F459836

General Info

Members Datasets Scaffolds Average Seq Length
529 337 500 222

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0037149|Ga0395900_0037149_2084_2899
Length 271
Sequence MDRNAHQSTIRKKESRRRSHHQPAVVGERWRNIDFLICLRNQIPTGKEMTMSLRIADIAPDFTADTTQGPISFHEWLGKDWGILFSHPKDYTPVCTTELGYMARLKPEFDKRGVKVIGLSVDPVEKHAGWAKDIAETQGMAPNFPMIGDPTLAVSQLYDMLPASAGNSADGRTAADNQTVRNVYVIGPDKKIKLVISYPMTTGRNFDEVLRVVDSLQLTAKHRLATPVNWKPGDDVIIAGSVSNDEAKQLYPQGWKEPKPYIRIVPQPVLT

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
3 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
4 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
5 2643221629 Devosia sp. Root105 Isolate Unclassified
6 2643221662 Devosia sp. Root413D1 Isolate Unclassified
7 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
8 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
9 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
10 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
11 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
12 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
13 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
14 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
15 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
16 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
17 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
18 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
19 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
20 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
21 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
22 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
23 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
24 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
25 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
26 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
27 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
28 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
29 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
30 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
33 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
230 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
330 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
331 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
336 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
337 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.14
Metatranscriptomes 0.38
Isolates 5.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.7
Nodule 3.78
Rhizoplane 1.7
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000209 3300000546 Bacteria 9945
2 JGI25156J39149_1007878 3300002705 Bacteria 2745
3 JGI25158J39367_1001640 3300002739 Bacteria 3856
4 JGI25157J39369_1000850 3300002741 Bacteria 15042
5 JGI25152J39213_1002594 3300002773 Bacteria 6745
6 JGI25159J45721_1004297 3300002987 Bacteria 4772
7 JGI25165J46597_1000037 3300003214 Bacteria 285722
8 JGI25153J46596_10002702 3300003215 Bacteria 10115
9 JGI25160J50197_1029079 3300003354 Bacteria 1470
10 JGI25161J50226_1000300 3300003374 Bacteria 27867
11 Ga0055526_1020804 3300003771 Bacteria 2313
12 Ga0055524_1044178 3300003775 Bacteria 1086
13 Ga0055528_1040988 3300003790 Bacteria 1037
14 Ga0055543_1000065 3300004625 Bacteria 97333
15 Ga0065165_1060654 3300005262 Bacteria 1037
16 Ga0065715_10364253 3300005293 Bacteria 929
17 Ga0070658_10006622 3300005327 Bacteria 9387
18 Ga0070658_10453413 3300005327 Bacteria 1105
19 Ga0070690_100006843 3300005330 Bacteria 6486
20 Ga0070670_100077243 3300005331 Bacteria 2861
21 Ga0070670_100078399 3300005331 Bacteria 2838
22 Ga0068869_100167430 3300005334 Bacteria 1715
23 Ga0068869_100323978 3300005334 Bacteria 1250
24 Ga0070666_10026904 3300005335 Bacteria 3763
25 Ga0070680_100080949 3300005336 Bacteria 2679
26 Ga0070680_100297454 3300005336 Bacteria 1368
27 Ga0070682_100005616 3300005337 Bacteria 6991
28 Ga0070682_100132293 3300005337 Bacteria 1690
29 Ga0070682_100211575 3300005337 Bacteria 1374
30 Ga0068868_100021409 3300005338 Bacteria 4868
31 Ga0070660_100136158 3300005339 Bacteria 1968
32 Ga0070689_100034500 3300005340 Bacteria 3860
33 Ga0070687_100166020 3300005343 Bacteria 1309
34 Ga0070687_100234410 3300005343 Bacteria 1131
35 Ga0070661_100162073 3300005344 Bacteria 1694
36 Ga0070692_10003986 3300005345 Bacteria 6096
37 Ga0070669_100188710 3300005353 Bacteria 1616
38 Ga0070675_100002968 3300005354 Bacteria 12810
39 Ga0070675_100024483 3300005354 Bacteria 4834
40 Ga0070671_100005081 3300005355 Bacteria 10478
41 Ga0070674_100023426 3300005356 Bacteria 3996
42 Ga0070674_100610349 3300005356 Bacteria 923
43 Ga0070673_100012281 3300005364 Bacteria