300028381 | Bacteria | 1942 |
| 337 | Ga0265336_10001878 | 3300028666 | Bacteria | 9085 |
| 338 | Ga0265760_10014625 | 3300031090 | Bacteria | 2249 |
| 339 | Ga0265316_10001007 | 3300031344 | Bacteria | 30605 |
| 340 | Ga0307408_100270180 | 3300031548 | Bacteria | 1411 |
| 341 | Ga0307405_10204809 | 3300031731 | Bacteria | 1436 |
| 342 | Ga0307410_10158330 | 3300031852 | Bacteria | 1694 |
| 343 | Ga0307410_10191713 | 3300031852 | Bacteria | 1555 |
| 344 | Ga0307411_10276059 | 3300032005 | Bacteria | 1335 |
| 345 | Ga0373934_0007068 | 3300035086 | Bacteria | 4165 |
| 346 | Ga0373932_0050832 | 3300035112 | Bacteria | 1229 |
| 347 | Ga0373927_0010876 | 3300035695 | Bacteria | 6060 |
| 348 | Ga0373933_0023125 | 3300035724 | Bacteria | 3548 |
| 349 | Ga0373933_0253838 | 3300035724 | Bacteria | 1133 |
| 350 | Ga0373947_0000399 | 3300035725 | Bacteria | 24491 |
| 351 | Ga0373937_0000499 | 3300036401 | Bacteria | 35871 |
| 352 | Ga0373937_0001949 | 3300036401 | Bacteria | 17281 |
| 353 | Ga0373937_0087881 | 3300036401 | Bacteria | 2877 |
| 354 | Ga0373925_0001209 | 3300037068 | Bacteria | 22767 |
| 355 | Ga0395905_0068804 | 3300037471 | Bacteria | 3316 |
| 356 | Ga0395905_0093407 | 3300037471 | Bacteria | 2822 |
| 357 | Ga0436364_0347559 | 3300037853 | Bacteria | 1247 |
| 358 | Ga0436363_0210429 | 3300039450 | Bacteria | 1639 |
| 359 | Ga0436363_0622237 | 3300039450 | Bacteria | 2167 |
| 360 | Ga0436363_0869569 | 3300039450 | Bacteria | 2081 |
| 361 | Ga0436363_1537631 | 3300039450 | Bacteria | 1981 |
| 362 | Ga0450894_001200 | 3300042131 | Bacteria | 3841 |
| 363 | Ga0450908_010797 | 3300042184 | Bacteria | 1681 |
| 364 | Ga0439435_0030075 | 3300042436 | Bacteria | 1470 |
| 365 | Ga0439464_0036666 | 3300042439 | Bacteria | 1388 |
| 366 | Ga0439464_0043567 | 3300042439 | Bacteria | 1284 |
| 367 | Ga0453683_0135390 | 3300044673 | Bacteria | 1554 |
| 368 | Ga0466963_0067333 | 3300044694 | Bacteria | 2403 |
| 369 | Ga0453684_0084396 | 3300044712 | Bacteria | 3950 |
| 370 | Ga0453684_0723447 | 3300044712 | Bacteria | 1080 |
| 371 | Ga0451576_0008042 | 3300045051 | Bacteria | 12447 |
| 372 | Ga0451576_0022914 | 3300045051 | Bacteria | 6767 |
| 373 | Ga0451576_0025872 | 3300045051 | Bacteria | 6319 |
| 374 | Ga0451576_0123792 | 3300045051 | Bacteria | 2693 |
| 375 | Ga0451576_0298918 | 3300045051 | Bacteria | 1683 |
| 376 | Ga0495629_0105033 | 3300046459 | Bacteria | 1970 |
| 377 | Ga0495638_0007866 | 3300046460 | Bacteria | 7605 |
| 378 | Ga0495651_0026908 | 3300046462 | Bacteria | 4479 |
| 379 | Ga0495653_0019761 | 3300046463 | Bacteria | 5462 |
| 380 | Ga0495665_0035412 | 3300046531 | Bacteria | 2667 |
| 381 | Ga0495645_0100539 | 3300046543 | Bacteria | 2056 |
| 382 | Ga0495599_0038251 | 3300046678 | Bacteria | 3015 |
| 383 | Ga0495599_0096900 | 3300046678 | Bacteria | 1839 |
| 384 | Ga0495647_0003002 | 3300046681 | Bacteria | 5369 |
| 385 | Ga0495658_0023673 | 3300046683 | Bacteria | 3263 |
| 386 | Ga0495613_0099408 | 3300046689 | Bacteria | 2102 |
| 387 | Ga0495613_0166662 | 3300046689 | Bacteria | 1565 |
| 388 | Ga0495680_0130878 | 3300047322 | Bacteria | 1844 |
| 389 | Ga0495684_0032654 | 3300047471 | Bacteria | 3997 |
| 390 | Ga0495684_0035673 | 3300047471 | Bacteria | 3813 |
| 391 | Ga0495684_0057472 | 3300047471 | Bacteria | 2965 |
| 392 | Ga0495684_0105529 | 3300047471 | Bacteria | 2129 |
| 393 | Ga0496100_0006282 | 3300048903 | Bacteria | 6471 |
| 394 | Ga0496100_0045682 | 3300048903 | Bacteria | 2812 |
| 395 | Ga0496100_0188772 | 3300048903 | Bacteria | 1495 |
| 396 | Ga0496101_0000222 | 3300048904 | Bacteria | 42490 |
| 397 | Ga0496102_0017609 | 3300048905 | Bacteria | 6260 |
| 398 | Ga0496102_0106816 | 3300048905 | Bacteria | 2606 |
| 399 | Ga0496103_0039199 | 3300048906 | Bacteria | 2911 |
| 400 | Ga0496104_0001478 | 3300048907 | Bacteria | 20272 |
| 401 | Ga0496104_0016812 | 3300048907 | Bacteria | 6648 |
| 402 | Ga0496104_0044478 | 3300048907 | Bacteria | 4172 |
| 403 | Ga0496105_0016285 | 3300048908 | Bacteria | 5934 |
| 404 | Ga0496105_0246966 | 3300048908 | Bacteria | 1447 |
| 405 | Ga0496106_0000977 | 3300048909 | Bacteria | 20836 |
| 406 | Ga0496107_0218165 | 3300048910 | Bacteria | 1419 |
| 407 | Ga0496108_0119269 | 3300048911 | Bacteria | 2262 |
| 408 | Ga0496109_0001591 | 3300048912 | Bacteria | 18936 |
| 409 | Ga0496109_0002883 | 3300048912 | Bacteria | 14395 |
| 410 | Ga0496109_0006323 | 3300048912 | Bacteria | 9976 |
| 411 | Ga0496110_0003223 | 3300048913 | Bacteria | 12429 |
| 412 | Ga0496110_0189705 | 3300048913 | Bacteria | 1867 |
| 413 | Ga0496110_0246176 | 3300048913 | Bacteria | 1627 |
| 414 | Ga0496111_0089134 | 3300048914 | Bacteria | 2259 |
| 415 | Ga0496111_0118267 | 3300048914 | Bacteria | 1956 |
| 416 | Ga0496111_0324024 | 3300048914 | Bacteria | 1141 |
| 417 | Ga0496112_0000913 | 3300048915 | Bacteria | 21318 |
| 418 | Ga0496112_0001633 | 3300048915 | Bacteria | 17370 |
| 419 | Ga0496112_0090896 | 3300048915 | Bacteria | 3022 |
| 420 | Ga0496112_0155496 | 3300048915 | Bacteria | 2253 |
| 421 | Ga0496113_0167260 | 3300048916 | Bacteria | 1740 |
| 422 | Ga0496113_0480121 | 3300048916 | Bacteria | 998 |
| 423 | Ga0496114_0000416 | 3300048917 | Bacteria | 31603 |
| 424 | Ga0496114_0001016 | 3300048917 | Bacteria | 21060 |
| 425 | Ga0496114_0039519 | 3300048917 | Bacteria | 3904 |
| 426 | Ga0496115_0020221 | 3300048918 | Bacteria | 5133 |
| 427 | Ga0501031_0010042 | 3300049568 | Bacteria | 6166 |
| 428 | Ga0501032_0038195 | 3300049569 | Bacteria | 3271 |
| 429 | Ga0501033_0072609 | 3300049570 | Bacteria | 2526 |
| 430 | Ga0501033_0119413 | 3300049570 | Bacteria | 1914 |
| 431 | Ga0501034_0009195 | 3300049571 | Bacteria | 10366 |
| 432 | Ga0501036_0002069 | 3300049572 | Bacteria | 15647 |
| 433 | Ga0501036_0047506 | 3300049572 | Bacteria | 3634 |
| 434 | Ga0501037_0006174 | 3300049573 | Bacteria | 8757 |
| 435 | Ga0501038_0015045 | 3300049574 | Bacteria | 7047 |
| 436 | Ga0501039_0011230 | 3300049575 | Bacteria | 6825 |
| 437 | Ga0501039_0082901 | 3300049575 | Bacteria | 2497 |
| 438 | Ga0501040_0041322 | 3300049576 | Bacteria | 3141 |
| 439 | Ga0501040_0052315 | 3300049576 | Bacteria | 2795 |
| 440 | Ga0501041_0030537 | 3300049577 | Bacteria | 3253 |
| 441 | Ga0501042_0009454 | 3300049578 | Bacteria | 6496 |
| 442 | Ga0501042_0183726 | 3300049578 | Bacteria | 1508 |
| 443 | Ga0501043_0003896 | 3300049579 | Bacteria | 12248 |
| 444 | Ga0501046_0060979 | 3300049580 | Bacteria | 2951 |
| 445 | Ga0501046_0068737 | 3300049580 | Bacteria | 2756 |
| 446 | Ga0501047_0003720 | 3300049581 | Bacteria | 14361 |
| 447 | Ga0501048_0148192 | 3300049582 | Bacteria | 1659 |
| 448 | Ga0501067_0004090 | 3300049583 | Bacteria | 8044 |
| 449 | Ga0501068_0014774 | 3300049584 | Bacteria | 4468 |
| 450 | Ga0501069_0009417 | 3300049585 | Bacteria | 5153 |
| 451 | Ga0501069_0029616 | 3300049585 | Bacteria | 3004 |
| 452 | Ga0501070_0180591 | 3300049586 | Bacteria | 1737 |
| 453 | Ga0501070_0222497 | 3300049586 | Bacteria | 1547 |
| 454 | Ga0501071_0074314 | 3300049587 | Bacteria | 2480 |
| 455 | Ga0501071_0159208 | 3300049587 | Bacteria | 1687 |
| 456 | Ga0501073_0002590 | 3300049589 | Bacteria | 13524 |
| 457 | Ga0501073_0101130 | 3300049589 | Bacteria | 2001 |
| 458 | Ga0501074_0020019 | 3300049590 | Bacteria | 4863 |
| 459 | Ga0501074_0027557 | 3300049590 | Bacteria | 4119 |
| 460 | Ga0501074_0299895 | 3300049590 | Bacteria | 1141 |
| 461 | Ga0501075_0037535 | 3300049591 | Bacteria | 3620 |
| 462 | Ga0501075_0068544 | 3300049591 | Bacteria | 2680 |
| 463 | Ga0501075_0179191 | 3300049591 | Bacteria | 1617 |
| 464 | Ga0501079_0038052 | 3300049741 | Bacteria | 3710 |
| 465 | Ga0501080_0060984 | 3300049742 | Bacteria | 3512 |
| 466 | Ga0501080_0156288 | 3300049742 | Bacteria | 2106 |
| 467 | Ga0501083_0011332 | 3300049744 | Bacteria | 6253 |
| 468 | Ga0501273_006719 | 3300049770 | Bacteria | 1339 |
| 469 | Ga0501035_0057778 | 3300049822 | Bacteria | 3458 |
| 470 | Ga0501035_0137770 | 3300049822 | Bacteria | 2123 |
| 471 | Ga0501044_0099869 | 3300049823 | Bacteria | 2920 |
| 472 | Ga0501045_0127805 | 3300049824 | Bacteria | 1888 |
| 473 | nmdc:mga00v17_134312_c1 | 3300050491 | Bacteria | 1583 |
| 474 | nmdc:mga06z11_77406_c1 | 3300050494 | Bacteria | 1776 |
| 475 | nmdc:mga07m45_89282_c1 | 3300050496 | Bacteria | 1765 |
| 476 | nmdc:mga05p37_124034_c1 | 3300050507 | Bacteria | 3173 |
| 477 | nmdc:mga05p37_204_c1 | 3300050507 | Bacteria | 59503 |
| 478 | nmdc:mga05p37_21801_c1 | 3300050507 | Bacteria | 7760 |
| 479 | nmdc:mga05p37_31808_c1 | 3300050507 | Bacteria | 6447 |
| 480 | nmdc:mga05p37_7226_c1 | 3300050507 | Bacteria | 13099 |
| 481 | nmdc:mga09592_117816_c1 | 3300050508 | Bacteria | 2279 |
| 482 | nmdc:mga09592_14652_c1 | 3300050508 | Bacteria | 6397 |
| 483 | nmdc:mga0qj67_1031_c1 | 3300050509 | Bacteria | 19266 |
| 484 | nmdc:mga0qj67_126273_c1 | 3300050509 | Bacteria | 2070 |
| 485 | nmdc:mga0qj67_16036_c1 | 3300050509 | Bacteria | 5675 |
| 486 | nmdc:mga0qj67_31718_c1 | 3300050509 | Bacteria | 4118 |
| 487 | nmdc:mga0qj67_3991_c1 | 3300050509 | Bacteria | 10683 |
| 488 | nmdc:mga06r32_133540_c1 | 3300050510 | Bacteria | 2456 |
| 489 | nmdc:mga06r32_2396_c1 | 3300050510 | Bacteria | 16781 |
| 490 | nmdc:mga06r32_38284_c1 | 3300050510 | Bacteria | 4542 |
| 491 | nmdc:mga06r32_74634_c1 | 3300050510 | Bacteria | 3288 |
| 492 | nmdc:mga06r32_95014_c1 | 3300050510 | Bacteria | 2917 |
| 493 | nmdc:mga08y16_15221_c1 | 3300050511 | Bacteria | 8091 |
| 494 | nmdc:mga08y16_175386_c1 | 3300050511 | Bacteria | 2226 |
| 495 | nmdc:mga08y16_257149_c1 | 3300050511 | Bacteria | 1804 |
| 496 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 497 | nmdc:mga08y16_49622_c1 | 3300050511 | Bacteria | 4392 |
| 498 | nmdc:mga08y16_66229_c1 | 3300050511 | Bacteria | 3770 |
| 499 | nmdc:mga08y16_8329_c1 | 3300050511 | Bacteria | 10851 |
| 500 | nmdc:mga0n895_265611_c1 | 3300050512 | Bacteria | 1741 |
| 501 | nmdc:mga0n895_28663_c1 | 3300050512 | Bacteria | 5300 |
| 502 | nmdc:mga0n895_47349_c1 | 3300050512 | Bacteria | 4203 |
| 503 | nmdc:mga0n895_477_c1 | 3300050512 | Bacteria | 26935 |
| 504 | nmdc:mga0n895_75379_c1 | 3300050512 | Bacteria | 3353 |
| 505 | nmdc:mga0rr50_152554_c1 | 3300050513 | Bacteria | 1868 |
| 506 | nmdc:mga0rr50_89900_c1 | 3300050513 | Bacteria | 2388 |
| 507 | nmdc:mga08x19_31958_c1 | 3300050514 | Bacteria | 3316 |
| 508 | nmdc:mga08x19_8005_c1 | 3300050514 | Bacteria | 6281 |
| 509 | nmdc:mga0a205_103159_c1 | 3300050515 | Bacteria | 2750 |
| 510 | nmdc:mga0a205_1627_c1 | 3300050515 | Bacteria | 19317 |
| 511 | nmdc:mga0a205_172_c1 | 3300050515 | Bacteria | 43386 |
| 512 | nmdc:mga0a205_255771_c1 | 3300050515 | Bacteria | 1630 |
| 513 | nmdc:mga0a205_43164_c1 | 3300050515 | Bacteria | 4348 |
| 514 | nmdc:mga0a205_53455_c1 | 3300050515 | Bacteria | 3898 |
| 515 | nmdc:mga0a205_646_c1 | 3300050515 | Bacteria | 27674 |
| 516 | nmdc:mga0a205_81371_c1 | 3300050515 | Bacteria | 3129 |
| 517 | Ga0495601_0014121 | 3300053077 | Bacteria | 4812 |
| 518 | Ga0495601_0109654 | 3300053077 | Bacteria | 1787 |
| 519 | Ga0495619_0005774 | 3300053085 | Bacteria | 7843 |
| 520 | Ga0500555_000738 | 3300053103 | Bacteria | 12099 |
| 521 | Ga0500592_012087 | 3300053116 | Bacteria | 1380 |
| 522 | Ga0500616_0000167 | 3300053153 | Bacteria | 109823 |
| 523 | Ga0500645_000021 | 3300053730 | Bacteria | 133415 |
| 524 | Ga0500599_008481 | 3300053736 | Bacteria | 1336 |
| 525 | Ga0501084_0008305 | 3300054114 | Bacteria | 8569 |
| 526 | Ga0501084_0029452 | 3300054114 | Bacteria | 4592 |
| 527 | Ga0501082_0003223 | 3300060353 | Bacteria | 14224 |
| 528 | Ga0501082_0109866 | 3300060353 | Bacteria | 2387 |
| 529 | Ga0530510_0011389 | 3300061734 | Bacteria | 6239 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046531 | Ga0495665_0035412 | Ga0495665_0035412_1776_2657 | 293 |
| 2 | 3300035724 | Ga0373933_0253838 | Ga0373933_0253838_219_1118 | 299 |
| 3 | 3300037853 | Ga0436364_0347559 | Ga0436364_0347559_333_1232 | 299 |
| 4 | 3300049586 | Ga0501070_0180591 | Ga0501070_0180591_822_1721 | 299 |
| 5 | 3300048916 | Ga0496113_0480121 | Ga0496113_0480121_28_936 | 302 |
| 6 | 3300025972 | Ga0207668_10145049 | Ga0207668_101450492 | 322 |
| 7 | 3300050515 | nmdc:mga0a205_172_c1 | nmdc:mga0a205_172_c1_1863_2864 | 333 |
| 8 | 3300050512 | nmdc:mga0n895_28663_c1 | nmdc:mga0n895_28663_c1_4200_5210 | 336 |
| 9 | 3300050515 | nmdc:mga0a205_81371_c1 | nmdc:mga0a205_81371_c1_1032_2042 | 336 |
| 10 | 3300039450 | Ga0436363_1537631 | Ga0436363_1537631_664_1707 | 338 |
| 11 | 3300005331 | Ga0070670_100035799 | Ga0070670_1000357992 | 339 |
| 12 | 3300005336 | Ga0070680_100115296 | Ga0070680_1001152962 | 339 |
| 13 | 3300005518 | Ga0070699_100444028 | Ga0070699_1004440281 | 339 |
| 14 | 3300005577 | Ga0068857_100037884 | Ga0068857_1000378844 | 339 |
| 15 | 3300025925 | Ga0207650_10069414 | Ga0207650_100694142 | 339 |
| 16 | 3300026116 | Ga0207674_10017928 | Ga0207674_100179283 | 339 |
| 17 | 3300036401 | Ga0373937_0001949 | Ga0373937_0001949_5937_6959 | 339 |
| 18 | 3300039450 | Ga0436363_0622237 | Ga0436363_0622237_288_1310 | 339 |
| 19 | 3300005293 | Ga0065715_10135686 | Ga0065715_101356862 | 340 |
| 20 | 3300005340 | Ga0070689_100030013 | Ga0070689_1000300132 | 340 |
| 21 | 3300005365 | Ga0070688_100188019 | Ga0070688_1001880192 | 340 |
| 22 | 3300005437 | Ga0070710_10008097 | Ga0070710_100080973 | 340 |
| 23 | 3300005543 | Ga0070672_100002598 | Ga0070672_1000025988 | 340 |
| 24 | 3300005844 | Ga0068862_100186042 | Ga0068862_1001860422 | 340 |
| 25 | 3300006237 | Ga0097621_100005339 | Ga0097621_1000053393 | 340 |
| 26 | 3300006358 | Ga0068871_100086372 | Ga0068871_1000863722 | 340 |
| 27 | 3300006871 | Ga0075434_100173984 | Ga0075434_1001739841 | 340 |
| 28 | 3300007076 | Ga0075435_100006980 | Ga0075435_1000069802 | 340 |
| 29 | 3300013296 | Ga0157374_10083973 | Ga0157374_100839732 | 340 |
| 30 | 3300014325 | Ga0163163_10128873 | Ga0163163_101288732 | 340 |
| 31 | 3300014969 | Ga0157376_10037777 | Ga0157376_100377773 | 340 |
| 32 | 3300025898 | Ga0207692_10015489 | Ga0207692_100154893 | 340 |
| 33 | 3300025904 | Ga0207647_10002036 | Ga0207647_100020365 | 340 |
| 34 | 3300031090 | Ga0265760_10014625 | Ga0265760_100146252 | 340 |
| 35 | 3300048903 | Ga0496100_0006282 | Ga0496100_0006282_1158_2180 | 340 |
| 36 | 3300048903 | Ga0496100_0188772 | Ga0496100_0188772_227_1288 | 340 |
| 37 | 3300048904 | Ga0496101_0000222 | Ga0496101_0000222_1508_2530 | 340 |
| 38 | 3300048907 | Ga0496104_0001478 | Ga0496104_0001478_16310_17332 | 340 |
| 39 | 3300048912 | Ga0496109_0006323 | Ga0496109_0006323_8218_9279 | 340 |
| 40 | 3300048913 | Ga0496110_0246176 | Ga0496110_0246176_17_1078 | 340 |
| 41 | 3300048914 | Ga0496111_0324024 | Ga0496111_0324024_69_1097 | 340 |
| 42 | 3300048915 | Ga0496112_0155496 | Ga0496112_0155496_1091_2152 | 340 |
| 43 | 3300048916 | Ga0496113_0167260 | Ga0496113_0167260_18_1079 | 340 |
| 44 | 3300048917 | Ga0496114_0000416 | Ga0496114_0000416_24392_25414 | 340 |
| 45 | 3300049572 | Ga0501036_0047506 | Ga0501036_0047506_1127_2188 | 340 |
| 46 | 3300049585 | Ga0501069_0029616 | Ga0501069_0029616_333_1388 | 340 |
| 47 | 3300049590 | Ga0501074_0020019 | Ga0501074_0020019_571_1632 | 340 |
| 48 | 3300049744 | Ga0501083_0011332 | Ga0501083_0011332_2347_3408 | 340 |
| 49 | 3300049822 | Ga0501035_0057778 | Ga0501035_0057778_277_1338 | 340 |
| 50 | 3300050511 | nmdc:mga08y16_49622_c1 | nmdc:mga08y16_49622_c1_1703_2728 | 340 |
| 51 | 3300050512 | nmdc:mga0n895_47349_c1 | nmdc:mga0n895_47349_c1_2552_3574 | 340 |
| 52 | 3300050513 | nmdc:mga0rr50_89900_c1 | nmdc:mga0rr50_89900_c1_483_1505 | 340 |
| 53 | 3300053116 | Ga0500592_012087 | Ga0500592_012087_124_1221 | 340 |
| 54 | 3300006844 | Ga0075428_100000108 | Ga0075428_10000010835 | 341 |
| 55 | 3300006852 | Ga0075433_10236375 | Ga0075433_102363752 | 341 |
| 56 | 3300006871 | Ga0075434_100125622 | Ga0075434_1001256221 | 341 |
| 57 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001232 | 341 |
| 58 | 3300025933 | Ga0207706_10225391 | Ga0207706_102253912 | 341 |
| 59 | 3300026089 | Ga0207648_10266495 | Ga0207648_102664952 | 341 |
| 60 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002245 | 341 |
| 61 | 3300032005 | Ga0307411_10276059 | Ga0307411_102760592 | 341 |
| 62 | 3300048910 | Ga0496107_0218165 | Ga0496107_0218165_291_1319 | 341 |
| 63 | 3300049568 | Ga0501031_0010042 | Ga0501031_0010042_4650_5711 | 341 |
| 64 | 3300049569 | Ga0501032_0038195 | Ga0501032_0038195_969_2030 | 341 |
| 65 | 3300049570 | Ga0501033_0072609 | Ga0501033_0072609_1114_2175 | 341 |
| 66 | 3300049572 | Ga0501036_0002069 | Ga0501036_0002069_2430_3491 | 341 |
| 67 | 3300049573 | Ga0501037_0006174 | Ga0501037_0006174_2387_3448 | 341 |
| 68 | 3300049574 | Ga0501038_0015045 | Ga0501038_0015045_1242_2303 | 341 |
| 69 | 3300049575 | Ga0501039_0011230 | Ga0501039_0011230_4494_5555 | 341 |
| 70 | 3300049579 | Ga0501043_0003896 | Ga0501043_0003896_307_1368 | 341 |
| 71 | 3300049580 | Ga0501046_0068737 | Ga0501046_0068737_582_1643 | 341 |
| 72 | 3300049581 | Ga0501047_0003720 | Ga0501047_0003720_12994_14055 | 341 |
| 73 | 3300049582 | Ga0501048_0148192 | Ga0501048_0148192_509_1570 | 341 |
| 74 | 3300049583 | Ga0501067_0004090 | Ga0501067_0004090_2316_3377 | 341 |
| 75 | 3300049584 | Ga0501068_0014774 | Ga0501068_0014774_2197_3258 | 341 |
| 76 | 3300049585 | Ga0501069_0009417 | Ga0501069_0009417_465_1526 | 341 |
| 77 | 3300049587 | Ga0501071_0074314 | Ga0501071_0074314_89_1150 | 341 |
| 78 | 3300049589 | Ga0501073_0002590 | Ga0501073_0002590_11892_12953 | 341 |
| 79 | 3300049590 | Ga0501074_0027557 | Ga0501074_0027557_2396_3457 | 341 |
| 80 | 3300049741 | Ga0501079_0038052 | Ga0501079_0038052_2120_3181 | 341 |
| 81 | 3300049742 | Ga0501080_0156288 | Ga0501080_0156288_511_1572 | 341 |
| 82 | 3300049822 | Ga0501035_0137770 | Ga0501035_0137770_528_1589 | 341 |
| 83 | 3300049823 | Ga0501044_0099869 | Ga0501044_0099869_1114_2175 | 341 |
| 84 | 3300049824 | Ga0501045_0127805 | Ga0501045_0127805_544_1605 | 341 |
| 85 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_258203_259231 | 341 |
| 86 | 3300053103 | Ga0500555_000738 | Ga0500555_000738_5619_6674 | 341 |
| 87 | 3300053153 | Ga0500616_0000167 | Ga0500616_0000167_54578_55633 | 341 |
| 88 | 3300053730 | Ga0500645_000021 | Ga0500645_000021_10850_11905 | 341 |
| 89 | 3300053736 | Ga0500599_008481 | Ga0500599_008481_212_1267 | 341 |
| 90 | 3300054114 | Ga0501084_0008305 | Ga0501084_0008305_5318_6379 | 341 |
| 91 | 3300060353 | Ga0501082_0003223 | Ga0501082_0003223_2839_3900 | 341 |
| 92 | 3300005530 | Ga0070679_100005990 | Ga0070679_1000059907 | 342 |
| 93 | 3300005577 | Ga0068857_100132802 | Ga0068857_1001328022 | 342 |
| 94 | 3300025921 | Ga0207652_10042033 | Ga0207652_100420332 | 342 |
| 95 | 3300048915 | Ga0496112_0090896 | Ga0496112_0090896_1883_2935 | 342 |
| 96 | 3300005290 | Ga0065712_10001052 | Ga0065712_100010527 | 343 |
| 97 | 3300005293 | Ga0065715_10000269 | Ga0065715_1000026912 | 343 |
| 98 | 3300005330 | Ga0070690_100023258 | Ga0070690_1000232582 | 343 |
| 99 | 3300005331 | Ga0070670_100009228 | Ga0070670_1000092287 | 343 |
| 100 | 3300005334 | Ga0068869_100059568 | Ga0068869_1000595685 | 343 |
| 101 | 3300005335 | Ga0070666_10001844 | Ga0070666_100018449 | 343 |
| 102 | 3300005353 | Ga0070669_100170841 | Ga0070669_1001708412 | 343 |
| 103 | 3300005365 | Ga0070688_100072787 | Ga0070688_1000727871 | 343 |
| 104 | 3300005367 | Ga0070667_100000989 | Ga0070667_1000009893 | 343 |
| 105 | 3300005367 | Ga0070667_100119736 | Ga0070667_1001197362 | 343 |
| 106 | 3300005466 | Ga0070685_10082546 | Ga0070685_100825462 | 343 |
| 107 | 3300005518 | Ga0070699_100008025 | Ga0070699_10000802510 | 343 |
| 108 | 3300005539 | Ga0068853_100397880 | Ga0068853_1003978801 | 343 |
| 109 | 3300005543 | Ga0070672_100139502 | Ga0070672_1001395023 | 343 |
| 110 | 3300005548 | Ga0070665_100059083 | Ga0070665_1000590833 | 343 |
| 111 | 3300005614 | Ga0068856_100006029 | Ga0068856_1000060298 | 343 |
| 112 | 3300005617 | Ga0068859_100000645 | Ga0068859_10000064515 | 343 |
| 113 | 3300005617 | Ga0068859_100179315 | Ga0068859_1001793152 | 343 |
| 114 | 3300005618 | Ga0068864_100023937 | Ga0068864_1000239376 | 343 |
| 115 | 3300005842 | Ga0068858_100021235 | Ga0068858_1000212353 | 343 |
| 116 | 3300005843 | Ga0068860_100010562 | Ga0068860_1000105625 | 343 |
| 117 | 3300005985 | Ga0081539_10000096 | Ga0081539_1000009693 | 343 |
| 118 | 3300005985 | Ga0081539_10002353 | Ga0081539_1000235323 | 343 |
| 119 | 3300006237 | Ga0097621_100045464 | Ga0097621_1000454642 | 343 |
| 120 | 3300006237 | Ga0097621_100077347 | Ga0097621_1000773472 | 343 |
| 121 | 3300006358 | Ga0068871_100059193 | Ga0068871_1000591932 | 343 |
| 122 | 3300006844 | Ga0075428_100098297 | Ga0075428_1000982973 | 343 |
| 123 | 3300006852 | Ga0075433_10000839 | Ga0075433_1000083910 | 343 |
| 124 | 3300006852 | Ga0075433_10130467 | Ga0075433_101304672 | 343 |
| 125 | 3300006852 | Ga0075433_10189122 | Ga0075433_101891222 | 343 |
| 126 | 3300006871 | Ga0075434_100001347 | Ga0075434_1000013479 | 343 |
| 127 | 3300006871 | Ga0075434_100178425 | Ga0075434_1001784252 | 343 |
| 128 | 3300006881 | Ga0068865_100186468 | Ga0068865_1001864682 | 343 |
| 129 | 3300006931 | Ga0097620_100000645 | Ga0097620_10000064515 | 343 |
| 130 | 3300006931 | Ga0097620_100179304 | Ga0097620_1001793044 | 343 |
| 131 | 3300009094 | Ga0111539_10001789 | Ga0111539_1000178924 | 343 |
| 132 | 3300009094 | Ga0111539_10010482 | Ga0111539_100104825 | 343 |
| 133 | 3300009177 | Ga0105248_10026112 | Ga0105248_100261124 | 343 |
| 134 | 3300009553 | Ga0105249_10107994 | Ga0105249_101079942 | 343 |
| 135 | 3300013308 | Ga0157375_10001332 | Ga0157375_100013324 | 343 |
| 136 | 3300013308 | Ga0157375_10072570 | Ga0157375_100725704 | 343 |
| 137 | 3300014325 | Ga0163163_10000017 | Ga0163163_1000001775 | 343 |
| 138 | 3300014968 | Ga0157379_10034512 | Ga0157379_100345122 | 343 |
| 139 | 3300025925 | Ga0207650_10027932 | Ga0207650_100279326 | 343 |
| 140 | 3300025938 | Ga0207704_10019970 | Ga0207704_100199702 | 343 |
| 141 | 3300025940 | Ga0207691_10042995 | Ga0207691_100429954 | 343 |
| 142 | 3300025941 | Ga0207711_10000511 | Ga0207711_1000051133 | 343 |
| 143 | 3300025961 | Ga0207712_10022729 | Ga0207712_100227295 | 343 |
| 144 | 3300025972 | Ga0207668_10278611 | Ga0207668_102786112 | 343 |
| 145 | 3300025986 | Ga0207658_10049176 | Ga0207658_100491762 | 343 |
| 146 | 3300025986 | Ga0207658_10073613 | Ga0207658_100736132 | 343 |
| 147 | 3300026075 | Ga0207708_10097167 | Ga0207708_100971672 | 343 |
| 148 | 3300026088 | Ga0207641_10110284 | Ga0207641_101102842 | 343 |
| 149 | 3300026095 | Ga0207676_10016426 | Ga0207676_100164266 | 343 |
| 150 | 3300027907 | Ga0207428_10000849 | Ga0207428_1000084911 | 343 |
| 151 | 3300027907 | Ga0207428_10209042 | Ga0207428_102090422 | 343 |
| 152 | 3300028379 | Ga0268266_10035802 | Ga0268266_100358022 | 343 |
| 153 | 3300028379 | Ga0268266_10143107 | Ga0268266_101431074 | 343 |
| 154 | 3300028381 | Ga0268264_10175418 | Ga0268264_101754182 | 343 |
| 155 | 3300035086 | Ga0373934_0007068 | Ga0373934_0007068_749_1789 | 343 |
| 156 | 3300035695 | Ga0373927_0010876 | Ga0373927_0010876_2833_3873 | 343 |
| 157 | 3300035724 | Ga0373933_0023125 | Ga0373933_0023125_1053_2093 | 343 |
| 158 | 3300035725 | Ga0373947_0000399 | Ga0373947_0000399_9429_10469 | 343 |
| 159 | 3300036401 | Ga0373937_0000499 | Ga0373937_0000499_22013_23053 | 343 |
| 160 | 3300037068 | Ga0373925_0001209 | Ga0373925_0001209_10340_11380 | 343 |
| 161 | 3300044712 | Ga0453684_0723447 | Ga0453684_0723447_17_1057 | 343 |
| 162 | 3300045051 | Ga0451576_0008042 | Ga0451576_0008042_8395_9435 | 343 |
| 163 | 3300045051 | Ga0451576_0298918 | Ga0451576_0298918_433_1473 | 343 |
| 164 | 3300046462 | Ga0495651_0026908 | Ga0495651_0026908_1478_2518 | 343 |
| 165 | 3300048903 | Ga0496100_0045682 | Ga0496100_0045682_1726_2802 | 343 |
| 166 | 3300048905 | Ga0496102_0017609 | Ga0496102_0017609_1101_2177 | 343 |
| 167 | 3300048906 | Ga0496103_0039199 | Ga0496103_0039199_171_1247 | 343 |
| 168 | 3300048907 | Ga0496104_0044478 | Ga0496104_0044478_1879_2925 | 343 |
| 169 | 3300048909 | Ga0496106_0000977 | Ga0496106_0000977_2513_3589 | 343 |
| 170 | 3300048911 | Ga0496108_0119269 | Ga0496108_0119269_342_1388 | 343 |
| 171 | 3300048912 | Ga0496109_0001591 | Ga0496109_0001591_15098_16144 | 343 |
| 172 | 3300048913 | Ga0496110_0003223 | Ga0496110_0003223_9360_10406 | 343 |
| 173 | 3300048914 | Ga0496111_0089134 | Ga0496111_0089134_987_2033 | 343 |
| 174 | 3300048914 | Ga0496111_0118267 | Ga0496111_0118267_859_1935 | 343 |
| 175 | 3300048915 | Ga0496112_0001633 | Ga0496112_0001633_9858_10904 | 343 |
| 176 | 3300050511 | nmdc:mga08y16_175386_c1 | nmdc:mga08y16_175386_c1_656_1699 | 343 |
| 177 | 3300050511 | nmdc:mga08y16_257149_c1 | nmdc:mga08y16_257149_c1_468_1508 | 343 |
| 178 | 3300050511 | nmdc:mga08y16_8329_c1 | nmdc:mga08y16_8329_c1_7512_8552 | 343 |
| 179 | 3300050512 | nmdc:mga0n895_265611_c1 | nmdc:mga0n895_265611_c1_624_1664 | 343 |
| 180 | 3300050512 | nmdc:mga0n895_477_c1 | nmdc:mga0n895_477_c1_14565_15605 | 343 |
| 181 | 3300050515 | nmdc:mga0a205_255771_c1 | nmdc:mga0a205_255771_c1_201_1241 | 343 |
| 182 | 3300050515 | nmdc:mga0a205_53455_c1 | nmdc:mga0a205_53455_c1_436_1476 | 343 |
| 183 | 3300050515 | nmdc:mga0a205_646_c1 | nmdc:mga0a205_646_c1_22781_23821 | 343 |
| 184 | 3300053077 | Ga0495601_0109654 | Ga0495601_0109654_510_1550 | 343 |
| 185 | 3300003203 | JGI25406J46586_10000120 | JGI25406J46586_1000012025 | 344 |
| 186 | 3300005289 | Ga0065704_10105622 | Ga0065704_101056222 | 344 |
| 187 | 3300005290 | Ga0065712_10004968 | Ga0065712_100049685 | 344 |
| 188 | 3300005290 | Ga0065712_10078549 | Ga0065712_100785494 | 344 |
| 189 | 3300005293 | Ga0065715_10094426 | Ga0065715_100944261 | 344 |
| 190 | 3300005295 | Ga0065707_10120897 | Ga0065707_101208971 | 344 |
| 191 | 3300005328 | Ga0070676_10007368 | Ga0070676_100073682 | 344 |
| 192 | 3300005329 | Ga0070683_100000500 | Ga0070683_10000050020 | 344 |
| 193 | 3300005329 | Ga0070683_100193003 | Ga0070683_1001930032 | 344 |
| 194 | 3300005331 | Ga0070670_100063835 | Ga0070670_1000638352 | 344 |
| 195 | 3300005331 | Ga0070670_100096963 | Ga0070670_1000969632 | 344 |
| 196 | 3300005331 | Ga0070670_100242154 | Ga0070670_1002421542 | 344 |
| 197 | 3300005333 | Ga0070677_10001312 | Ga0070677_100013124 | 344 |
| 198 | 3300005334 | Ga0068869_100030640 | Ga0068869_1000306404 | 344 |
| 199 | 3300005335 | Ga0070666_10028715 | Ga0070666_100287152 | 344 |
| 200 | 3300005335 | Ga0070666_10073997 | Ga0070666_100739972 | 344 |
| 201 | 3300005340 | Ga0070689_100011278 | Ga0070689_1000112782 | 344 |
| 202 | 3300005340 | Ga0070689_100101741 | Ga0070689_1001017412 | 344 |
| 203 | 3300005343 | Ga0070687_100015200 | Ga0070687_1000152005 | 344 |
| 204 | 3300005347 | Ga0070668_100070586 | Ga0070668_1000705862 | 344 |
| 205 | 3300005347 | Ga0070668_100165941 | Ga0070668_1001659412 | 344 |
| 206 | 3300005353 | Ga0070669_100016441 | Ga0070669_1000164412 | 344 |
| 207 | 3300005353 | Ga0070669_100027792 | Ga0070669_1000277922 | 344 |
| 208 | 3300005353 | Ga0070669_100057480 | Ga0070669_1000574802 | 344 |
| 209 | 3300005354 | Ga0070675_100017971 | Ga0070675_1000179714 | 344 |
| 210 | 3300005354 | Ga0070675_100041501 | Ga0070675_1000415013 | 344 |
| 211 | 3300005354 | Ga0070675_100143650 | Ga0070675_1001436502 | 344 |
| 212 | 3300005355 | Ga0070671_100014366 | Ga0070671_1000143662 | 344 |
| 213 | 3300005355 | Ga0070671_100331668 | Ga0070671_1003316682 | 344 |
| 214 | 3300005356 | Ga0070674_100003802 | Ga0070674_1000038023 | 344 |
| 215 | 3300005356 | Ga0070674_100070771 | Ga0070674_1000707714 | 344 |
| 216 | 3300005364 | Ga0070673_100021855 | Ga0070673_1000218552 | 344 |
| 217 | 3300005364 | Ga0070673_100031830 | Ga0070673_1000318305 | 344 |
| 218 | 3300005365 | Ga0070688_100020051 | Ga0070688_1000200512 | 344 |
| 219 | 3300005366 | Ga0070659_100123168 | Ga0070659_1001231682 | 344 |
| 220 | 3300005367 | Ga0070667_100021437 | Ga0070667_1000214376 | 344 |
| 221 | 3300005367 | Ga0070667_100399131 | Ga0070667_1003991312 | 344 |
| 222 | 3300005438 | Ga0070701_10021316 | Ga0070701_100213162 | 344 |
| 223 | 3300005441 | Ga0070700_100070430 | Ga0070700_1000704301 | 344 |
| 224 | 3300005455 | Ga0070663_100061488 | Ga0070663_1000614883 | 344 |
| 225 | 3300005455 | Ga0070663_100088734 | Ga0070663_1000887342 | 344 |
| 226 | 3300005457 | Ga0070662_100006443 | Ga0070662_1000064432 | 344 |
| 227 | 3300005466 | Ga0070685_10012465 | Ga0070685_100124655 | 344 |
| 228 | 3300005535 | Ga0070684_100001365 | Ga0070684_1000013658 | 344 |
| 229 | 3300005539 | Ga0068853_100228297 | Ga0068853_1002282971 | 344 |
| 230 | 3300005543 | Ga0070672_100023539 | Ga0070672_1000235392 | 344 |
| 231 | 3300005543 | Ga0070672_100032696 | Ga0070672_1000326965 | 344 |
| 232 | 3300005543 | Ga0070672_100190193 | Ga0070672_1001901932 | 344 |
| 233 | 3300005544 | Ga0070686_100015561 | Ga0070686_1000155612 | 344 |
| 234 | 3300005548 | Ga0070665_100030190 | Ga0070665_1000301907 | 344 |
| 235 | 3300005548 | Ga0070665_100054864 | Ga0070665_1000548642 | 344 |
| 236 | 3300005564 | Ga0070664_100008009 | Ga0070664_1000080096 | 344 |
| 237 | 3300005564 | Ga0070664_100015875 | Ga0070664_1000158752 | 344 |
| 238 | 3300005564 | Ga0070664_100016791 | Ga0070664_1000167912 | 344 |
| 239 | 3300005617 | Ga0068859_100206957 | Ga0068859_1002069572 | 344 |
| 240 | 3300005618 | Ga0068864_100016681 | Ga0068864_1000166815 | 344 |
| 241 | 3300005618 | Ga0068864_100227617 | Ga0068864_1002276171 | 344 |
| 242 | 3300005618 | Ga0068864_100231356 | Ga0068864_1002313562 | 344 |
| 243 | 3300005719 | Ga0068861_100011509 | Ga0068861_1000115093 | 344 |
| 244 | 3300005719 | Ga0068861_100028741 | Ga0068861_1000287413 | 344 |
| 245 | 3300005719 | Ga0068861_100298921 | Ga0068861_1002989211 | 344 |
| 246 | 3300005840 | Ga0068870_10027107 | Ga0068870_100271074 | 344 |
| 247 | 3300005841 | Ga0068863_100002061 | Ga0068863_10000206114 | 344 |
| 248 | 3300005841 | Ga0068863_100145040 | Ga0068863_1001450402 | 344 |
| 249 | 3300005842 | Ga0068858_100118421 | Ga0068858_1001184212 | 344 |
| 250 | 3300005843 | Ga0068860_100035124 | Ga0068860_1000351242 | 344 |
| 251 | 3300005844 | Ga0068862_100013690 | Ga0068862_1000136905 | 344 |
| 252 | 3300005985 | Ga0081539_10000024 | Ga0081539_1000002430 | 344 |
| 253 | 3300006042 | Ga0075368_10041328 | Ga0075368_100413282 | 344 |
| 254 | 3300006195 | Ga0075366_10008607 | Ga0075366_100086072 | 344 |
| 255 | 3300006237 | Ga0097621_100031081 | Ga0097621_1000310812 | 344 |
| 256 | 3300006237 | Ga0097621_100052224 | Ga0097621_1000522242 | 344 |
| 257 | 3300006358 | Ga0068871_100014012 | Ga0068871_1000140124 | 344 |
| 258 | 3300006844 | Ga0075428_100004648 | Ga0075428_1000046483 | 344 |
| 259 | 3300006844 | Ga0075428_100178684 | Ga0075428_1001786842 | 344 |
| 260 | 3300006846 | Ga0075430_100019579 | Ga0075430_1000195795 | 344 |
| 261 | 3300006846 | Ga0075430_100043749 | Ga0075430_1000437492 | 344 |
| 262 | 3300006847 | Ga0075431_100001687 | Ga0075431_1000016879 | 344 |
| 263 | 3300006847 | Ga0075431_100020699 | Ga0075431_1000206993 | 344 |
| 264 | 3300006847 | Ga0075431_100356979 | Ga0075431_1003569791 | 344 |
| 265 | 3300006852 | Ga0075433_10169105 | Ga0075433_101691052 | 344 |
| 266 | 3300006880 | Ga0075429_100014281 | Ga0075429_1000142812 | 344 |
| 267 | 3300006880 | Ga0075429_100143545 | Ga0075429_1001435451 | 344 |
| 268 | 3300006881 | Ga0068865_100158037 | Ga0068865_1001580372 | 344 |
| 269 | 3300006931 | Ga0097620_100053081 | Ga0097620_1000530814 | 344 |
| 270 | 3300006931 | Ga0097620_100206945 | Ga0097620_1002069452 | 344 |
| 271 | 3300007076 | Ga0075435_100051099 | Ga0075435_1000510992 | 344 |
| 272 | 3300009094 | Ga0111539_10002263 | Ga0111539_1000226319 | 344 |
| 273 | 3300009094 | Ga0111539_10002439 | Ga0111539_100024398 | 344 |
| 274 | 3300009094 | Ga0111539_10015398 | Ga0111539_100153985 | 344 |
| 275 | 3300009094 | Ga0111539_10028916 | Ga0111539_100289161 | 344 |
| 276 | 3300009094 | Ga0111539_10106604 | Ga0111539_101066044 | 344 |
| 277 | 3300009094 | Ga0111539_10150684 | Ga0111539_101506843 | 344 |
| 278 | 3300009094 | Ga0111539_10183879 | Ga0111539_101838792 | 344 |
| 279 | 3300009094 | Ga0111539_10258764 | Ga0111539_102587642 | 344 |
| 280 | 3300009098 | Ga0105245_10153449 | Ga0105245_101534493 | 344 |
| 281 | 3300009098 | Ga0105245_10336731 | Ga0105245_103367311 | 344 |
| 282 | 3300009147 | Ga0114129_10000174 | Ga0114129_1000017461 | 344 |
| 283 | 3300009147 | Ga0114129_10003221 | Ga0114129_1000322112 | 344 |
| 284 | 3300009147 | Ga0114129_10025369 | Ga0114129_100253694 | 344 |
| 285 | 3300009147 | Ga0114129_10030336 | Ga0114129_100303367 | 344 |
| 286 | 3300009177 | Ga0105248_10021539 | Ga0105248_100215396 | 344 |
| 287 | 3300009177 | Ga0105248_10061095 | Ga0105248_100610953 | 344 |
| 288 | 3300009177 | Ga0105248_10078331 | Ga0105248_100783316 | 344 |
| 289 | 3300009177 | Ga0105248_10779426 | Ga0105248_107794261 | 344 |
| 290 | 3300009545 | Ga0105237_10426864 | Ga0105237_104268641 | 344 |
| 291 | 3300009553 | Ga0105249_10001517 | Ga0105249_1000151716 | 344 |
| 292 | 3300011119 | Ga0105246_10025235 | Ga0105246_100252352 | 344 |
| 293 | 3300013102 | Ga0157371_10145906 | Ga0157371_101459062 | 344 |
| 294 | 3300013296 | Ga0157374_10100314 | Ga0157374_101003142 | 344 |
| 295 | 3300013296 | Ga0157374_10295934 | Ga0157374_102959342 | 344 |
| 296 | 3300013297 | Ga0157378_10265204 | Ga0157378_102652042 | 344 |
| 297 | 3300013306 | Ga0163162_10068321 | Ga0163162_100683217 | 344 |
| 298 | 3300013308 | Ga0157375_10046551 | Ga0157375_100465513 | 344 |
| 299 | 3300013308 | Ga0157375_10241713 | Ga0157375_102417132 | 344 |
| 300 | 3300014325 | Ga0163163_10378098 | Ga0163163_103780981 | 344 |
| 301 | 3300014326 | Ga0157380_10017590 | Ga0157380_100175904 | 344 |
| 302 | 3300014326 | Ga0157380_10417945 | Ga0157380_104179451 | 344 |
| 303 | 3300014969 | Ga0157376_10010121 | Ga0157376_100101212 | 344 |
| 304 | 3300017792 | Ga0163161_10029497 | Ga0163161_100294972 | 344 |
| 305 | 3300025315 | Ga0207697_10010226 | Ga0207697_100102262 | 344 |
| 306 | 3300025315 | Ga0207697_10100831 | Ga0207697_101008311 | 344 |
| 307 | 3300025893 | Ga0207682_10003116 | Ga0207682_100031169 | 344 |
| 308 | 3300025893 | Ga0207682_10003998 | Ga0207682_100039983 | 344 |
| 309 | 3300025901 | Ga0207688_10006597 | Ga0207688_100065975 | 344 |
| 310 | 3300025901 | Ga0207688_10010284 | Ga0207688_100102842 | 344 |
| 311 | 3300025907 | Ga0207645_10013270 | Ga0207645_100132705 | 344 |
| 312 | 3300025907 | Ga0207645_10020774 | Ga0207645_100207742 | 344 |
| 313 | 3300025908 | Ga0207643_10000719 | Ga0207643_1000071914 | 344 |
| 314 | 3300025908 | Ga0207643_10063566 | Ga0207643_100635662 | 344 |
| 315 | 3300025918 | Ga0207662_10013224 | Ga0207662_100132242 | 344 |
| 316 | 3300025923 | Ga0207681_10329861 | Ga0207681_103298611 | 344 |
| 317 | 3300025925 | Ga0207650_10011577 | Ga0207650_100115773 | 344 |
| 318 | 3300025925 | Ga0207650_10019377 | Ga0207650_100193772 | 344 |
| 319 | 3300025925 | Ga0207650_10311843 | Ga0207650_103118431 | 344 |
| 320 | 3300025926 | Ga0207659_10023305 | Ga0207659_100233053 | 344 |
| 321 | 3300025926 | Ga0207659_10033346 | Ga0207659_100333463 | 344 |
| 322 | 3300025933 | Ga0207706_10054786 | Ga0207706_100547863 | 344 |
| 323 | 3300025936 | Ga0207670_10043647 | Ga0207670_100436474 | 344 |
| 324 | 3300025937 | Ga0207669_10005017 | Ga0207669_100050171 | 344 |
| 325 | 3300025940 | Ga0207691_10038899 | Ga0207691_100388991 | 344 |
| 326 | 3300025940 | Ga0207691_10042996 | Ga0207691_100429962 | 344 |
| 327 | 3300025940 | Ga0207691_10046064 | Ga0207691_100460645 | 344 |
| 328 | 3300025940 | Ga0207691_10059785 | Ga0207691_100597851 | 344 |
| 329 | 3300025940 | Ga0207691_10125234 | Ga0207691_101252342 | 344 |
| 330 | 3300025942 | Ga0207689_10034173 | Ga0207689_100341732 | 344 |
| 331 | 3300025942 | Ga0207689_10055184 | Ga0207689_100551842 | 344 |
| 332 | 3300025944 | Ga0207661_10005594 | Ga0207661_100055942 | 344 |
| 333 | 3300025945 | Ga0207679_10007747 | Ga0207679_100077476 | 344 |
| 334 | 3300025960 | Ga0207651_10007460 | Ga0207651_100074606 | 344 |
| 335 | 3300025960 | Ga0207651_10034440 | Ga0207651_100344402 | 344 |
| 336 | 3300025961 | Ga0207712_10301351 | Ga0207712_103013512 | 344 |
| 337 | 3300025986 | Ga0207658_10028612 | Ga0207658_100286123 | 344 |
| 338 | 3300026067 | Ga0207678_10087667 | Ga0207678_100876672 | 344 |
| 339 | 3300026067 | Ga0207678_10181110 | Ga0207678_101811102 | 344 |
| 340 | 3300026075 | Ga0207708_10023376 | Ga0207708_100233763 | 344 |
| 341 | 3300026088 | Ga0207641_10285838 | Ga0207641_102858382 | 344 |
| 342 | 3300026095 | Ga0207676_10045247 | Ga0207676_100452474 | 344 |
| 343 | 3300026095 | Ga0207676_10045901 | Ga0207676_100459012 | 344 |
| 344 | 3300026116 | Ga0207674_10423926 | Ga0207674_104239262 | 344 |
| 345 | 3300026118 | Ga0207675_100012281 | Ga0207675_1000122812 | 344 |
| 346 | 3300026118 | Ga0207675_100084735 | Ga0207675_1000847352 | 344 |
| 347 | 3300026121 | Ga0207683_10012400 | Ga0207683_100124003 | 344 |
| 348 | 3300027907 | Ga0207428_10004387 | Ga0207428_1000438711 | 344 |
| 349 | 3300027907 | Ga0207428_10010923 | Ga0207428_100109233 | 344 |
| 350 | 3300027907 | Ga0207428_10011180 | Ga0207428_100111803 | 344 |
| 351 | 3300027907 | Ga0207428_10025773 | Ga0207428_100257733 | 344 |
| 352 | 3300028379 | Ga0268266_10140740 | Ga0268266_101407402 | 344 |
| 353 | 3300028380 | Ga0268265_10306804 | Ga0268265_103068041 | 344 |
| 354 | 3300028666 | Ga0265336_10001878 | Ga0265336_100018782 | 344 |
| 355 | 3300031344 | Ga0265316_10001007 | Ga0265316_1000100717 | 344 |
| 356 | 3300031731 | Ga0307405_10204809 | Ga0307405_102048092 | 344 |
| 357 | 3300035112 | Ga0373932_0050832 | Ga0373932_0050832_71_1123 | 344 |
| 358 | 3300042436 | Ga0439435_0030075 | Ga0439435_0030075_300_1352 | 344 |
| 359 | 3300042439 | Ga0439464_0036666 | Ga0439464_0036666_287_1330 | 344 |
| 360 | 3300042439 | Ga0439464_0043567 | Ga0439464_0043567_101_1147 | 344 |
| 361 | 3300045051 | Ga0451576_0025872 | Ga0451576_0025872_343_1395 | 344 |
| 362 | 3300046460 | Ga0495638_0007866 | Ga0495638_0007866_1193_2236 | 344 |
| 363 | 3300046678 | Ga0495599_0096900 | Ga0495599_0096900_413_1474 | 344 |
| 364 | 3300046689 | Ga0495613_0166662 | Ga0495613_0166662_61_1122 | 344 |
| 365 | 3300047471 | Ga0495684_0057472 | Ga0495684_0057472_422_1465 | 344 |
| 366 | 3300047471 | Ga0495684_0105529 | Ga0495684_0105529_249_1310 | 344 |
| 367 | 3300048912 | Ga0496109_0002883 | Ga0496109_0002883_7510_8553 | 344 |
| 368 | 3300048915 | Ga0496112_0000913 | Ga0496112_0000913_12751_13794 | 344 |
| 369 | 3300049570 | Ga0501033_0119413 | Ga0501033_0119413_330_1376 | 344 |
| 370 | 3300049575 | Ga0501039_0082901 | Ga0501039_0082901_991_2037 | 344 |
| 371 | 3300049576 | Ga0501040_0041322 | Ga0501040_0041322_1086_2171 | 344 |
| 372 | 3300049576 | Ga0501040_0052315 | Ga0501040_0052315_1613_2659 | 344 |
| 373 | 3300049577 | Ga0501041_0030537 | Ga0501041_0030537_757_1803 | 344 |
| 374 | 3300049578 | Ga0501042_0009454 | Ga0501042_0009454_2591_3637 | 344 |
| 375 | 3300049578 | Ga0501042_0183726 | Ga0501042_0183726_343_1386 | 344 |
| 376 | 3300049580 | Ga0501046_0060979 | Ga0501046_0060979_412_1458 | 344 |
| 377 | 3300049586 | Ga0501070_0222497 | Ga0501070_0222497_299_1342 | 344 |
| 378 | 3300049587 | Ga0501071_0159208 | Ga0501071_0159208_530_1573 | 344 |
| 379 | 3300049589 | Ga0501073_0101130 | Ga0501073_0101130_435_1478 | 344 |
| 380 | 3300049590 | Ga0501074_0299895 | Ga0501074_0299895_15_1100 | 344 |
| 381 | 3300049591 | Ga0501075_0037535 | Ga0501075_0037535_2554_3600 | 344 |
| 382 | 3300049591 | Ga0501075_0068544 | Ga0501075_0068544_1451_2536 | 344 |
| 383 | 3300049591 | Ga0501075_0179191 | Ga0501075_0179191_51_1097 | 344 |
| 384 | 3300049742 | Ga0501080_0060984 | Ga0501080_0060984_1168_2253 | 344 |
| 385 | 3300050491 | nmdc:mga00v17_134312_c1 | nmdc:mga00v17_134312_c1_401_1441 | 344 |
| 386 | 3300050494 | nmdc:mga06z11_77406_c1 | nmdc:mga06z11_77406_c1_277_1317 | 344 |
| 387 | 3300050496 | nmdc:mga07m45_89282_c1 | nmdc:mga07m45_89282_c1_594_1634 | 344 |
| 388 | 3300050507 | nmdc:mga05p37_124034_c1 | nmdc:mga05p37_124034_c1_2024_3064 | 344 |
| 389 | 3300050507 | nmdc:mga05p37_204_c1 | nmdc:mga05p37_204_c1_9671_10714 | 344 |
| 390 | 3300050507 | nmdc:mga05p37_31808_c1 | nmdc:mga05p37_31808_c1_2223_3275 | 344 |
| 391 | 3300050507 | nmdc:mga05p37_7226_c1 | nmdc:mga05p37_7226_c1_5189_6235 | 344 |
| 392 | 3300050508 | nmdc:mga09592_117816_c1 | nmdc:mga09592_117816_c1_1059_2099 | 344 |
| 393 | 3300050508 | nmdc:mga09592_14652_c1 | nmdc:mga09592_14652_c1_4558_5610 | 344 |
| 394 | 3300050509 | nmdc:mga0qj67_1031_c1 | nmdc:mga0qj67_1031_c1_15663_16715 | 344 |
| 395 | 3300050509 | nmdc:mga0qj67_126273_c1 | nmdc:mga0qj67_126273_c1_840_1886 | 344 |
| 396 | 3300050509 | nmdc:mga0qj67_16036_c1 | nmdc:mga0qj67_16036_c1_804_1850 | 344 |
| 397 | 3300050509 | nmdc:mga0qj67_31718_c1 | nmdc:mga0qj67_31718_c1_459_1505 | 344 |
| 398 | 3300050509 | nmdc:mga0qj67_3991_c1 | nmdc:mga0qj67_3991_c1_2259_3299 | 344 |
| 399 | 3300050510 | nmdc:mga06r32_133540_c1 | nmdc:mga06r32_133540_c1_113_1153 | 344 |
| 400 | 3300050510 | nmdc:mga06r32_2396_c1 | nmdc:mga06r32_2396_c1_5814_6866 | 344 |
| 401 | 3300050510 | nmdc:mga06r32_38284_c1 | nmdc:mga06r32_38284_c1_1421_2467 | 344 |
| 402 | 3300050510 | nmdc:mga06r32_74634_c1 | nmdc:mga06r32_74634_c1_79_1125 | 344 |
| 403 | 3300050510 | nmdc:mga06r32_95014_c1 | nmdc:mga06r32_95014_c1_1664_2710 | 344 |
| 404 | 3300050511 | nmdc:mga08y16_15221_c1 | nmdc:mga08y16_15221_c1_4132_5175 | 344 |
| 405 | 3300050511 | nmdc:mga08y16_66229_c1 | nmdc:mga08y16_66229_c1_1971_3023 | 344 |
| 406 | 3300050513 | nmdc:mga0rr50_152554_c1 | nmdc:mga0rr50_152554_c1_567_1619 | 344 |
| 407 | 3300050515 | nmdc:mga0a205_103159_c1 | nmdc:mga0a205_103159_c1_539_1582 | 344 |
| 408 | 3300050515 | nmdc:mga0a205_1627_c1 | nmdc:mga0a205_1627_c1_7247_8299 | 344 |
| 409 | 3300054114 | Ga0501084_0029452 | Ga0501084_0029452_1993_3039 | 344 |
| 410 | 3300060353 | Ga0501082_0109866 | Ga0501082_0109866_1320_2366 | 344 |
| 411 | 3300061734 | Ga0530510_0011389 | Ga0530510_0011389_4929_5975 | 344 |
| 412 | 3300000546 | LJNas_1000739 | LJNas_10007392 | 345 |
| 413 | 3300005327 | Ga0070658_10159524 | Ga0070658_101595242 | 345 |
| 414 | 3300005328 | Ga0070676_10176049 | Ga0070676_101760491 | 345 |
| 415 | 3300005337 | Ga0070682_100296611 | Ga0070682_1002966111 | 345 |
| 416 | 3300005339 | Ga0070660_100187722 | Ga0070660_1001877222 | 345 |
| 417 | 3300005354 | Ga0070675_100179372 | Ga0070675_1001793722 | 345 |
| 418 | 3300005364 | Ga0070673_100005375 | Ga0070673_1000053757 | 345 |
| 419 | 3300005364 | Ga0070673_100331249 | Ga0070673_1003312492 | 345 |
| 420 | 3300005436 | Ga0070713_100008567 | Ga0070713_1000085677 | 345 |
| 421 | 3300005444 | Ga0070694_100011589 | Ga0070694_1000115892 | 345 |
| 422 | 3300005456 | Ga0070678_100144994 | Ga0070678_1001449942 | 345 |
| 423 | 3300005458 | Ga0070681_10073144 | Ga0070681_100731442 | 345 |
| 424 | 3300005543 | Ga0070672_100014063 | Ga0070672_1000140633 | 345 |
| 425 | 3300005543 | Ga0070672_100048247 | Ga0070672_1000482472 | 345 |
| 426 | 3300005545 | Ga0070695_100188016 | Ga0070695_1001880162 | 345 |
| 427 | 3300005546 | Ga0070696_100081432 | Ga0070696_1000814322 | 345 |
| 428 | 3300005548 | Ga0070665_100539407 | Ga0070665_1005394071 | 345 |
| 429 | 3300005564 | Ga0070664_100055676 | Ga0070664_1000556762 | 345 |
| 430 | 3300005617 | Ga0068859_100084288 | Ga0068859_1000842882 | 345 |
| 431 | 3300005618 | Ga0068864_100005866 | Ga0068864_10000586611 | 345 |
| 432 | 3300005719 | Ga0068861_100011576 | Ga0068861_1000115763 | 345 |
| 433 | 3300005841 | Ga0068863_100002762 | Ga0068863_10000276211 | 345 |
| 434 | 3300005841 | Ga0068863_100276342 | Ga0068863_1002763422 | 345 |
| 435 | 3300005841 | Ga0068863_100492124 | Ga0068863_1004921241 | 345 |
| 436 | 3300005844 | Ga0068862_100205979 | Ga0068862_1002059792 | 345 |
| 437 | 3300006358 | Ga0068871_100133883 | Ga0068871_1001338832 | 345 |
| 438 | 3300006852 | Ga0075433_10020584 | Ga0075433_100205843 | 345 |
| 439 | 3300006914 | Ga0075436_100000671 | Ga0075436_1000006716 | 345 |
| 440 | 3300006931 | Ga0097620_100084282 | Ga0097620_1000842823 | 345 |
| 441 | 3300009093 | Ga0105240_10120425 | Ga0105240_101204254 | 345 |
| 442 | 3300009094 | Ga0111539_10559582 | Ga0111539_105595821 | 345 |
| 443 | 3300009147 | Ga0114129_10007540 | Ga0114129_100075407 | 345 |
| 444 | 3300009176 | Ga0105242_10194146 | Ga0105242_101941462 | 345 |
| 445 | 3300009177 | Ga0105248_10082480 | Ga0105248_100824804 | 345 |
| 446 | 3300009553 | Ga0105249_10199642 | Ga0105249_101996421 | 345 |
| 447 | 3300013104 | Ga0157370_10137425 | Ga0157370_101374253 | 345 |
| 448 | 3300013296 | Ga0157374_10043570 | Ga0157374_100435702 | 345 |
| 449 | 3300013297 | Ga0157378_10025354 | Ga0157378_100253543 | 345 |
| 450 | 3300013306 | Ga0163162_10031787 | Ga0163162_100317875 | 345 |
| 451 | 3300013308 | Ga0157375_10024925 | Ga0157375_100249252 | 345 |
| 452 | 3300013308 | Ga0157375_10112204 | Ga0157375_101122044 | 345 |
| 453 | 3300014326 | Ga0157380_10076073 | Ga0157380_100760732 | 345 |
| 454 | 3300014745 | Ga0157377_10125469 | Ga0157377_101254692 | 345 |
| 455 | 3300022467 | Ga0224712_10040484 | Ga0224712_100404841 | 345 |
| 456 | 3300025907 | Ga0207645_10106312 | Ga0207645_101063122 | 345 |
| 457 | 3300025908 | Ga0207643_10006147 | Ga0207643_100061474 | 345 |
| 458 | 3300025912 | Ga0207707_10158044 | Ga0207707_101580443 | 345 |
| 459 | 3300025913 | Ga0207695_10389317 | Ga0207695_103893172 | 345 |
| 460 | 3300025919 | Ga0207657_10160399 | Ga0207657_101603992 | 345 |
| 461 | 3300025926 | Ga0207659_10004886 | Ga0207659_1000488610 | 345 |
| 462 | 3300025928 | Ga0207700_10220589 | Ga0207700_102205891 | 345 |
| 463 | 3300025929 | Ga0207664_10025948 | Ga0207664_100259482 | 345 |
| 464 | 3300025937 | Ga0207669_10143478 | Ga0207669_101434782 | 345 |
| 465 | 3300025940 | Ga0207691_10002949 | Ga0207691_100029491 | 345 |
| 466 | 3300025942 | Ga0207689_10011973 | Ga0207689_100119737 | 345 |
| 467 | 3300025942 | Ga0207689_10075399 | Ga0207689_100753992 | 345 |
| 468 | 3300025972 | Ga0207668_10197196 | Ga0207668_101971962 | 345 |
| 469 | 3300026089 | Ga0207648_10017784 | Ga0207648_100177844 | 345 |
| 470 | 3300026089 | Ga0207648_10081129 | Ga0207648_100811292 | 345 |
| 471 | 3300026118 | Ga0207675_100311116 | Ga0207675_1003111162 | 345 |
| 472 | 3300026121 | Ga0207683_10230455 | Ga0207683_102304551 | 345 |
| 473 | 3300026142 | Ga0207698_10136072 | Ga0207698_101360722 | 345 |
| 474 | 3300028380 | Ga0268265_10011891 | Ga0268265_100118911 | 345 |
| 475 | 3300028380 | Ga0268265_10062247 | Ga0268265_100622472 | 345 |
| 476 | 3300028381 | Ga0268264_10039306 | Ga0268264_100393061 | 345 |
| 477 | 3300031548 | Ga0307408_100270180 | Ga0307408_1002701802 | 345 |
| 478 | 3300031852 | Ga0307410_10158330 | Ga0307410_101583301 | 345 |
| 479 | 3300031852 | Ga0307410_10191713 | Ga0307410_101917132 | 345 |
| 480 | 3300036401 | Ga0373937_0087881 | Ga0373937_0087881_196_1239 | 345 |
| 481 | 3300039450 | Ga0436363_0210429 | Ga0436363_0210429_313_1368 | 345 |
| 482 | 3300042131 | Ga0450894_001200 | Ga0450894_001200_1420_2472 | 345 |
| 483 | 3300042184 | Ga0450908_010797 | Ga0450908_010797_445_1497 | 345 |
| 484 | 3300044712 | Ga0453684_0084396 | Ga0453684_0084396_748_1791 | 345 |
| 485 | 3300045051 | Ga0451576_0022914 | Ga0451576_0022914_169_1212 | 345 |
| 486 | 3300046459 | Ga0495629_0105033 | Ga0495629_0105033_390_1433 | 345 |
| 487 | 3300046463 | Ga0495653_0019761 | Ga0495653_0019761_778_1818 | 345 |
| 488 | 3300046678 | Ga0495599_0038251 | Ga0495599_0038251_817_1869 | 345 |
| 489 | 3300046681 | Ga0495647_0003002 | Ga0495647_0003002_3221_4282 | 345 |
| 490 | 3300046683 | Ga0495658_0023673 | Ga0495658_0023673_228_1271 | 345 |
| 491 | 3300046689 | Ga0495613_0099408 | Ga0495613_0099408_314_1357 | 345 |
| 492 | 3300047322 | Ga0495680_0130878 | Ga0495680_0130878_203_1246 | 345 |
| 493 | 3300047471 | Ga0495684_0032654 | Ga0495684_0032654_2785_3846 | 345 |
| 494 | 3300047471 | Ga0495684_0035673 | Ga0495684_0035673_1707_2759 | 345 |
| 495 | 3300048905 | Ga0496102_0106816 | Ga0496102_0106816_924_1970 | 345 |
| 496 | 3300048907 | Ga0496104_0016812 | Ga0496104_0016812_3469_4521 | 345 |
| 497 | 3300048908 | Ga0496105_0016285 | Ga0496105_0016285_1648_2700 | 345 |
| 498 | 3300048908 | Ga0496105_0246966 | Ga0496105_0246966_63_1115 | 345 |
| 499 | 3300048913 | Ga0496110_0189705 | Ga0496110_0189705_16_1059 | 345 |
| 500 | 3300048917 | Ga0496114_0001016 | Ga0496114_0001016_1691_2743 | 345 |
| 501 | 3300048917 | Ga0496114_0039519 | Ga0496114_0039519_1706_2758 | 345 |
| 502 | 3300048918 | Ga0496115_0020221 | Ga0496115_0020221_1975_3027 | 345 |
| 503 | 3300049571 | Ga0501034_0009195 | Ga0501034_0009195_655_1695 | 345 |
| 504 | 3300049770 | Ga0501273_006719 | Ga0501273_006719_164_1213 | 345 |
| 505 | 3300050507 | nmdc:mga05p37_21801_c1 | nmdc:mga05p37_21801_c1_967_2010 | 345 |
| 506 | 3300050512 | nmdc:mga0n895_75379_c1 | nmdc:mga0n895_75379_c1_2018_3061 | 345 |
| 507 | 3300050514 | nmdc:mga08x19_31958_c1 | nmdc:mga08x19_31958_c1_2061_3101 | 345 |
| 508 | 3300050514 | nmdc:mga08x19_8005_c1 | nmdc:mga08x19_8005_c1_950_1990 | 345 |
| 509 | 3300050515 | nmdc:mga0a205_43164_c1 | nmdc:mga0a205_43164_c1_972_2015 | 345 |
| 510 | 3300053077 | Ga0495601_0014121 | Ga0495601_0014121_2486_3538 | 345 |
| 511 | 3300053085 | Ga0495619_0005774 | Ga0495619_0005774_2292_3335 | 345 |
| 512 | 3300000546 | LJNas_1000423 | LJNas_10004236 | 346 |
| 513 | 3300005530 | Ga0070679_100280651 | Ga0070679_1002806512 | 346 |
| 514 | 3300005563 | Ga0068855_100209254 | Ga0068855_1002092542 | 346 |
| 515 | 3300006871 | Ga0075434_100071301 | Ga0075434_1000713012 | 346 |
| 516 | 3300006914 | Ga0075436_100244931 | Ga0075436_1002449312 | 346 |
| 517 | 3300009147 | Ga0114129_10320019 | Ga0114129_103200192 | 346 |
| 518 | 3300013105 | Ga0157369_10190988 | Ga0157369_101909881 | 346 |
| 519 | 3300013306 | Ga0163162_10298596 | Ga0163162_102985962 | 346 |
| 520 | 3300025917 | Ga0207660_10143056 | Ga0207660_101430561 | 346 |
| 521 | 3300025949 | Ga0207667_10195119 | Ga0207667_101951194 | 346 |
| 522 | 3300026067 | Ga0207678_10194996 | Ga0207678_101949962 | 346 |
| 523 | 3300037471 | Ga0395905_0068804 | Ga0395905_0068804_2063_3109 | 346 |
| 524 | 3300037471 | Ga0395905_0093407 | Ga0395905_0093407_1236_2282 | 346 |
| 525 | 3300039450 | Ga0436363_0869569 | Ga0436363_0869569_182_1228 | 346 |
| 526 | 3300044673 | Ga0453683_0135390 | Ga0453683_0135390_54_1097 | 346 |
| 527 | 3300044694 | Ga0466963_0067333 | Ga0466963_0067333_879_1934 | 346 |
| 528 | 3300045051 | Ga0451576_0123792 | Ga0451576_0123792_1361_2404 | 346 |
| 529 | 3300046543 | Ga0495645_0100539 | Ga0495645_0100539_898_1953 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cin-assembly3.cif.gz_F | crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica | 0.8236 | 53 | 210 |
| 6cio-assembly3.cif.gz_E | pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound | 0.822 | 53 | 210 |
| 6cip-assembly2.cif.gz_C | pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound | 0.8201 | 53 | 210 |
| 6n2o-assembly1.cif.gz_D | 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound | 0.813 | 18 | 341 |
| 6cio-assembly3.cif.gz_F | pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound | 0.8005 | 53 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53181_117_260_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8872 | 94 | 218 | 3.40.50.970 |
| af_Q57714_86_295_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8327 | 99 | 210 | 3.40.50.970 |
| af_Q57957_74_243_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8277 | 88 | 231 | 3.40.50.970 |
| af_Q2FZ04_70_219_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.8184 | 87 | 236 | 3.40.50.970 |
| af_Q2FZ04_70_219_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.7977 | 87 | 236 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D0UTH0-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9302 | 80 | 211 |
GO:0016625
GO:0030976 |
| AF-A0A0F8Y5H2-F1-model_v4 | Thiamine pyrophosphate enzyme TPP-binding domain-containing protein | 0.9193 | 7 | 199 |
GO:0016625
GO:0030976 |
| AF-A0A7C3GBX4-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.9163 | 7 | 209 |
GO:0016625
GO:0030976 GO:0044281 |
| AF-A0A535RG64-F1-model_v4 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | 0.9121 | 10 | 193 |
GO:0016625
GO:0030976 |
| AF-A0A1Z8VLM2-F1-model_v4 | 2-oxoglutarate ferredoxin oxidoreductase subunit beta | 0.9046 | 7 | 181 |
GO:0016625
GO:0030976 GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar