F459836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 337 | 500 | 222 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0037149|Ga0395900_0037149_2084_2899 |
| Length | 271 |
| Sequence | MDRNAHQSTIRKKESRRRSHHQPAVVGERWRNIDFLICLRNQIPTGKEMTMSLRIADIAPDFTADTTQGPISFHEWLGKDWGILFSHPKDYTPVCTTELGYMARLKPEFDKRGVKVIGLSVDPVEKHAGWAKDIAETQGMAPNFPMIGDPTLAVSQLYDMLPASAGNSADGRTAADNQTVRNVYVIGPDKKIKLVISYPMTTGRNFDEVLRVVDSLQLTAKHRLATPVNWKPGDDVIIAGSVSNDEAKQLYPQGWKEPKPYIRIVPQPVLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 2 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 3 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 4 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 5 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 6 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 7 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 8 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 9 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 10 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 11 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 12 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 13 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 14 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 15 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 16 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 17 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 18 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 19 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 20 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 21 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 22 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 23 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 24 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 25 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 26 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 27 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 28 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 29 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 30 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 31 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 32 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 33 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 37 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 109 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 110 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 229 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 230 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 323 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 328 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 331 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 336 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 337 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.14 |
| Metatranscriptomes | 0.38 |
| Isolates | 5.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.7 |
| Nodule | 3.78 |
| Rhizoplane | 1.7 |
| Rhizosphere | 82.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000209 | 3300000546 | Bacteria | 9945 |
| 2 | JGI25156J39149_1007878 | 3300002705 | Bacteria | 2745 |
| 3 | JGI25158J39367_1001640 | 3300002739 | Bacteria | 3856 |
| 4 | JGI25157J39369_1000850 | 3300002741 | Bacteria | 15042 |
| 5 | JGI25152J39213_1002594 | 3300002773 | Bacteria | 6745 |
| 6 | JGI25159J45721_1004297 | 3300002987 | Bacteria | 4772 |
| 7 | JGI25165J46597_1000037 | 3300003214 | Bacteria | 285722 |
| 8 | JGI25153J46596_10002702 | 3300003215 | Bacteria | 10115 |
| 9 | JGI25160J50197_1029079 | 3300003354 | Bacteria | 1470 |
| 10 | JGI25161J50226_1000300 | 3300003374 | Bacteria | 27867 |
| 11 | Ga0055526_1020804 | 3300003771 | Bacteria | 2313 |
| 12 | Ga0055524_1044178 | 3300003775 | Bacteria | 1086 |
| 13 | Ga0055528_1040988 | 3300003790 | Bacteria | 1037 |
| 14 | Ga0055543_1000065 | 3300004625 | Bacteria | 97333 |
| 15 | Ga0065165_1060654 | 3300005262 | Bacteria | 1037 |
| 16 | Ga0065715_10364253 | 3300005293 | Bacteria | 929 |
| 17 | Ga0070658_10006622 | 3300005327 | Bacteria | 9387 |
| 18 | Ga0070658_10453413 | 3300005327 | Bacteria | 1105 |
| 19 | Ga0070690_100006843 | 3300005330 | Bacteria | 6486 |
| 20 | Ga0070670_100077243 | 3300005331 | Bacteria | 2861 |
| 21 | Ga0070670_100078399 | 3300005331 | Bacteria | 2838 |
| 22 | Ga0068869_100167430 | 3300005334 | Bacteria | 1715 |
| 23 | Ga0068869_100323978 | 3300005334 | Bacteria | 1250 |
| 24 | Ga0070666_10026904 | 3300005335 | Bacteria | 3763 |
| 25 | Ga0070680_100080949 | 3300005336 | Bacteria | 2679 |
| 26 | Ga0070680_100297454 | 3300005336 | Bacteria | 1368 |
| 27 | Ga0070682_100005616 | 3300005337 | Bacteria | 6991 |
| 28 | Ga0070682_100132293 | 3300005337 | Bacteria | 1690 |
| 29 | Ga0070682_100211575 | 3300005337 | Bacteria | 1374 |
| 30 | Ga0068868_100021409 | 3300005338 | Bacteria | 4868 |
| 31 | Ga0070660_100136158 | 3300005339 | Bacteria | 1968 |
| 32 | Ga0070689_100034500 | 3300005340 | Bacteria | 3860 |
| 33 | Ga0070687_100166020 | 3300005343 | Bacteria | 1309 |
| 34 | Ga0070687_100234410 | 3300005343 | Bacteria | 1131 |
| 35 | Ga0070661_100162073 | 3300005344 | Bacteria | 1694 |
| 36 | Ga0070692_10003986 | 3300005345 | Bacteria | 6096 |
| 37 | Ga0070669_100188710 | 3300005353 | Bacteria | 1616 |
| 38 | Ga0070675_100002968 | 3300005354 | Bacteria | 12810 |
| 39 | Ga0070675_100024483 | 3300005354 | Bacteria | 4834 |
| 40 | Ga0070671_100005081 | 3300005355 | Bacteria | 10478 |
| 41 | Ga0070674_100023426 | 3300005356 | Bacteria | 3996 |
| 42 | Ga0070674_100610349 | 3300005356 | Bacteria | 923 |
| 43 | Ga0070673_100012281 | 3300005364 | Bacteria | 5876 |
| 44 | Ga0070673_100031751 | 3300005364 | Bacteria | 3967 |
| 45 | Ga0070673_100875187 | 3300005364 | Bacteria | 832 |
| 46 | Ga0070688_100008377 | 3300005365 | Bacteria | 5609 |
| 47 | Ga0070688_100559179 | 3300005365 | Bacteria | 871 |
| 48 | Ga0070659_100051353 | 3300005366 | Bacteria | 3242 |
| 49 | Ga0070659_100061159 | 3300005366 | Bacteria | 2976 |
| 50 | Ga0070667_100040773 | 3300005367 | Bacteria | 3895 |
| 51 | Ga0070714_100012361 | 3300005435 | Bacteria | 6815 |
| 52 | Ga0070714_100111152 | 3300005435 | Bacteria | 2426 |
| 53 | Ga0070714_100559087 | 3300005435 | Bacteria | 1096 |
| 54 | Ga0070713_100124160 | 3300005436 | Bacteria | 2268 |
| 55 | Ga0070713_100239524 | 3300005436 | Bacteria | 1652 |
| 56 | Ga0070710_10538118 | 3300005437 | Bacteria | 805 |
| 57 | Ga0070701_10170917 | 3300005438 | Bacteria | 1266 |
| 58 | Ga0070711_100132580 | 3300005439 | Bacteria | 1858 |
| 59 | Ga0070694_100063429 | 3300005444 | Bacteria | 2527 |
| 60 | Ga0070708_100012302 | 3300005445 | Bacteria | 6978 |
| 61 | Ga0070708_100947054 | 3300005445 | Bacteria | 808 |
| 62 | Ga0070663_100043593 | 3300005455 | Bacteria | 3158 |
| 63 | Ga0070663_100053366 | 3300005455 | Bacteria | 2885 |
| 64 | Ga0070663_100321798 | 3300005455 | Bacteria | 1244 |
| 65 | Ga0070678_100010774 | 3300005456 | Bacteria | 5603 |
| 66 | Ga0070662_100057466 | 3300005457 | Bacteria | 2827 |
| 67 | Ga0070662_100269523 | 3300005457 | Bacteria | 1374 |
| 68 | Ga0068867_100049040 | 3300005459 | Bacteria | 3108 |
| 69 | Ga0068867_100104614 | 3300005459 | Bacteria | 2167 |
| 70 | Ga0070685_10004790 | 3300005466 | Bacteria | 6852 |
| 71 | Ga0070706_100061798 | 3300005467 | Bacteria | 3459 |
| 72 | Ga0070698_100502033 | 3300005471 | Bacteria | 1151 |
| 73 | Ga0070684_100053678 | 3300005535 | Bacteria | 3510 |
| 74 | Ga0070697_100026383 | 3300005536 | Bacteria | 4640 |
| 75 | Ga0070697_100169504 | 3300005536 | Bacteria | 1847 |
| 76 | Ga0068853_100015409 | 3300005539 | Bacteria | 6281 |
| 77 | Ga0068853_100641131 | 3300005539 | Bacteria | 1011 |
| 78 | Ga0070672_100000676 | 3300005543 | Bacteria | 20037 |
| 79 | Ga0070672_100114694 | 3300005543 | Bacteria | 2200 |
| 80 | Ga0070672_100267547 | 3300005543 | Bacteria | 1443 |
| 81 | Ga0070672_100418801 | 3300005543 | Bacteria | 1150 |
| 82 | Ga0070672_100773101 | 3300005543 | Bacteria | 844 |
| 83 | Ga0070686_100162485 | 3300005544 | Bacteria | 1574 |
| 84 | Ga0070695_100004097 | 3300005545 | Bacteria | 8517 |
| 85 | Ga0070696_100000861 | 3300005546 | Bacteria | 19604 |
| 86 | Ga0070696_100206962 | 3300005546 | Bacteria | 1467 |
| 87 | Ga0070665_100006072 | 3300005548 | Bacteria | 12347 |
| 88 | Ga0070665_100368653 | 3300005548 | Bacteria | 1443 |
| 89 | Ga0070704_100111095 | 3300005549 | Bacteria | 2086 |
| 90 | Ga0068855_100061462 | 3300005563 | Bacteria | 4389 |
| 91 | Ga0070664_100093228 | 3300005564 | Bacteria | 2609 |
| 92 | Ga0068854_100119185 | 3300005578 | Bacteria | 2001 |
| 93 | Ga0070702_100399115 | 3300005615 | Bacteria | 983 |
| 94 | Ga0068859_100002586 | 3300005617 | Bacteria | 18412 |
| 95 | Ga0068859_100048953 | 3300005617 | Bacteria | 4245 |
| 96 | Ga0068859_100380849 | 3300005617 | Bacteria | 1506 |
| 97 | Ga0068859_100453154 | 3300005617 | Bacteria | 1379 |
| 98 | Ga0068864_100124860 | 3300005618 | Bacteria | 2305 |
| 99 | Ga0068870_10111506 | 3300005840 | Bacteria | 1563 |
| 100 | Ga0068863_100005191 | 3300005841 | Bacteria | 12848 |
| 101 | Ga0068858_100014526 | 3300005842 | Bacteria | 7419 |
| 102 | Ga0068858_100644780 | 3300005842 | Bacteria | 1029 |
| 103 | Ga0068860_100003598 | 3300005843 | Bacteria | 15930 |
| 104 | Ga0068860_100094545 | 3300005843 | Bacteria | 2849 |
| 105 | Ga0068862_100100804 | 3300005844 | Bacteria | 2525 |
| 106 | Ga0081455_10174405 | 3300005937 | Bacteria | 1634 |
| 107 | Ga0081538_10011617 | 3300005981 | Bacteria | 7119 |
| 108 | Ga0081538_10035239 | 3300005981 | Bacteria | 3291 |
| 109 | Ga0070717_10188340 | 3300006028 | Bacteria | 1802 |
| 110 | Ga0075365_10091842 | 3300006038 | Bacteria | 2069 |
| 111 | Ga0075364_10261717 | 3300006051 | Bacteria | 1176 |
| 112 | Ga0075362_10150435 | 3300006177 | Bacteria | 1116 |
| 113 | Ga0075366_10199108 | 3300006195 | Bacteria | 1218 |
| 114 | Ga0097621_100001774 | 3300006237 | Bacteria | 14795 |
| 115 | Ga0097621_100017679 | 3300006237 | Bacteria | 5422 |
| 116 | Ga0068871_100000977 | 3300006358 | Bacteria | 19153 |
| 117 | Ga0068871_100005924 | 3300006358 | Bacteria | 8604 |
| 118 | Ga0068871_100078799 | 3300006358 | Bacteria | 2725 |
| 119 | Ga0075430_100487808 | 3300006846 | Bacteria | 1017 |
| 120 | Ga0075431_100032383 | 3300006847 | Bacteria | 5386 |
| 121 | Ga0075431_100194086 | 3300006847 | Bacteria | 2079 |
| 122 | Ga0075433_10010306 | 3300006852 | Bacteria | 7495 |
| 123 | Ga0075434_100059396 | 3300006871 | Bacteria | 3801 |
| 124 | Ga0075434_100504865 | 3300006871 | Bacteria | 1230 |
| 125 | Ga0068865_100013688 | 3300006881 | Bacteria | 5137 |
| 126 | Ga0068865_100126659 | 3300006881 | Bacteria | 1907 |
| 127 | Ga0075436_100023439 | 3300006914 | Bacteria | 4240 |
| 128 | Ga0075436_100191109 | 3300006914 | Bacteria | 1449 |
| 129 | Ga0097620_100002586 | 3300006931 | Bacteria | 18412 |
| 130 | Ga0097620_100048946 | 3300006931 | Bacteria | 4245 |
| 131 | Ga0097620_100380878 | 3300006931 | Bacteria | 1506 |
| 132 | Ga0097620_100453237 | 3300006931 | Bacteria | 1379 |
| 133 | Ga0105240_10034639 | 3300009093 | Bacteria | 6511 |
| 134 | Ga0105240_10120073 | 3300009093 | Bacteria | 3166 |
| 135 | Ga0105240_10395029 | 3300009093 | Bacteria | 1559 |
| 136 | Ga0105240_10596335 | 3300009093 | Bacteria | 1217 |
| 137 | Ga0111539_10000294 | 3300009094 | Bacteria | 60290 |
| 138 | Ga0105245_10023458 | 3300009098 | Bacteria | 5416 |
| 139 | Ga0105245_10145516 | 3300009098 | Bacteria | 2236 |
| 140 | Ga0105247_10109179 | 3300009101 | Bacteria | 1778 |
| 141 | Ga0114129_10863459 | 3300009147 | Bacteria | 1149 |
| 142 | Ga0105241_10383592 | 3300009174 | Bacteria | 1228 |
| 143 | Ga0105242_10260438 | 3300009176 | Bacteria | 1566 |
| 144 | Ga0105242_10294552 | 3300009176 | Bacteria | 1479 |
| 145 | Ga0105248_10000997 | 3300009177 | Bacteria | 31307 |
| 146 | Ga0105248_10014429 | 3300009177 | Bacteria | 8696 |
| 147 | Ga0105248_10285540 | 3300009177 | Bacteria | 1858 |
| 148 | Ga0105237_10002299 | 3300009545 | Bacteria | 23749 |
| 149 | Ga0105237_10011073 | 3300009545 | Bacteria | 9560 |
| 150 | Ga0105238_10009996 | 3300009551 | Bacteria | 9516 |
| 151 | Ga0105238_10081917 | 3300009551 | Bacteria | 3217 |
| 152 | Ga0105249_10123114 | 3300009553 | Bacteria | 2467 |
| 153 | Ga0105028_101436 | 3300009993 | Bacteria | 2517 |
| 154 | Ga0105239_10020752 | 3300010375 | Bacteria | 7249 |
| 155 | Ga0105239_10237542 | 3300010375 | Bacteria | 2046 |
| 156 | Ga0105239_10273907 | 3300010375 | Bacteria | 1899 |
| 157 | Ga0105239_10903726 | 3300010375 | Bacteria | 1013 |
| 158 | Ga0157371_10213576 | 3300013102 | Bacteria | 1385 |
| 159 | Ga0157370_10030755 | 3300013104 | Bacteria | 5260 |
| 160 | Ga0157370_10624341 | 3300013104 | Bacteria | 986 |
| 161 | Ga0157369_10095542 | 3300013105 | Bacteria | 3171 |
| 162 | Ga0157378_10000764 | 3300013297 | Bacteria | 29926 |
| 163 | Ga0157378_10607455 | 3300013297 | Bacteria | 1105 |
| 164 | Ga0163162_10006138 | 3300013306 | Bacteria | 11630 |
| 165 | Ga0163162_10125990 | 3300013306 | Bacteria | 2667 |
| 166 | Ga0163162_10552805 | 3300013306 | Bacteria | 1279 |
| 167 | Ga0157372_11122356 | 3300013307 | Bacteria | 909 |
| 168 | Ga0157375_10000197 | 3300013308 | Bacteria | 56238 |
| 169 | Ga0157375_10056713 | 3300013308 | Bacteria | 3869 |
| 170 | Ga0163163_10015347 | 3300014325 | Bacteria | 7079 |
| 171 | Ga0163163_10052473 | 3300014325 | Bacteria | 4023 |
| 172 | Ga0157380_10047668 | 3300014326 | Bacteria | 3371 |
| 173 | Ga0157377_10111730 | 3300014745 | Bacteria | 1643 |
| 174 | Ga0157379_10000050 | 3300014968 | Bacteria | 74545 |
| 175 | Ga0157376_10005076 | 3300014969 | Bacteria | 9181 |
| 176 | Ga0157376_10147079 | 3300014969 | Bacteria | 2121 |
| 177 | Ga0182005_1020871 | 3300015265 | Bacteria | 1799 |
| 178 | Ga0213873_10017146 | 3300021358 | Bacteria | 1648 |
| 179 | Ga0213876_10093523 | 3300021384 | Bacteria | 1593 |
| 180 | Ga0213876_10094171 | 3300021384 | Bacteria | 1587 |
| 181 | Ga0213875_10004961 | 3300021388 | Bacteria | 7217 |
| 182 | Ga0209436_100097 | 3300025208 | Bacteria | 42571 |
| 183 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 184 | Ga0209759_1000149 | 3300025256 | Bacteria | 120932 |
| 185 | Ga0209129_1001082 | 3300025258 | Bacteria | 16013 |
| 186 | Ga0209233_1000102 | 3300025261 | Bacteria | 285774 |
| 187 | Ga0209673_1002249 | 3300025273 | Bacteria | 13924 |
| 188 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 189 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 190 | Ga0209025_1000179 | 3300025294 | Bacteria | 157965 |
| 191 | Ga0209564_1000650 | 3300025295 | Bacteria | 52044 |
| 192 | Ga0209758_1001247 | 3300025297 | Bacteria | 31568 |
| 193 | Ga0209758_1002011 | 3300025297 | Bacteria | 21870 |
| 194 | Ga0209256_1002461 | 3300025299 | Bacteria | 15057 |
| 195 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 196 | Ga0207426_1000191 | 3300025302 | Bacteria | 151850 |
| 197 | Ga0207680_10033810 | 3300025903 | Bacteria | 2920 |
| 198 | Ga0207680_10086983 | 3300025903 | Bacteria | 1978 |
| 199 | Ga0207645_10056721 | 3300025907 | Bacteria | 2500 |
| 200 | Ga0207645_10113029 | 3300025907 | Bacteria | 1759 |
| 201 | Ga0207643_10059272 | 3300025908 | Bacteria | 2184 |
| 202 | Ga0207643_10253670 | 3300025908 | Bacteria | 1084 |
| 203 | Ga0207705_10039487 | 3300025909 | Bacteria | 3384 |
| 204 | Ga0207705_10574015 | 3300025909 | Bacteria | 877 |
| 205 | Ga0207684_10041138 | 3300025910 | Bacteria | 3920 |
| 206 | Ga0207654_10189866 | 3300025911 | Bacteria | 1346 |
| 207 | Ga0207695_10095233 | 3300025913 | Bacteria | 2982 |
| 208 | Ga0207695_10277015 | 3300025913 | Bacteria | 1572 |
| 209 | Ga0207671_10002344 | 3300025914 | Bacteria | 20412 |
| 210 | Ga0207671_10025241 | 3300025914 | Bacteria | 4465 |
| 211 | Ga0207663_10602727 | 3300025916 | Bacteria | 863 |
| 212 | Ga0207662_10202892 | 3300025918 | Bacteria | 1284 |
| 213 | Ga0207657_10028957 | 3300025919 | Bacteria | 5046 |
| 214 | Ga0207657_10203913 | 3300025919 | Bacteria | 1590 |
| 215 | Ga0207646_10134904 | 3300025922 | Bacteria | 2222 |
| 216 | Ga0207694_10010848 | 3300025924 | Bacteria | 6878 |
| 217 | Ga0207650_10012822 | 3300025925 | Bacteria | 5792 |
| 218 | Ga0207650_10088087 | 3300025925 | Bacteria | 2367 |
| 219 | Ga0207650_10123133 | 3300025925 | Bacteria | 2021 |
| 220 | Ga0207659_10001541 | 3300025926 | Bacteria | 13677 |
| 221 | Ga0207687_10013039 | 3300025927 | Bacteria | 5430 |
| 222 | Ga0207687_10174646 | 3300025927 | Bacteria | 1660 |
| 223 | Ga0207700_10190911 | 3300025928 | Bacteria | 1721 |
| 224 | Ga0207700_10666948 | 3300025928 | Bacteria | 928 |
| 225 | Ga0207664_10051588 | 3300025929 | Bacteria | 3249 |
| 226 | Ga0207644_10007848 | 3300025931 | Bacteria | 6972 |
| 227 | Ga0207644_10112180 | 3300025931 | Bacteria | 2063 |
| 228 | Ga0207690_10060371 | 3300025932 | Bacteria | 2573 |
| 229 | Ga0207690_10127950 | 3300025932 | Bacteria | 1855 |
| 230 | Ga0207709_10150108 | 3300025935 | Bacteria | 1613 |
| 231 | Ga0207704_10025603 | 3300025938 | Bacteria | 3221 |
| 232 | Ga0207704_10132363 | 3300025938 | Bacteria | 1730 |
| 233 | Ga0207704_10227515 | 3300025938 | Bacteria | 1384 |
| 234 | Ga0207704_10610556 | 3300025938 | Bacteria | 894 |
| 235 | Ga0207691_10006850 | 3300025940 | Bacteria | 10999 |
| 236 | Ga0207691_10109854 | 3300025940 | Bacteria | 2453 |
| 237 | Ga0207691_10369449 | 3300025940 | Bacteria | 1225 |
| 238 | Ga0207691_10598411 | 3300025940 | Bacteria | 933 |
| 239 | Ga0207711_10007088 | 3300025941 | Bacteria | 9390 |
| 240 | Ga0207711_10115056 | 3300025941 | Bacteria | 2396 |
| 241 | Ga0207689_10016674 | 3300025942 | Bacteria | 6217 |
| 242 | Ga0207689_10377634 | 3300025942 | Bacteria | 1180 |
| 243 | Ga0207679_10069764 | 3300025945 | Bacteria | 2646 |
| 244 | Ga0207667_10037929 | 3300025949 | Bacteria | 5150 |
| 245 | Ga0207651_10006051 | 3300025960 | Bacteria | 6284 |
| 246 | Ga0207651_10119561 | 3300025960 | Bacteria | 1995 |
| 247 | Ga0207668_10185115 | 3300025972 | Bacteria | 1646 |
| 248 | Ga0207640_10197349 | 3300025981 | Bacteria | 1522 |
| 249 | Ga0207658_10232692 | 3300025986 | Bacteria | 1556 |
| 250 | Ga0207677_10011645 | 3300026023 | Bacteria | 5020 |
| 251 | Ga0207677_10221577 | 3300026023 | Bacteria | 1517 |
| 252 | Ga0207703_10063994 | 3300026035 | Bacteria | 3017 |
| 253 | Ga0207703_10582311 | 3300026035 | Bacteria | 1057 |
| 254 | Ga0207639_10004467 | 3300026041 | Bacteria | 9440 |
| 255 | Ga0207678_10075269 | 3300026067 | Bacteria | 2892 |
| 256 | Ga0207678_10101334 | 3300026067 | Bacteria | 2459 |
| 257 | Ga0207641_10001463 | 3300026088 | Bacteria | 23157 |
| 258 | Ga0207641_10070881 | 3300026088 | Bacteria | 2996 |
| 259 | Ga0207641_10399688 | 3300026088 | Bacteria | 1319 |
| 260 | Ga0207648_10073369 | 3300026089 | Bacteria | 2982 |
| 261 | Ga0207648_10086130 | 3300026089 | Bacteria | 2741 |
| 262 | Ga0207676_10025695 | 3300026095 | Bacteria | 4372 |
| 263 | Ga0207674_10057534 | 3300026116 | Bacteria | 3941 |
| 264 | Ga0207675_100073763 | 3300026118 | Bacteria | 3193 |
| 265 | Ga0207683_10007131 | 3300026121 | Bacteria | 9582 |
| 266 | Ga0207683_10215926 | 3300026121 | Bacteria | 1747 |
| 267 | Ga0207683_10522349 | 3300026121 | Bacteria | 1097 |
| 268 | Ga0207428_10043523 | 3300027907 | Bacteria | 3625 |
| 269 | Ga0268266_10000472 | 3300028379 | Bacteria | 58159 |
| 270 | Ga0268266_10323988 | 3300028379 | Bacteria | 1443 |
| 271 | Ga0268266_10545057 | 3300028379 | Bacteria | 1111 |
| 272 | Ga0268266_10609201 | 3300028379 | Bacteria | 1049 |
| 273 | Ga0268266_11057265 | 3300028379 | Bacteria | 785 |
| 274 | Ga0268265_10515376 | 3300028380 | Bacteria | 1129 |
| 275 | Ga0268264_10005331 | 3300028381 | Bacteria | 10895 |
| 276 | Ga0268264_10137685 | 3300028381 | Bacteria | 2173 |
| 277 | Ga0265319_1031568 | 3300028563 | Bacteria | 1843 |
| 278 | Ga0265338_10037552 | 3300028800 | Bacteria | 4607 |
| 279 | Ga0265338_10091789 | 3300028800 | Bacteria | 2507 |
| 280 | Ga0265760_10005225 | 3300031090 | Bacteria | 3719 |
| 281 | Ga0265328_10000577 | 3300031239 | Bacteria | 16979 |
| 282 | Ga0265320_10015215 | 3300031240 | Bacteria | 4355 |
| 283 | Ga0265325_10036919 | 3300031241 | Bacteria | 2586 |
| 284 | Ga0265325_10072945 | 3300031241 | Bacteria | 1719 |
| 285 | Ga0265314_10015545 | 3300031711 | Bacteria | 6038 |
| 286 | Ga0265314_10017597 | 3300031711 | Bacteria | 5604 |
| 287 | Ga0265314_10203822 | 3300031711 | Bacteria | 1167 |
| 288 | Ga0307413_10472846 | 3300031824 | Bacteria | 1000 |
| 289 | Ga0307406_10216141 | 3300031901 | Bacteria | 1422 |
| 290 | Ga0307416_100159947 | 3300032002 | Bacteria | 2080 |
| 291 | Ga0307416_100601829 | 3300032002 | Bacteria | 1179 |
| 292 | Ga0307414_10583326 | 3300032004 | Bacteria | 1001 |
| 293 | Ga0307411_10215830 | 3300032005 | Bacteria | 1485 |
| 294 | Ga0373936_0009161 | 3300035113 | Bacteria | 3731 |
| 295 | Ga0373954_0095797 | 3300035118 | Bacteria | 1429 |
| 296 | Ga0373924_0044504 | 3300035410 | Bacteria | 1824 |
| 297 | Ga0373935_0015697 | 3300035692 | Bacteria | 4580 |
| 298 | Ga0373927_0010170 | 3300035695 | Bacteria | 6290 |
| 299 | Ga0373937_0886836 | 3300036401 | Bacteria | 841 |
| 300 | Ga0373925_0021842 | 3300037068 | Bacteria | 4665 |
| 301 | Ga0395900_0037149 | 3300037418 | Bacteria | 5023 |
| 302 | Ga0395900_0605666 | 3300037418 | Bacteria | 1036 |
| 303 | Ga0395905_0001510 | 3300037471 | Bacteria | 27815 |
| 304 | Ga0395905_0046373 | 3300037471 | Bacteria | 4075 |
| 305 | Ga0436364_0622955 | 3300037853 | Bacteria | 6062 |
| 306 | Ga0436364_1051528 | 3300037853 | Bacteria | 1765 |
| 307 | Ga0395901_0022725 | 3300038443 | Bacteria | 6431 |
| 308 | Ga0395901_0225679 | 3300038443 | Bacteria | 1957 |
| 309 | Ga0395901_0382175 | 3300038443 | Bacteria | 1449 |
| 310 | Ga0436365_0701971 | 3300039437 | Bacteria | 1501 |
| 311 | Ga0436365_0945779 | 3300039437 | Bacteria | 1836 |
| 312 | Ga0436365_1625021 | 3300039437 | Bacteria | 851 |
| 313 | Ga0436360_0007524 | 3300039438 | Bacteria | 1367 |
| 314 | Ga0436362_0093681 | 3300039453 | Bacteria | 3241 |
| 315 | Ga0436362_1255939 | 3300039453 | Bacteria | 2161 |
| 316 | Ga0439431_0012539 | 3300041997 | Bacteria | 1949 |
| 317 | Ga0439463_085943 | 3300042016 | Bacteria | 809 |
| 318 | Ga0450915_005089 | 3300042119 | Bacteria | 800 |
| 319 | Ga0450907_011232 | 3300042146 | Bacteria | 1488 |
| 320 | Ga0439464_0018622 | 3300042439 | Bacteria | 1890 |
| 321 | Ga0451577_0149261 | 3300042876 | Bacteria | 2103 |
| 322 | Ga0451577_0659411 | 3300042876 | Bacteria | 949 |
| 323 | Ga0466972_0018818 | 3300044658 | Bacteria | 3452 |
| 324 | Ga0466963_0025369 | 3300044694 | Bacteria | 3780 |
| 325 | Ga0453684_0075492 | 3300044712 | Bacteria | 4236 |
| 326 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 327 | Ga0451576_0381888 | 3300045051 | Bacteria | 1476 |
| 328 | Ga0466967_0061585 | 3300045976 | Bacteria | 3329 |
| 329 | Ga0466967_0239200 | 3300045976 | Bacteria | 1731 |
| 330 | Ga0495592_0152896 | 3300046454 | Bacteria | 1594 |
| 331 | Ga0495592_0235817 | 3300046454 | Bacteria | 1216 |
| 332 | Ga0495629_0035236 | 3300046459 | Bacteria | 3537 |
| 333 | Ga0495629_0035919 | 3300046459 | Bacteria | 3500 |
| 334 | Ga0495638_0016472 | 3300046460 | Bacteria | 4950 |
| 335 | Ga0495580_0005176 | 3300046472 | Bacteria | 10847 |
| 336 | Ga0495605_0015141 | 3300046474 | Bacteria | 4203 |
| 337 | Ga0495664_0082898 | 3300046477 | Bacteria | 1924 |
| 338 | Ga0495607_0237519 | 3300046501 | Bacteria | 883 |
| 339 | Ga0495620_0116069 | 3300046515 | Bacteria | 1058 |
| 340 | Ga0495628_0240607 | 3300046516 | Bacteria | 1354 |
| 341 | Ga0495630_0067951 | 3300046517 | Bacteria | 2679 |
| 342 | Ga0495630_0218305 | 3300046517 | Bacteria | 1456 |
| 343 | Ga0495631_0017845 | 3300046518 | Bacteria | 3350 |
| 344 | Ga0495643_0072231 | 3300046522 | Bacteria | 1810 |
| 345 | Ga0495648_0121580 | 3300046524 | Bacteria | 1403 |
| 346 | Ga0495648_0322889 | 3300046524 | Bacteria | 715 |
| 347 | Ga0495665_0036139 | 3300046531 | Bacteria | 2637 |
| 348 | Ga0495586_0201715 | 3300046535 | Bacteria | 1128 |
| 349 | Ga0495609_0055123 | 3300046538 | Bacteria | 1764 |
| 350 | Ga0495668_0014729 | 3300046616 | Bacteria | 4579 |
| 351 | Ga0495634_0094788 | 3300046642 | Bacteria | 1934 |
| 352 | Ga0495611_0095496 | 3300046648 | Bacteria | 1376 |
| 353 | Ga0495625_0023224 | 3300046660 | Bacteria | 4740 |
| 354 | Ga0495625_0221463 | 3300046660 | Bacteria | 1240 |
| 355 | Ga0495657_0052454 | 3300046675 | Bacteria | 2734 |
| 356 | Ga0495658_0342609 | 3300046683 | Bacteria | 949 |
| 357 | Ga0495613_0175601 | 3300046689 | Bacteria | 1519 |
| 358 | Ga0495671_0246988 | 3300046692 | Bacteria | 862 |
| 359 | Ga0495649_0075109 | 3300046694 | Bacteria | 1810 |
| 360 | Ga0495581_0089424 | 3300047315 | Bacteria | 1786 |
| 361 | Ga0495604_0090665 | 3300047317 | Bacteria | 2269 |
| 362 | Ga0495674_0003679 | 3300047319 | Bacteria | 14916 |
| 363 | Ga0495672_0040567 | 3300047320 | Bacteria | 2822 |
| 364 | Ga0495673_0094411 | 3300047469 | Bacteria | 1218 |
| 365 | Ga0495684_0046811 | 3300047471 | Bacteria | 3309 |
| 366 | Ga0495626_0047128 | 3300048091 | Bacteria | 2005 |
| 367 | Ga0496102_0735109 | 3300048905 | Bacteria | 910 |
| 368 | Ga0496102_0822290 | 3300048905 | Bacteria | 851 |
| 369 | Ga0496103_0358760 | 3300048906 | Bacteria | 937 |
| 370 | Ga0496106_0000163 | 3300048909 | Bacteria | 48064 |
| 371 | Ga0496108_0017169 | 3300048911 | Bacteria | 5920 |
| 372 | Ga0496109_0332465 | 3300048912 | Bacteria | 1434 |
| 373 | Ga0496110_0379968 | 3300048913 | Bacteria | 1287 |
| 374 | Ga0496113_0120693 | 3300048916 | Bacteria | 2049 |
| 375 | Ga0496114_0258060 | 3300048917 | Bacteria | 1534 |
| 376 | Ga0496121_0107819 | 3300048924 | Bacteria | 2132 |
| 377 | Ga0496125_0035760 | 3300048928 | Bacteria | 4350 |
| 378 | Ga0495678_036401 | 3300049459 | Bacteria | 2008 |
| 379 | Ga0501031_0091189 | 3300049568 | Bacteria | 1987 |
| 380 | Ga0501032_0158339 | 3300049569 | Bacteria | 1487 |
| 381 | Ga0501032_0321367 | 3300049569 | Bacteria | 999 |
| 382 | Ga0501033_0023020 | 3300049570 | Bacteria | 4696 |
| 383 | Ga0501033_0034921 | 3300049570 | Bacteria | 3769 |
| 384 | Ga0501034_0444364 | 3300049571 | Bacteria | 1215 |
| 385 | Ga0501036_0010306 | 3300049572 | Bacteria | 7710 |
| 386 | Ga0501036_0048456 | 3300049572 | Bacteria | 3597 |
| 387 | Ga0501036_0168543 | 3300049572 | Bacteria | 1845 |
| 388 | Ga0501037_0149297 | 3300049573 | Bacteria | 1671 |
| 389 | Ga0501037_0489685 | 3300049573 | Bacteria | 835 |
| 390 | Ga0501038_0005181 | 3300049574 | Bacteria | 12128 |
| 391 | Ga0501038_0051968 | 3300049574 | Bacteria | 3534 |
| 392 | Ga0501039_0009913 | 3300049575 | Bacteria | 7264 |
| 393 | Ga0501039_0087963 | 3300049575 | Bacteria | 2420 |
| 394 | Ga0501039_0234895 | 3300049575 | Bacteria | 1441 |
| 395 | Ga0501040_0001092 | 3300049576 | Bacteria | 17152 |
| 396 | Ga0501040_0001555 | 3300049576 | Bacteria | 14603 |
| 397 | Ga0501041_0000468 | 3300049577 | Bacteria | 20479 |
| 398 | Ga0501041_0010094 | 3300049577 | Bacteria | 5563 |
| 399 | Ga0501041_0037205 | 3300049577 | Bacteria | 2948 |
| 400 | Ga0501041_0119879 | 3300049577 | Bacteria | 1635 |
| 401 | Ga0501042_0021351 | 3300049578 | Bacteria | 4511 |
| 402 | Ga0501042_0047525 | 3300049578 | Bacteria | 3060 |
| 403 | Ga0501043_0000075 | 3300049579 | Bacteria | 86156 |
| 404 | Ga0501043_0064894 | 3300049579 | Bacteria | 2867 |
| 405 | Ga0501043_0236214 | 3300049579 | Bacteria | 1411 |
| 406 | Ga0501046_0000195 | 3300049580 | Bacteria | 62300 |
| 407 | Ga0501046_0007800 | 3300049580 | Bacteria | 9391 |
| 408 | Ga0501046_0023531 | 3300049580 | Bacteria | 5066 |
| 409 | Ga0501047_0000145 | 3300049581 | Bacteria | 86319 |
| 410 | Ga0501047_0045907 | 3300049581 | Bacteria | 4223 |
| 411 | Ga0501048_0001016 | 3300049582 | Bacteria | 20962 |
| 412 | Ga0501048_0066450 | 3300049582 | Bacteria | 2549 |
| 413 | Ga0501067_0152134 | 3300049583 | Bacteria | 1289 |
| 414 | Ga0501068_0073869 | 3300049584 | Bacteria | 2083 |
| 415 | Ga0501068_0143408 | 3300049584 | Bacteria | 1498 |
| 416 | Ga0501068_0172549 | 3300049584 | Bacteria | 1365 |
| 417 | Ga0501070_0175063 | 3300049586 | Bacteria | 1767 |
| 418 | Ga0501071_0000051 | 3300049587 | Bacteria | 39618 |
| 419 | Ga0501071_0199279 | 3300049587 | Bacteria | 1503 |
| 420 | Ga0501072_0001092 | 3300049588 | Bacteria | 20169 |
| 421 | Ga0501072_0001642 | 3300049588 | Bacteria | 16720 |
| 422 | Ga0501072_0029967 | 3300049588 | Bacteria | 4252 |
| 423 | Ga0501073_0028518 | 3300049589 | Bacteria | 3989 |
| 424 | Ga0501073_0029687 | 3300049589 | Bacteria | 3907 |
| 425 | Ga0501073_0049897 | 3300049589 | Bacteria | 2934 |
| 426 | Ga0501073_0089981 | 3300049589 | Bacteria | 2134 |
| 427 | Ga0501073_0144998 | 3300049589 | Bacteria | 1645 |
| 428 | Ga0501073_0168574 | 3300049589 | Bacteria | 1516 |
| 429 | Ga0501074_0003789 | 3300049590 | Bacteria | 10742 |
| 430 | Ga0501074_0138330 | 3300049590 | Bacteria | 1742 |
| 431 | Ga0501075_0000116 | 3300049591 | Bacteria | 38606 |
| 432 | Ga0501075_0007468 | 3300049591 | Bacteria | 7580 |
| 433 | Ga0501075_0037154 | 3300049591 | Bacteria | 3637 |
| 434 | Ga0501075_0513578 | 3300049591 | Bacteria | 914 |
| 435 | Ga0501076_0000821 | 3300049592 | Bacteria | 20162 |
| 436 | Ga0501076_0088195 | 3300049592 | Bacteria | 2493 |
| 437 | Ga0501076_0430017 | 3300049592 | Bacteria | 1086 |
| 438 | Ga0501077_0001156 | 3300049593 | Bacteria | 15933 |
| 439 | Ga0501077_0073156 | 3300049593 | Bacteria | 2171 |
| 440 | Ga0501079_0000020 | 3300049741 | Bacteria | 63869 |
| 441 | Ga0501079_0020373 | 3300049741 | Bacteria | 5068 |
| 442 | Ga0501079_0025533 | 3300049741 | Bacteria | 4530 |
| 443 | Ga0501079_0228453 | 3300049741 | Bacteria | 1454 |
| 444 | Ga0501080_0004977 | 3300049742 | Bacteria | 11832 |
| 445 | Ga0501080_0012211 | 3300049742 | Bacteria | 7871 |
| 446 | Ga0501080_0057613 | 3300049742 | Bacteria | 3617 |
| 447 | Ga0501080_0362232 | 3300049742 | Bacteria | 1308 |
| 448 | Ga0501081_0000583 | 3300049743 | Bacteria | 20746 |
| 449 | Ga0501081_0023219 | 3300049743 | Bacteria | 4156 |
| 450 | Ga0501081_0046498 | 3300049743 | Bacteria | 2983 |
| 451 | Ga0501083_0010169 | 3300049744 | Bacteria | 6630 |
| 452 | Ga0501083_0061338 | 3300049744 | Bacteria | 2510 |
| 453 | Ga0501083_0065391 | 3300049744 | Bacteria | 2422 |
| 454 | Ga0501083_0084655 | 3300049744 | Bacteria | 2099 |
| 455 | Ga0501083_0208568 | 3300049744 | Bacteria | 1274 |
| 456 | Ga0501083_0580478 | 3300049744 | Bacteria | 729 |
| 457 | Ga0501035_0012299 | 3300049822 | Bacteria | 7913 |
| 458 | Ga0501035_0018173 | 3300049822 | Bacteria | 6476 |
| 459 | Ga0501035_0700360 | 3300049822 | Bacteria | 817 |
| 460 | Ga0501044_0215651 | 3300049823 | Bacteria | 1872 |
| 461 | Ga0501044_0216149 | 3300049823 | Bacteria | 1869 |
| 462 | Ga0501044_0334950 | 3300049823 | Bacteria | 1435 |
| 463 | Ga0501045_0003929 | 3300049824 | Bacteria | 10240 |
| 464 | Ga0501045_0005600 | 3300049824 | Bacteria | 8692 |
| 465 | Ga0501045_0077367 | 3300049824 | Bacteria | 2451 |
| 466 | nmdc:mga00v17_270840_c1 | 3300050491 | Bacteria | 1102 |
| 467 | nmdc:mga00v17_69602_c1 | 3300050491 | Bacteria | 2178 |
| 468 | nmdc:mga0yw44_52735_c1 | 3300050492 | Bacteria | 2467 |
| 469 | nmdc:mga06z11_82802_c1 | 3300050494 | Bacteria | 1726 |
| 470 | nmdc:mga0qj67_405489_c1 | 3300050509 | Bacteria | 1100 |
| 471 | nmdc:mga06r32_133937_c1 | 3300050510 | Bacteria | 2452 |
| 472 | nmdc:mga06r32_323122_c1 | 3300050510 | Bacteria | 1528 |
| 473 | nmdc:mga08y16_238_c1 | 3300050511 | Bacteria | 49219 |
| 474 | nmdc:mga0n895_27890_c1 | 3300050512 | Bacteria | 5365 |
| 475 | nmdc:mga08x19_51428_c1 | 3300050514 | Bacteria | 2647 |
| 476 | nmdc:mga0a205_89941_c1 | 3300050515 | Bacteria | 2967 |
| 477 | Ga0500557_011175 | 3300053105 | Bacteria | 2279 |
| 478 | Ga0500618_006136 | 3300053125 | Bacteria | 3559 |
| 479 | Ga0500658_0004963 | 3300053134 | Bacteria | 4957 |
| 480 | Ga0500658_0041432 | 3300053134 | Bacteria | 1847 |
| 481 | Ga0500559_0029444 | 3300053136 | Bacteria | 2351 |
| 482 | Ga0500568_0000444 | 3300053139 | Bacteria | 31072 |
| 483 | Ga0500568_0000725 | 3300053139 | Bacteria | 23622 |
| 484 | Ga0500590_000591 | 3300053148 | Bacteria | 12831 |
| 485 | Ga0500616_0000522 | 3300053153 | Bacteria | 48622 |
| 486 | Ga0500627_0109374 | 3300053158 | Bacteria | 1244 |
| 487 | Ga0500633_0000270 | 3300053160 | Bacteria | 7598 |
| 488 | Ga0500611_009441 | 3300053727 | Bacteria | 1546 |
| 489 | Ga0500611_036910 | 3300053727 | Bacteria | 1049 |
| 490 | Ga0501084_0016473 | 3300054114 | Bacteria | 6139 |
| 491 | Ga0501084_0033823 | 3300054114 | Bacteria | 4276 |
| 492 | Ga0501084_0044341 | 3300054114 | Bacteria | 3723 |
| 493 | Ga0501084_0150006 | 3300054114 | Bacteria | 1965 |
| 494 | Ga0501084_0160786 | 3300054114 | Bacteria | 1895 |
| 495 | Ga0587069_014313 | 3300059642 | Bacteria | 1104 |
| 496 | Ga0501082_0000771 | 3300060353 | Bacteria | 28072 |
| 497 | Ga0501082_0023373 | 3300060353 | Bacteria | 5332 |
| 498 | Ga0501082_0062682 | 3300060353 | Bacteria | 3201 |
| 499 | Ga0530510_0007886 | 3300061734 | Bacteria | 7426 |
| 500 | Ga0530510_0066231 | 3300061734 | Bacteria | 2618 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005364 | Ga0070673_100875187 | Ga0070673_1008751871 | 208 |
| 2 | 3300005617 | Ga0068859_100453154 | Ga0068859_1004531541 | 208 |
| 3 | 3300006931 | Ga0097620_100453237 | Ga0097620_1004532372 | 208 |
| 4 | 3300005337 | Ga0070682_100211575 | Ga0070682_1002115752 | 210 |
| 5 | 3300005455 | Ga0070663_100043593 | Ga0070663_1000435934 | 210 |
| 6 | 3300005578 | Ga0068854_100119185 | Ga0068854_1001191854 | 210 |
| 7 | 3300025981 | Ga0207640_10197349 | Ga0207640_101973491 | 210 |
| 8 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_81158_81793 | 210 |
| 9 | 3300005617 | Ga0068859_100380849 | Ga0068859_1003808492 | 215 |
| 10 | 3300006931 | Ga0097620_100380878 | Ga0097620_1003808782 | 215 |
| 11 | 3300032002 | Ga0307416_100601829 | Ga0307416_1006018292 | 216 |
| 12 | 3300005435 | Ga0070714_100559087 | Ga0070714_1005590871 | 217 |
| 13 | 3300005437 | Ga0070710_10538118 | Ga0070710_105381181 | 217 |
| 14 | 3300005467 | Ga0070706_100061798 | Ga0070706_1000617982 | 217 |
| 15 | 3300005536 | Ga0070697_100026383 | Ga0070697_1000263835 | 217 |
| 16 | 3300005543 | Ga0070672_100418801 | Ga0070672_1004188012 | 217 |
| 17 | 3300005937 | Ga0081455_10174405 | Ga0081455_101744052 | 217 |
| 18 | 3300025910 | Ga0207684_10041138 | Ga0207684_100411382 | 217 |
| 19 | 3300036401 | Ga0373937_0886836 | Ga0373937_0886836_65_721 | 217 |
| 20 | 3300039437 | Ga0436365_1625021 | Ga0436365_1625021_40_696 | 217 |
| 21 | 3300039438 | Ga0436360_0007524 | Ga0436360_0007524_177_857 | 217 |
| 22 | 3300044694 | Ga0466963_0025369 | Ga0466963_0025369_2674_3330 | 217 |
| 23 | 3300045976 | Ga0466967_0061585 | Ga0466967_0061585_852_1508 | 217 |
| 24 | 3300046517 | Ga0495630_0218305 | Ga0495630_0218305_500_1207 | 217 |
| 25 | 3300047471 | Ga0495684_0046811 | Ga0495684_0046811_2264_2920 | 217 |
| 26 | 3300049569 | Ga0501032_0321367 | Ga0501032_0321367_268_924 | 217 |
| 27 | 3300049571 | Ga0501034_0444364 | Ga0501034_0444364_350_1006 | 217 |
| 28 | iso_pu_bacteria | 2510917030 | 2511196398 | 217 |
| 29 | iso_pu_bacteria | 2513237090 | 2513612438 | 217 |
| 30 | iso_pu_bacteria | 2582581298 | 2585224604 | 217 |
| 31 | iso_pu_bacteria | 2585427529 | 2585546725 | 217 |
| 32 | iso_pu_bacteria | 2643221629 | 2644164949 | 217 |
| 33 | iso_pu_bacteria | 2643221662 | 2644345782 | 217 |
| 34 | iso_pu_bacteria | 2791355123 | 2792752457 | 217 |
| 35 | iso_pu_bacteria | 2856364286 | 2856367286 | 217 |
| 36 | iso_pu_bacteria | 2869285874 | 2869287569 | 217 |
| 37 | iso_pu_bacteria | 2871429161 | 2871431093 | 217 |
| 38 | iso_pu_bacteria | 2874146452 | 2874150365 | 217 |
| 39 | iso_pu_bacteria | 2874155637 | 2874157420 | 217 |
| 40 | iso_pu_bacteria | 2876413966 | 2876416516 | 217 |
| 41 | iso_pu_bacteria | 2878745973 | 2878747706 | 217 |
| 42 | iso_pu_bacteria | 2903492973 | 2903498822 | 217 |
| 43 | iso_pu_bacteria | 2906308376 | 2906310107 | 217 |
| 44 | iso_pu_bacteria | 2906321335 | 2906322979 | 217 |
| 45 | iso_pu_bacteria | 2937813078 | 2937815393 | 217 |
| 46 | iso_pu_bacteria | 2939669807 | 2939673093 | 217 |
| 47 | iso_pu_bacteria | 2958041894 | 2958055086 | 217 |
| 48 | iso_pu_bacteria | 2958130278 | 2958131971 | 217 |
| 49 | iso_pu_bacteria | 2958179912 | 2958181774 | 217 |
| 50 | iso_pu_bacteria | 2961077736 | 2961079618 | 217 |
| 51 | iso_pu_bacteria | 2968117919 | 2968120267 | 217 |
| 52 | iso_pu_bacteria | 2977843712 | 2977846621 | 217 |
| 53 | iso_pu_bacteria | 2977864932 | 2977868500 | 217 |
| 54 | iso_pu_bacteria | 8004387939 | 8004390305 | 217 |
| 55 | iso_pu_bacteria | 8004714634 | 8004716369 | 217 |
| 56 | 3300005293 | Ga0065715_10364253 | Ga0065715_103642531 | 218 |
| 57 | 3300005327 | Ga0070658_10006622 | Ga0070658_100066227 | 218 |
| 58 | 3300005331 | Ga0070670_100077243 | Ga0070670_1000772432 | 218 |
| 59 | 3300005331 | Ga0070670_100078399 | Ga0070670_1000783992 | 218 |
| 60 | 3300005334 | Ga0068869_100323978 | Ga0068869_1003239781 | 218 |
| 61 | 3300005335 | Ga0070666_10026904 | Ga0070666_100269042 | 218 |
| 62 | 3300005336 | Ga0070680_100080949 | Ga0070680_1000809491 | 218 |
| 63 | 3300005337 | Ga0070682_100005616 | Ga0070682_1000056162 | 218 |
| 64 | 3300005338 | Ga0068868_100021409 | Ga0068868_1000214092 | 218 |
| 65 | 3300005343 | Ga0070687_100234410 | Ga0070687_1002344102 | 218 |
| 66 | 3300005344 | Ga0070661_100162073 | Ga0070661_1001620732 | 218 |
| 67 | 3300005354 | Ga0070675_100002968 | Ga0070675_10000296810 | 218 |
| 68 | 3300005355 | Ga0070671_100005081 | Ga0070671_1000050816 | 218 |
| 69 | 3300005364 | Ga0070673_100012281 | Ga0070673_1000122812 | 218 |
| 70 | 3300005367 | Ga0070667_100040773 | Ga0070667_1000407732 | 218 |
| 71 | 3300005435 | Ga0070714_100012361 | Ga0070714_1000123615 | 218 |
| 72 | 3300005435 | Ga0070714_100111152 | Ga0070714_1001111521 | 218 |
| 73 | 3300005436 | Ga0070713_100124160 | Ga0070713_1001241601 | 218 |
| 74 | 3300005436 | Ga0070713_100239524 | Ga0070713_1002395242 | 218 |
| 75 | 3300005439 | Ga0070711_100132580 | Ga0070711_1001325801 | 218 |
| 76 | 3300005455 | Ga0070663_100053366 | Ga0070663_1000533663 | 218 |
| 77 | 3300005457 | Ga0070662_100269523 | Ga0070662_1002695231 | 218 |
| 78 | 3300005459 | Ga0068867_100104614 | Ga0068867_1001046142 | 218 |
| 79 | 3300005466 | Ga0070685_10004790 | Ga0070685_100047902 | 218 |
| 80 | 3300005543 | Ga0070672_100000676 | Ga0070672_10000067618 | 218 |
| 81 | 3300005543 | Ga0070672_100267547 | Ga0070672_1002675472 | 218 |
| 82 | 3300005544 | Ga0070686_100162485 | Ga0070686_1001624852 | 218 |
| 83 | 3300005545 | Ga0070695_100004097 | Ga0070695_1000040977 | 218 |
| 84 | 3300005546 | Ga0070696_100000861 | Ga0070696_10000086110 | 218 |
| 85 | 3300005546 | Ga0070696_100206962 | Ga0070696_1002069621 | 218 |
| 86 | 3300005549 | Ga0070704_100111095 | Ga0070704_1001110951 | 218 |
| 87 | 3300005563 | Ga0068855_100061462 | Ga0068855_1000614625 | 218 |
| 88 | 3300005564 | Ga0070664_100093228 | Ga0070664_1000932282 | 218 |
| 89 | 3300005615 | Ga0070702_100399115 | Ga0070702_1003991151 | 218 |
| 90 | 3300005617 | Ga0068859_100002586 | Ga0068859_1000025864 | 218 |
| 91 | 3300005618 | Ga0068864_100124860 | Ga0068864_1001248602 | 218 |
| 92 | 3300005841 | Ga0068863_100005191 | Ga0068863_10000519110 | 218 |
| 93 | 3300005842 | Ga0068858_100014526 | Ga0068858_1000145266 | 218 |
| 94 | 3300005843 | Ga0068860_100003598 | Ga0068860_1000035989 | 218 |
| 95 | 3300006028 | Ga0070717_10188340 | Ga0070717_101883404 | 218 |
| 96 | 3300006237 | Ga0097621_100001774 | Ga0097621_1000017747 | 218 |
| 97 | 3300006237 | Ga0097621_100017679 | Ga0097621_1000176793 | 218 |
| 98 | 3300006358 | Ga0068871_100000977 | Ga0068871_10000097710 | 218 |
| 99 | 3300006358 | Ga0068871_100005924 | Ga0068871_1000059249 | 218 |
| 100 | 3300006846 | Ga0075430_100487808 | Ga0075430_1004878082 | 218 |
| 101 | 3300006914 | Ga0075436_100023439 | Ga0075436_1000234394 | 218 |
| 102 | 3300006914 | Ga0075436_100191109 | Ga0075436_1001911092 | 218 |
| 103 | 3300006931 | Ga0097620_100002586 | Ga0097620_1000025864 | 218 |
| 104 | 3300009093 | Ga0105240_10120073 | Ga0105240_101200736 | 218 |
| 105 | 3300009093 | Ga0105240_10395029 | Ga0105240_103950293 | 218 |
| 106 | 3300009098 | Ga0105245_10023458 | Ga0105245_100234585 | 218 |
| 107 | 3300009147 | Ga0114129_10863459 | Ga0114129_108634591 | 218 |
| 108 | 3300009174 | Ga0105241_10383592 | Ga0105241_103835922 | 218 |
| 109 | 3300009176 | Ga0105242_10260438 | Ga0105242_102604381 | 218 |
| 110 | 3300009176 | Ga0105242_10294552 | Ga0105242_102945523 | 218 |
| 111 | 3300009177 | Ga0105248_10000997 | Ga0105248_1000099719 | 218 |
| 112 | 3300009177 | Ga0105248_10014429 | Ga0105248_100144294 | 218 |
| 113 | 3300009551 | Ga0105238_10081917 | Ga0105238_100819172 | 218 |
| 114 | 3300010375 | Ga0105239_10237542 | Ga0105239_102375422 | 218 |
| 115 | 3300013102 | Ga0157371_10213576 | Ga0157371_102135762 | 218 |
| 116 | 3300013104 | Ga0157370_10030755 | Ga0157370_100307557 | 218 |
| 117 | 3300013104 | Ga0157370_10624341 | Ga0157370_106243411 | 218 |
| 118 | 3300013105 | Ga0157369_10095542 | Ga0157369_100955423 | 218 |
| 119 | 3300013297 | Ga0157378_10000764 | Ga0157378_1000076420 | 218 |
| 120 | 3300013306 | Ga0163162_10006138 | Ga0163162_100061389 | 218 |
| 121 | 3300013306 | Ga0163162_10552805 | Ga0163162_105528052 | 218 |
| 122 | 3300013307 | Ga0157372_11122356 | Ga0157372_111223562 | 218 |
| 123 | 3300013308 | Ga0157375_10000197 | Ga0157375_100001973 | 218 |
| 124 | 3300014325 | Ga0163163_10015347 | Ga0163163_100153472 | 218 |
| 125 | 3300014968 | Ga0157379_10000050 | Ga0157379_1000005019 | 218 |
| 126 | 3300021384 | Ga0213876_10093523 | Ga0213876_100935231 | 218 |
| 127 | 3300025903 | Ga0207680_10033810 | Ga0207680_100338103 | 218 |
| 128 | 3300025903 | Ga0207680_10086983 | Ga0207680_100869832 | 218 |
| 129 | 3300025909 | Ga0207705_10039487 | Ga0207705_100394872 | 218 |
| 130 | 3300025911 | Ga0207654_10189866 | Ga0207654_101898662 | 218 |
| 131 | 3300025913 | Ga0207695_10277015 | Ga0207695_102770153 | 218 |
| 132 | 3300025916 | Ga0207663_10602727 | Ga0207663_106027271 | 218 |
| 133 | 3300025918 | Ga0207662_10202892 | Ga0207662_102028921 | 218 |
| 134 | 3300025919 | Ga0207657_10203913 | Ga0207657_102039133 | 218 |
| 135 | 3300025925 | Ga0207650_10012822 | Ga0207650_100128223 | 218 |
| 136 | 3300025925 | Ga0207650_10088087 | Ga0207650_100880873 | 218 |
| 137 | 3300025925 | Ga0207650_10123133 | Ga0207650_101231332 | 218 |
| 138 | 3300025926 | Ga0207659_10001541 | Ga0207659_100015413 | 218 |
| 139 | 3300025927 | Ga0207687_10013039 | Ga0207687_100130395 | 218 |
| 140 | 3300025927 | Ga0207687_10174646 | Ga0207687_101746462 | 218 |
| 141 | 3300025928 | Ga0207700_10190911 | Ga0207700_101909112 | 218 |
| 142 | 3300025928 | Ga0207700_10666948 | Ga0207700_106669481 | 218 |
| 143 | 3300025929 | Ga0207664_10051588 | Ga0207664_100515882 | 218 |
| 144 | 3300025931 | Ga0207644_10007848 | Ga0207644_100078483 | 218 |
| 145 | 3300025931 | Ga0207644_10112180 | Ga0207644_101121802 | 218 |
| 146 | 3300025938 | Ga0207704_10610556 | Ga0207704_106105562 | 218 |
| 147 | 3300025940 | Ga0207691_10006850 | Ga0207691_100068509 | 218 |
| 148 | 3300025941 | Ga0207711_10007088 | Ga0207711_100070889 | 218 |
| 149 | 3300025941 | Ga0207711_10115056 | Ga0207711_101150562 | 218 |
| 150 | 3300025942 | Ga0207689_10377634 | Ga0207689_103776342 | 218 |
| 151 | 3300025945 | Ga0207679_10069764 | Ga0207679_100697642 | 218 |
| 152 | 3300025949 | Ga0207667_10037929 | Ga0207667_100379294 | 218 |
| 153 | 3300025960 | Ga0207651_10006051 | Ga0207651_100060512 | 218 |
| 154 | 3300025986 | Ga0207658_10232692 | Ga0207658_102326922 | 218 |
| 155 | 3300026023 | Ga0207677_10011645 | Ga0207677_100116454 | 218 |
| 156 | 3300026067 | Ga0207678_10075269 | Ga0207678_100752693 | 218 |
| 157 | 3300026067 | Ga0207678_10101334 | Ga0207678_101013342 | 218 |
| 158 | 3300026088 | Ga0207641_10001463 | Ga0207641_1000146316 | 218 |
| 159 | 3300026088 | Ga0207641_10070881 | Ga0207641_100708812 | 218 |
| 160 | 3300026088 | Ga0207641_10399688 | Ga0207641_103996882 | 218 |
| 161 | 3300026089 | Ga0207648_10073369 | Ga0207648_100733693 | 218 |
| 162 | 3300026095 | Ga0207676_10025695 | Ga0207676_100256952 | 218 |
| 163 | 3300028381 | Ga0268264_10005331 | Ga0268264_100053319 | 218 |
| 164 | 3300028381 | Ga0268264_10137685 | Ga0268264_101376853 | 218 |
| 165 | 3300028563 | Ga0265319_1031568 | Ga0265319_10315683 | 218 |
| 166 | 3300028800 | Ga0265338_10037552 | Ga0265338_100375526 | 218 |
| 167 | 3300028800 | Ga0265338_10091789 | Ga0265338_100917891 | 218 |
| 168 | 3300031090 | Ga0265760_10005225 | Ga0265760_100052256 | 218 |
| 169 | 3300031239 | Ga0265328_10000577 | Ga0265328_1000057717 | 218 |
| 170 | 3300031240 | Ga0265320_10015215 | Ga0265320_100152152 | 218 |
| 171 | 3300031241 | Ga0265325_10036919 | Ga0265325_100369194 | 218 |
| 172 | 3300031241 | Ga0265325_10072945 | Ga0265325_100729451 | 218 |
| 173 | 3300031711 | Ga0265314_10015545 | Ga0265314_100155455 | 218 |
| 174 | 3300031711 | Ga0265314_10017597 | Ga0265314_100175974 | 218 |
| 175 | 3300031711 | Ga0265314_10203822 | Ga0265314_102038221 | 218 |
| 176 | 3300031824 | Ga0307413_10472846 | Ga0307413_104728461 | 218 |
| 177 | 3300031901 | Ga0307406_10216141 | Ga0307406_102161412 | 218 |
| 178 | 3300032004 | Ga0307414_10583326 | Ga0307414_105833262 | 218 |
| 179 | 3300032005 | Ga0307411_10215830 | Ga0307411_102158302 | 218 |
| 180 | 3300035113 | Ga0373936_0009161 | Ga0373936_0009161_2813_3559 | 218 |
| 181 | 3300035118 | Ga0373954_0095797 | Ga0373954_0095797_373_1032 | 218 |
| 182 | 3300035410 | Ga0373924_0044504 | Ga0373924_0044504_775_1521 | 218 |
| 183 | 3300035692 | Ga0373935_0015697 | Ga0373935_0015697_1330_2076 | 218 |
| 184 | 3300037068 | Ga0373925_0021842 | Ga0373925_0021842_1442_2188 | 218 |
| 185 | 3300038443 | Ga0395901_0382175 | Ga0395901_0382175_678_1373 | 218 |
| 186 | 3300039437 | Ga0436365_0701971 | Ga0436365_0701971_27_686 | 218 |
| 187 | 3300039437 | Ga0436365_0945779 | Ga0436365_0945779_212_871 | 218 |
| 188 | 3300042016 | Ga0439463_085943 | Ga0439463_085943_117_776 | 218 |
| 189 | 3300042119 | Ga0450915_005089 | Ga0450915_005089_65_724 | 218 |
| 190 | 3300042439 | Ga0439464_0018622 | Ga0439464_0018622_899_1558 | 218 |
| 191 | 3300042876 | Ga0451577_0149261 | Ga0451577_0149261_838_1590 | 218 |
| 192 | 3300042876 | Ga0451577_0659411 | Ga0451577_0659411_261_920 | 218 |
| 193 | 3300045051 | Ga0451576_0381888 | Ga0451576_0381888_82_741 | 218 |
| 194 | 3300046454 | Ga0495592_0152896 | Ga0495592_0152896_329_988 | 218 |
| 195 | 3300046459 | Ga0495629_0035236 | Ga0495629_0035236_1604_2293 | 218 |
| 196 | 3300046460 | Ga0495638_0016472 | Ga0495638_0016472_3273_3932 | 218 |
| 197 | 3300046472 | Ga0495580_0005176 | Ga0495580_0005176_2377_3066 | 218 |
| 198 | 3300046515 | Ga0495620_0116069 | Ga0495620_0116069_121_780 | 218 |
| 199 | 3300046516 | Ga0495628_0240607 | Ga0495628_0240607_433_1179 | 218 |
| 200 | 3300046517 | Ga0495630_0067951 | Ga0495630_0067951_1841_2587 | 218 |
| 201 | 3300046522 | Ga0495643_0072231 | Ga0495643_0072231_220_879 | 218 |
| 202 | 3300046524 | Ga0495648_0322889 | Ga0495648_0322889_14_673 | 218 |
| 203 | 3300046531 | Ga0495665_0036139 | Ga0495665_0036139_1879_2568 | 218 |
| 204 | 3300046535 | Ga0495586_0201715 | Ga0495586_0201715_25_771 | 218 |
| 205 | 3300046660 | Ga0495625_0221463 | Ga0495625_0221463_531_1190 | 218 |
| 206 | 3300046683 | Ga0495658_0342609 | Ga0495658_0342609_176_865 | 218 |
| 207 | 3300046689 | Ga0495613_0175601 | Ga0495613_0175601_606_1295 | 218 |
| 208 | 3300047315 | Ga0495581_0089424 | Ga0495581_0089424_917_1606 | 218 |
| 209 | 3300047319 | Ga0495674_0003679 | Ga0495674_0003679_6128_6874 | 218 |
| 210 | 3300047320 | Ga0495672_0040567 | Ga0495672_0040567_1819_2478 | 218 |
| 211 | 3300048905 | Ga0496102_0735109 | Ga0496102_0735109_172_858 | 218 |
| 212 | 3300048916 | Ga0496113_0120693 | Ga0496113_0120693_103_762 | 218 |
| 213 | 3300049569 | Ga0501032_0158339 | Ga0501032_0158339_27_686 | 218 |
| 214 | 3300049570 | Ga0501033_0023020 | Ga0501033_0023020_3601_4260 | 218 |
| 215 | 3300049572 | Ga0501036_0010306 | Ga0501036_0010306_6803_7462 | 218 |
| 216 | 3300049572 | Ga0501036_0048456 | Ga0501036_0048456_1424_2083 | 218 |
| 217 | 3300049574 | Ga0501038_0005181 | Ga0501038_0005181_10865_11524 | 218 |
| 218 | 3300049575 | Ga0501039_0009913 | Ga0501039_0009913_1449_2108 | 218 |
| 219 | 3300049575 | Ga0501039_0087963 | Ga0501039_0087963_1588_2247 | 218 |
| 220 | 3300049576 | Ga0501040_0001092 | Ga0501040_0001092_3002_3661 | 218 |
| 221 | 3300049576 | Ga0501040_0001555 | Ga0501040_0001555_1605_2264 | 218 |
| 222 | 3300049577 | Ga0501041_0000468 | Ga0501041_0000468_5961_6620 | 218 |
| 223 | 3300049577 | Ga0501041_0010094 | Ga0501041_0010094_3047_3706 | 218 |
| 224 | 3300049578 | Ga0501042_0021351 | Ga0501042_0021351_3659_4318 | 218 |
| 225 | 3300049579 | Ga0501043_0236214 | Ga0501043_0236214_22_681 | 218 |
| 226 | 3300049580 | Ga0501046_0007800 | Ga0501046_0007800_1434_2093 | 218 |
| 227 | 3300049584 | Ga0501068_0143408 | Ga0501068_0143408_654_1316 | 218 |
| 228 | 3300049584 | Ga0501068_0172549 | Ga0501068_0172549_209_868 | 218 |
| 229 | 3300049586 | Ga0501070_0175063 | Ga0501070_0175063_174_833 | 218 |
| 230 | 3300049587 | Ga0501071_0000051 | Ga0501071_0000051_7489_8148 | 218 |
| 231 | 3300049588 | Ga0501072_0001092 | Ga0501072_0001092_17226_17885 | 218 |
| 232 | 3300049588 | Ga0501072_0001642 | Ga0501072_0001642_1519_2178 | 218 |
| 233 | 3300049589 | Ga0501073_0089981 | Ga0501073_0089981_327_986 | 218 |
| 234 | 3300049589 | Ga0501073_0168574 | Ga0501073_0168574_785_1444 | 218 |
| 235 | 3300049590 | Ga0501074_0003789 | Ga0501074_0003789_606_1265 | 218 |
| 236 | 3300049591 | Ga0501075_0000116 | Ga0501075_0000116_12250_12909 | 218 |
| 237 | 3300049591 | Ga0501075_0007468 | Ga0501075_0007468_1234_1893 | 218 |
| 238 | 3300049592 | Ga0501076_0000821 | Ga0501076_0000821_17781_18440 | 218 |
| 239 | 3300049592 | Ga0501076_0430017 | Ga0501076_0430017_411_1070 | 218 |
| 240 | 3300049593 | Ga0501077_0001156 | Ga0501077_0001156_11786_12445 | 218 |
| 241 | 3300049741 | Ga0501079_0000020 | Ga0501079_0000020_4947_5606 | 218 |
| 242 | 3300049741 | Ga0501079_0020373 | Ga0501079_0020373_803_1462 | 218 |
| 243 | 3300049742 | Ga0501080_0004977 | Ga0501080_0004977_316_975 | 218 |
| 244 | 3300049742 | Ga0501080_0012211 | Ga0501080_0012211_1107_1766 | 218 |
| 245 | 3300049743 | Ga0501081_0000583 | Ga0501081_0000583_7484_8143 | 218 |
| 246 | 3300049743 | Ga0501081_0023219 | Ga0501081_0023219_2347_3006 | 218 |
| 247 | 3300049744 | Ga0501083_0010169 | Ga0501083_0010169_3749_4405 | 218 |
| 248 | 3300049744 | Ga0501083_0061338 | Ga0501083_0061338_1706_2365 | 218 |
| 249 | 3300049744 | Ga0501083_0084655 | Ga0501083_0084655_537_1196 | 218 |
| 250 | 3300049744 | Ga0501083_0208568 | Ga0501083_0208568_17_676 | 218 |
| 251 | 3300049822 | Ga0501035_0012299 | Ga0501035_0012299_7136_7795 | 218 |
| 252 | 3300049822 | Ga0501035_0018173 | Ga0501035_0018173_294_953 | 218 |
| 253 | 3300049822 | Ga0501035_0700360 | Ga0501035_0700360_95_757 | 218 |
| 254 | 3300049823 | Ga0501044_0215651 | Ga0501044_0215651_1114_1773 | 218 |
| 255 | 3300049823 | Ga0501044_0334950 | Ga0501044_0334950_598_1260 | 218 |
| 256 | 3300049824 | Ga0501045_0003929 | Ga0501045_0003929_9427_10086 | 218 |
| 257 | 3300049824 | Ga0501045_0005600 | Ga0501045_0005600_2302_2961 | 218 |
| 258 | 3300050509 | nmdc:mga0qj67_405489_c1 | nmdc:mga0qj67_405489_c1_91_750 | 218 |
| 259 | 3300050514 | nmdc:mga08x19_51428_c1 | nmdc:mga08x19_51428_c1_1802_2458 | 218 |
| 260 | 3300053134 | Ga0500658_0041432 | Ga0500658_0041432_959_1618 | 218 |
| 261 | 3300053139 | Ga0500568_0000725 | Ga0500568_0000725_4690_5349 | 218 |
| 262 | 3300053153 | Ga0500616_0000522 | Ga0500616_0000522_4776_5435 | 218 |
| 263 | 3300053727 | Ga0500611_009441 | Ga0500611_009441_736_1395 | 218 |
| 264 | 3300053727 | Ga0500611_036910 | Ga0500611_036910_352_1011 | 218 |
| 265 | 3300054114 | Ga0501084_0016473 | Ga0501084_0016473_4188_4847 | 218 |
| 266 | 3300054114 | Ga0501084_0044341 | Ga0501084_0044341_459_1118 | 218 |
| 267 | 3300054114 | Ga0501084_0160786 | Ga0501084_0160786_1139_1798 | 218 |
| 268 | 3300059642 | Ga0587069_014313 | Ga0587069_014313_267_923 | 218 |
| 269 | 3300060353 | Ga0501082_0000771 | Ga0501082_0000771_16159_16818 | 218 |
| 270 | 3300060353 | Ga0501082_0023373 | Ga0501082_0023373_4042_4701 | 218 |
| 271 | 3300061734 | Ga0530510_0066231 | Ga0530510_0066231_1266_1925 | 218 |
| 272 | iso_pu_bacteria | 2844533157 | 2844537549 | 218 |
| 273 | 3300005345 | Ga0070692_10003986 | Ga0070692_100039863 | 219 |
| 274 | 3300005356 | Ga0070674_100610349 | Ga0070674_1006103491 | 219 |
| 275 | 3300005438 | Ga0070701_10170917 | Ga0070701_101709172 | 219 |
| 276 | 3300005444 | Ga0070694_100063429 | Ga0070694_1000634292 | 219 |
| 277 | 3300005445 | Ga0070708_100012302 | Ga0070708_1000123023 | 219 |
| 278 | 3300005445 | Ga0070708_100947054 | Ga0070708_1009470541 | 219 |
| 279 | 3300005471 | Ga0070698_100502033 | Ga0070698_1005020331 | 219 |
| 280 | 3300005536 | Ga0070697_100169504 | Ga0070697_1001695042 | 219 |
| 281 | 3300005981 | Ga0081538_10011617 | Ga0081538_100116174 | 219 |
| 282 | 3300005981 | Ga0081538_10035239 | Ga0081538_100352394 | 219 |
| 283 | 3300006038 | Ga0075365_10091842 | Ga0075365_100918421 | 219 |
| 284 | 3300006051 | Ga0075364_10261717 | Ga0075364_102617171 | 219 |
| 285 | 3300006358 | Ga0068871_100078799 | Ga0068871_1000787991 | 219 |
| 286 | 3300009093 | Ga0105240_10596335 | Ga0105240_105963351 | 219 |
| 287 | 3300009094 | Ga0111539_10000294 | Ga0111539_1000029412 | 219 |
| 288 | 3300009098 | Ga0105245_10145516 | Ga0105245_101455163 | 219 |
| 289 | 3300009993 | Ga0105028_101436 | Ga0105028_1014362 | 219 |
| 290 | 3300013297 | Ga0157378_10607455 | Ga0157378_106074552 | 219 |
| 291 | 3300013306 | Ga0163162_10125990 | Ga0163162_101259901 | 219 |
| 292 | 3300014969 | Ga0157376_10147079 | Ga0157376_101470792 | 219 |
| 293 | 3300021384 | Ga0213876_10094171 | Ga0213876_100941712 | 219 |
| 294 | 3300021388 | Ga0213875_10004961 | Ga0213875_100049617 | 219 |
| 295 | 3300025294 | Ga0209025_1000077 | Ga0209025_1000077113 | 219 |
| 296 | 3300025294 | Ga0209025_1000179 | Ga0209025_100017995 | 219 |
| 297 | 3300025297 | Ga0209758_1002011 | Ga0209758_100201111 | 219 |
| 298 | 3300025302 | Ga0207426_1000191 | Ga0207426_1000191116 | 219 |
| 299 | 3300025922 | Ga0207646_10134904 | Ga0207646_101349042 | 219 |
| 300 | 3300026118 | Ga0207675_100073763 | Ga0207675_1000737634 | 219 |
| 301 | 3300026121 | Ga0207683_10215926 | Ga0207683_102159262 | 219 |
| 302 | 3300027907 | Ga0207428_10043523 | Ga0207428_100435233 | 219 |
| 303 | 3300032002 | Ga0307416_100159947 | Ga0307416_1001599474 | 219 |
| 304 | 3300037853 | Ga0436364_0622955 | Ga0436364_0622955_2058_2720 | 219 |
| 305 | 3300037853 | Ga0436364_1051528 | Ga0436364_1051528_1052_1714 | 219 |
| 306 | 3300041997 | Ga0439431_0012539 | Ga0439431_0012539_468_1136 | 219 |
| 307 | 3300042146 | Ga0450907_011232 | Ga0450907_011232_760_1428 | 219 |
| 308 | 3300045976 | Ga0466967_0239200 | Ga0466967_0239200_760_1422 | 219 |
| 309 | 3300046694 | Ga0495649_0075109 | Ga0495649_0075109_1012_1680 | 219 |
| 310 | 3300047469 | Ga0495673_0094411 | Ga0495673_0094411_293_961 | 219 |
| 311 | 3300049568 | Ga0501031_0091189 | Ga0501031_0091189_1185_1847 | 219 |
| 312 | 3300049570 | Ga0501033_0034921 | Ga0501033_0034921_2590_3252 | 219 |
| 313 | 3300049572 | Ga0501036_0168543 | Ga0501036_0168543_227_889 | 219 |
| 314 | 3300049573 | Ga0501037_0149297 | Ga0501037_0149297_504_1166 | 219 |
| 315 | 3300049573 | Ga0501037_0489685 | Ga0501037_0489685_55_717 | 219 |
| 316 | 3300049574 | Ga0501038_0051968 | Ga0501038_0051968_1225_1887 | 219 |
| 317 | 3300049575 | Ga0501039_0234895 | Ga0501039_0234895_555_1217 | 219 |
| 318 | 3300049577 | Ga0501041_0037205 | Ga0501041_0037205_1890_2552 | 219 |
| 319 | 3300049577 | Ga0501041_0119879 | Ga0501041_0119879_717_1379 | 219 |
| 320 | 3300049578 | Ga0501042_0047525 | Ga0501042_0047525_1364_2026 | 219 |
| 321 | 3300049579 | Ga0501043_0000075 | Ga0501043_0000075_63616_64278 | 219 |
| 322 | 3300049579 | Ga0501043_0064894 | Ga0501043_0064894_2185_2847 | 219 |
| 323 | 3300049580 | Ga0501046_0000195 | Ga0501046_0000195_21944_22606 | 219 |
| 324 | 3300049580 | Ga0501046_0023531 | Ga0501046_0023531_2289_2951 | 219 |
| 325 | 3300049581 | Ga0501047_0000145 | Ga0501047_0000145_63616_64278 | 219 |
| 326 | 3300049581 | Ga0501047_0045907 | Ga0501047_0045907_3442_4104 | 219 |
| 327 | 3300049582 | Ga0501048_0001016 | Ga0501048_0001016_20260_20922 | 219 |
| 328 | 3300049582 | Ga0501048_0066450 | Ga0501048_0066450_1549_2211 | 219 |
| 329 | 3300049583 | Ga0501067_0152134 | Ga0501067_0152134_46_708 | 219 |
| 330 | 3300049584 | Ga0501068_0073869 | Ga0501068_0073869_108_770 | 219 |
| 331 | 3300049587 | Ga0501071_0199279 | Ga0501071_0199279_581_1243 | 219 |
| 332 | 3300049588 | Ga0501072_0029967 | Ga0501072_0029967_2147_2809 | 219 |
| 333 | 3300049589 | Ga0501073_0028518 | Ga0501073_0028518_2759_3421 | 219 |
| 334 | 3300049589 | Ga0501073_0029687 | Ga0501073_0029687_1395_2057 | 219 |
| 335 | 3300049589 | Ga0501073_0049897 | Ga0501073_0049897_614_1276 | 219 |
| 336 | 3300049589 | Ga0501073_0144998 | Ga0501073_0144998_724_1386 | 219 |
| 337 | 3300049590 | Ga0501074_0138330 | Ga0501074_0138330_29_691 | 219 |
| 338 | 3300049591 | Ga0501075_0037154 | Ga0501075_0037154_1335_1997 | 219 |
| 339 | 3300049592 | Ga0501076_0088195 | Ga0501076_0088195_568_1230 | 219 |
| 340 | 3300049593 | Ga0501077_0073156 | Ga0501077_0073156_903_1565 | 219 |
| 341 | 3300049741 | Ga0501079_0025533 | Ga0501079_0025533_2705_3367 | 219 |
| 342 | 3300049741 | Ga0501079_0228453 | Ga0501079_0228453_425_1087 | 219 |
| 343 | 3300049742 | Ga0501080_0057613 | Ga0501080_0057613_1017_1679 | 219 |
| 344 | 3300049742 | Ga0501080_0362232 | Ga0501080_0362232_414_1082 | 219 |
| 345 | 3300049743 | Ga0501081_0046498 | Ga0501081_0046498_798_1460 | 219 |
| 346 | 3300049744 | Ga0501083_0065391 | Ga0501083_0065391_972_1634 | 219 |
| 347 | 3300049744 | Ga0501083_0580478 | Ga0501083_0580478_32_694 | 219 |
| 348 | 3300049824 | Ga0501045_0077367 | Ga0501045_0077367_359_1021 | 219 |
| 349 | 3300050491 | nmdc:mga00v17_270840_c1 | nmdc:mga00v17_270840_c1_397_1059 | 219 |
| 350 | 3300050491 | nmdc:mga00v17_69602_c1 | nmdc:mga00v17_69602_c1_927_1589 | 219 |
| 351 | 3300050492 | nmdc:mga0yw44_52735_c1 | nmdc:mga0yw44_52735_c1_1609_2271 | 219 |
| 352 | 3300050511 | nmdc:mga08y16_238_c1 | nmdc:mga08y16_238_c1_11667_12359 | 219 |
| 353 | 3300054114 | Ga0501084_0033823 | Ga0501084_0033823_1747_2409 | 219 |
| 354 | 3300054114 | Ga0501084_0150006 | Ga0501084_0150006_608_1270 | 219 |
| 355 | 3300060353 | Ga0501082_0062682 | Ga0501082_0062682_2319_2981 | 219 |
| 356 | 3300061734 | Ga0530510_0007886 | Ga0530510_0007886_5767_6429 | 219 |
| 357 | 3300002705 | JGI25156J39149_1007878 | JGI25156J39149_10078782 | 220 |
| 358 | 3300002739 | JGI25158J39367_1001640 | JGI25158J39367_10016402 | 220 |
| 359 | 3300002741 | JGI25157J39369_1000850 | JGI25157J39369_10008509 | 220 |
| 360 | 3300002773 | JGI25152J39213_1002594 | JGI25152J39213_10025947 | 220 |
| 361 | 3300002987 | JGI25159J45721_1004297 | JGI25159J45721_10042972 | 220 |
| 362 | 3300003214 | JGI25165J46597_1000037 | JGI25165J46597_1000037237 | 220 |
| 363 | 3300003215 | JGI25153J46596_10002702 | JGI25153J46596_100027021 | 220 |
| 364 | 3300003354 | JGI25160J50197_1029079 | JGI25160J50197_10290792 | 220 |
| 365 | 3300003374 | JGI25161J50226_1000300 | JGI25161J50226_100030017 | 220 |
| 366 | 3300003771 | Ga0055526_1020804 | Ga0055526_10208042 | 220 |
| 367 | 3300003775 | Ga0055524_1044178 | Ga0055524_10441781 | 220 |
| 368 | 3300003790 | Ga0055528_1040988 | Ga0055528_10409882 | 220 |
| 369 | 3300004625 | Ga0055543_1000065 | Ga0055543_10000659 | 220 |
| 370 | 3300005262 | Ga0065165_1060654 | Ga0065165_10606541 | 220 |
| 371 | 3300005327 | Ga0070658_10453413 | Ga0070658_104534131 | 220 |
| 372 | 3300005339 | Ga0070660_100136158 | Ga0070660_1001361581 | 220 |
| 373 | 3300005356 | Ga0070674_100023426 | Ga0070674_1000234262 | 220 |
| 374 | 3300005364 | Ga0070673_100031751 | Ga0070673_1000317513 | 220 |
| 375 | 3300005366 | Ga0070659_100051353 | Ga0070659_1000513532 | 220 |
| 376 | 3300005456 | Ga0070678_100010774 | Ga0070678_1000107747 | 220 |
| 377 | 3300005457 | Ga0070662_100057466 | Ga0070662_1000574661 | 220 |
| 378 | 3300005459 | Ga0068867_100049040 | Ga0068867_1000490402 | 220 |
| 379 | 3300005539 | Ga0068853_100015409 | Ga0068853_1000154092 | 220 |
| 380 | 3300005543 | Ga0070672_100114694 | Ga0070672_1001146942 | 220 |
| 381 | 3300005548 | Ga0070665_100006072 | Ga0070665_10000607216 | 220 |
| 382 | 3300005842 | Ga0068858_100644780 | Ga0068858_1006447802 | 220 |
| 383 | 3300006177 | Ga0075362_10150435 | Ga0075362_101504352 | 220 |
| 384 | 3300006847 | Ga0075431_100194086 | Ga0075431_1001940862 | 220 |
| 385 | 3300006852 | Ga0075433_10010306 | Ga0075433_100103063 | 220 |
| 386 | 3300006871 | Ga0075434_100059396 | Ga0075434_1000593963 | 220 |
| 387 | 3300006871 | Ga0075434_100504865 | Ga0075434_1005048651 | 220 |
| 388 | 3300009093 | Ga0105240_10034639 | Ga0105240_100346394 | 220 |
| 389 | 3300009545 | Ga0105237_10002299 | Ga0105237_1000229916 | 220 |
| 390 | 3300009545 | Ga0105237_10011073 | Ga0105237_100110737 | 220 |
| 391 | 3300009551 | Ga0105238_10009996 | Ga0105238_100099966 | 220 |
| 392 | 3300010375 | Ga0105239_10020752 | Ga0105239_100207526 | 220 |
| 393 | 3300010375 | Ga0105239_10273907 | Ga0105239_102739072 | 220 |
| 394 | 3300015265 | Ga0182005_1020871 | Ga0182005_10208712 | 220 |
| 395 | 3300025208 | Ga0209436_100097 | Ga0209436_1000976 | 220 |
| 396 | 3300025250 | Ga0209026_1000013 | Ga0209026_100001319 | 220 |
| 397 | 3300025256 | Ga0209759_1000149 | Ga0209759_100014959 | 220 |
| 398 | 3300025258 | Ga0209129_1001082 | Ga0209129_100108214 | 220 |
| 399 | 3300025261 | Ga0209233_1000102 | Ga0209233_1000102237 | 220 |
| 400 | 3300025273 | Ga0209673_1002249 | Ga0209673_10022499 | 220 |
| 401 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004454 | 220 |
| 402 | 3300025295 | Ga0209564_1000650 | Ga0209564_100065011 | 220 |
| 403 | 3300025297 | Ga0209758_1001247 | Ga0209758_10012478 | 220 |
| 404 | 3300025299 | Ga0209256_1002461 | Ga0209256_10024615 | 220 |
| 405 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003272 | 220 |
| 406 | 3300025907 | Ga0207645_10113029 | Ga0207645_101130292 | 220 |
| 407 | 3300025909 | Ga0207705_10574015 | Ga0207705_105740151 | 220 |
| 408 | 3300025913 | Ga0207695_10095233 | Ga0207695_100952332 | 220 |
| 409 | 3300025914 | Ga0207671_10002344 | Ga0207671_1000234413 | 220 |
| 410 | 3300025914 | Ga0207671_10025241 | Ga0207671_100252415 | 220 |
| 411 | 3300025919 | Ga0207657_10028957 | Ga0207657_100289573 | 220 |
| 412 | 3300025924 | Ga0207694_10010848 | Ga0207694_100108487 | 220 |
| 413 | 3300025932 | Ga0207690_10060371 | Ga0207690_100603712 | 220 |
| 414 | 3300025938 | Ga0207704_10025603 | Ga0207704_100256032 | 220 |
| 415 | 3300025940 | Ga0207691_10109854 | Ga0207691_101098542 | 220 |
| 416 | 3300025940 | Ga0207691_10369449 | Ga0207691_103694491 | 220 |
| 417 | 3300025960 | Ga0207651_10119561 | Ga0207651_101195612 | 220 |
| 418 | 3300026035 | Ga0207703_10582311 | Ga0207703_105823111 | 220 |
| 419 | 3300026041 | Ga0207639_10004467 | Ga0207639_100044672 | 220 |
| 420 | 3300026089 | Ga0207648_10086130 | Ga0207648_100861302 | 220 |
| 421 | 3300026121 | Ga0207683_10007131 | Ga0207683_100071313 | 220 |
| 422 | 3300026121 | Ga0207683_10522349 | Ga0207683_105223491 | 220 |
| 423 | 3300028379 | Ga0268266_10000472 | Ga0268266_1000047257 | 220 |
| 424 | 3300028379 | Ga0268266_10609201 | Ga0268266_106092011 | 220 |
| 425 | 3300035695 | Ga0373927_0010170 | Ga0373927_0010170_120_785 | 220 |
| 426 | 3300037418 | Ga0395900_0037149 | Ga0395900_0037149_2084_2899 | 220 |
| 427 | 3300037418 | Ga0395900_0605666 | Ga0395900_0605666_210_875 | 220 |
| 428 | 3300037471 | Ga0395905_0001510 | Ga0395905_0001510_6692_7357 | 220 |
| 429 | 3300037471 | Ga0395905_0046373 | Ga0395905_0046373_2585_3250 | 220 |
| 430 | 3300038443 | Ga0395901_0022725 | Ga0395901_0022725_4316_5131 | 220 |
| 431 | 3300038443 | Ga0395901_0225679 | Ga0395901_0225679_164_829 | 220 |
| 432 | 3300044658 | Ga0466972_0018818 | Ga0466972_0018818_2264_2929 | 220 |
| 433 | 3300046454 | Ga0495592_0235817 | Ga0495592_0235817_454_1119 | 220 |
| 434 | 3300046459 | Ga0495629_0035919 | Ga0495629_0035919_1308_1973 | 220 |
| 435 | 3300046474 | Ga0495605_0015141 | Ga0495605_0015141_328_993 | 220 |
| 436 | 3300046477 | Ga0495664_0082898 | Ga0495664_0082898_1133_1798 | 220 |
| 437 | 3300046501 | Ga0495607_0237519 | Ga0495607_0237519_31_696 | 220 |
| 438 | 3300046518 | Ga0495631_0017845 | Ga0495631_0017845_1508_2173 | 220 |
| 439 | 3300046524 | Ga0495648_0121580 | Ga0495648_0121580_403_1068 | 220 |
| 440 | 3300046538 | Ga0495609_0055123 | Ga0495609_0055123_1047_1712 | 220 |
| 441 | 3300046616 | Ga0495668_0014729 | Ga0495668_0014729_3183_3848 | 220 |
| 442 | 3300046642 | Ga0495634_0094788 | Ga0495634_0094788_971_1636 | 220 |
| 443 | 3300046648 | Ga0495611_0095496 | Ga0495611_0095496_143_808 | 220 |
| 444 | 3300046660 | Ga0495625_0023224 | Ga0495625_0023224_132_797 | 220 |
| 445 | 3300046675 | Ga0495657_0052454 | Ga0495657_0052454_676_1341 | 220 |
| 446 | 3300046692 | Ga0495671_0246988 | Ga0495671_0246988_131_796 | 220 |
| 447 | 3300047317 | Ga0495604_0090665 | Ga0495604_0090665_1189_1854 | 220 |
| 448 | 3300048091 | Ga0495626_0047128 | Ga0495626_0047128_310_975 | 220 |
| 449 | 3300048905 | Ga0496102_0822290 | Ga0496102_0822290_125_790 | 220 |
| 450 | 3300048906 | Ga0496103_0358760 | Ga0496103_0358760_20_685 | 220 |
| 451 | 3300048909 | Ga0496106_0000163 | Ga0496106_0000163_32027_32692 | 220 |
| 452 | 3300048924 | Ga0496121_0107819 | Ga0496121_0107819_837_1502 | 220 |
| 453 | 3300048928 | Ga0496125_0035760 | Ga0496125_0035760_1935_2600 | 220 |
| 454 | 3300049459 | Ga0495678_036401 | Ga0495678_036401_82_747 | 220 |
| 455 | 3300049823 | Ga0501044_0216149 | Ga0501044_0216149_427_1092 | 220 |
| 456 | 3300050494 | nmdc:mga06z11_82802_c1 | nmdc:mga06z11_82802_c1_80_745 | 220 |
| 457 | 3300050510 | nmdc:mga06r32_323122_c1 | nmdc:mga06r32_323122_c1_787_1452 | 220 |
| 458 | 3300050512 | nmdc:mga0n895_27890_c1 | nmdc:mga0n895_27890_c1_3109_3774 | 220 |
| 459 | 3300050515 | nmdc:mga0a205_89941_c1 | nmdc:mga0a205_89941_c1_59_724 | 220 |
| 460 | 3300053105 | Ga0500557_011175 | Ga0500557_011175_952_1617 | 220 |
| 461 | 3300053125 | Ga0500618_006136 | Ga0500618_006136_420_1085 | 220 |
| 462 | 3300053134 | Ga0500658_0004963 | Ga0500658_0004963_2933_3598 | 220 |
| 463 | 3300053136 | Ga0500559_0029444 | Ga0500559_0029444_604_1269 | 220 |
| 464 | 3300053139 | Ga0500568_0000444 | Ga0500568_0000444_15655_16320 | 220 |
| 465 | 3300053148 | Ga0500590_000591 | Ga0500590_000591_3721_4386 | 220 |
| 466 | 3300053158 | Ga0500627_0109374 | Ga0500627_0109374_216_881 | 220 |
| 467 | 3300053160 | Ga0500633_0000270 | Ga0500633_0000270_2838_3503 | 220 |
| 468 | 3300049591 | Ga0501075_0513578 | Ga0501075_0513578_178_894 | 221 |
| 469 | 3300006195 | Ga0075366_10199108 | Ga0075366_101991081 | 222 |
| 470 | 3300028379 | Ga0268266_11057265 | Ga0268266_110572651 | 222 |
| 471 | 3300005365 | Ga0070688_100559179 | Ga0070688_1005591791 | 223 |
| 472 | 3300021358 | Ga0213873_10017146 | Ga0213873_100171462 | 223 |
| 473 | 3300039453 | Ga0436362_0093681 | Ga0436362_0093681_571_1242 | 223 |
| 474 | 3300044712 | Ga0453684_0075492 | Ga0453684_0075492_100_780 | 225 |
| 475 | 3300000546 | LJNas_1000209 | LJNas_10002092 | 226 |
| 476 | 3300005330 | Ga0070690_100006843 | Ga0070690_1000068435 | 226 |
| 477 | 3300005334 | Ga0068869_100167430 | Ga0068869_1001674301 | 226 |
| 478 | 3300005336 | Ga0070680_100297454 | Ga0070680_1002974542 | 226 |
| 479 | 3300005337 | Ga0070682_100132293 | Ga0070682_1001322932 | 226 |
| 480 | 3300005340 | Ga0070689_100034500 | Ga0070689_1000345005 | 226 |
| 481 | 3300005343 | Ga0070687_100166020 | Ga0070687_1001660201 | 226 |
| 482 | 3300005353 | Ga0070669_100188710 | Ga0070669_1001887101 | 226 |
| 483 | 3300005354 | Ga0070675_100024483 | Ga0070675_1000244831 | 226 |
| 484 | 3300005365 | Ga0070688_100008377 | Ga0070688_1000083774 | 226 |
| 485 | 3300005366 | Ga0070659_100061159 | Ga0070659_1000611593 | 226 |
| 486 | 3300005455 | Ga0070663_100321798 | Ga0070663_1003217981 | 226 |
| 487 | 3300005535 | Ga0070684_100053678 | Ga0070684_1000536782 | 226 |
| 488 | 3300005539 | Ga0068853_100641131 | Ga0068853_1006411311 | 226 |
| 489 | 3300005543 | Ga0070672_100773101 | Ga0070672_1007731011 | 226 |
| 490 | 3300005548 | Ga0070665_100368653 | Ga0070665_1003686532 | 226 |
| 491 | 3300005617 | Ga0068859_100048953 | Ga0068859_1000489535 | 226 |
| 492 | 3300005840 | Ga0068870_10111506 | Ga0068870_101115061 | 226 |
| 493 | 3300005843 | Ga0068860_100094545 | Ga0068860_1000945453 | 226 |
| 494 | 3300005844 | Ga0068862_100100804 | Ga0068862_1001008042 | 226 |
| 495 | 3300006847 | Ga0075431_100032383 | Ga0075431_1000323832 | 226 |
| 496 | 3300006881 | Ga0068865_100013688 | Ga0068865_1000136882 | 226 |
| 497 | 3300006881 | Ga0068865_100126659 | Ga0068865_1001266592 | 226 |
| 498 | 3300006931 | Ga0097620_100048946 | Ga0097620_1000489465 | 226 |
| 499 | 3300009101 | Ga0105247_10109179 | Ga0105247_101091792 | 226 |
| 500 | 3300009177 | Ga0105248_10285540 | Ga0105248_102855402 | 226 |
| 501 | 3300009553 | Ga0105249_10123114 | Ga0105249_101231144 | 226 |
| 502 | 3300010375 | Ga0105239_10903726 | Ga0105239_109037261 | 226 |
| 503 | 3300013308 | Ga0157375_10056713 | Ga0157375_100567134 | 226 |
| 504 | 3300014325 | Ga0163163_10052473 | Ga0163163_100524732 | 226 |
| 505 | 3300014326 | Ga0157380_10047668 | Ga0157380_100476682 | 226 |
| 506 | 3300014745 | Ga0157377_10111730 | Ga0157377_101117302 | 226 |
| 507 | 3300014969 | Ga0157376_10005076 | Ga0157376_100050769 | 226 |
| 508 | 3300025907 | Ga0207645_10056721 | Ga0207645_100567212 | 226 |
| 509 | 3300025908 | Ga0207643_10059272 | Ga0207643_100592722 | 226 |
| 510 | 3300025908 | Ga0207643_10253670 | Ga0207643_102536702 | 226 |
| 511 | 3300025932 | Ga0207690_10127950 | Ga0207690_101279502 | 226 |
| 512 | 3300025935 | Ga0207709_10150108 | Ga0207709_101501081 | 226 |
| 513 | 3300025938 | Ga0207704_10132363 | Ga0207704_101323631 | 226 |
| 514 | 3300025938 | Ga0207704_10227515 | Ga0207704_102275152 | 226 |
| 515 | 3300025940 | Ga0207691_10598411 | Ga0207691_105984111 | 226 |
| 516 | 3300025942 | Ga0207689_10016674 | Ga0207689_100166744 | 226 |
| 517 | 3300025972 | Ga0207668_10185115 | Ga0207668_101851152 | 226 |
| 518 | 3300026023 | Ga0207677_10221577 | Ga0207677_102215771 | 226 |
| 519 | 3300026035 | Ga0207703_10063994 | Ga0207703_100639941 | 226 |
| 520 | 3300026116 | Ga0207674_10057534 | Ga0207674_100575344 | 226 |
| 521 | 3300028379 | Ga0268266_10323988 | Ga0268266_103239882 | 226 |
| 522 | 3300028379 | Ga0268266_10545057 | Ga0268266_105450571 | 226 |
| 523 | 3300028380 | Ga0268265_10515376 | Ga0268265_105153762 | 226 |
| 524 | 3300039453 | Ga0436362_1255939 | Ga0436362_1255939_1278_1964 | 226 |
| 525 | 3300048911 | Ga0496108_0017169 | Ga0496108_0017169_485_1174 | 226 |
| 526 | 3300048912 | Ga0496109_0332465 | Ga0496109_0332465_53_742 | 226 |
| 527 | 3300048913 | Ga0496110_0379968 | Ga0496110_0379968_39_728 | 226 |
| 528 | 3300048917 | Ga0496114_0258060 | Ga0496114_0258060_217_906 | 226 |
| 529 | 3300050510 | nmdc:mga06r32_133937_c1 | nmdc:mga06r32_133937_c1_212_946 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9634 | 1 | 215 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9569 | 2 | 217 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9476 | 2 | 217 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9448 | 1 | 215 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.9134 | 1 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9531 | 4 | 105 | 3.40.30.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9403 | 154 | 215 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9317 | 154 | 217 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9269 | 4 | 105 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9182 | 154 | 217 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.9813 | 1 | 105 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9801 | 1 | 103 |
|
| AF-A0A7C7WM65-F1-model_v4 | Redoxin domain-containing protein | 0.9719 | 2 | 168 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-C3KLK5-F1-model_v4 | Peroxiredoxin 6 (EC 1.11.1.-) | 0.9632 | 2 | 217 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A2V8H4H9-F1-model_v4 | Peroxidase | 0.9632 | 2 | 201 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar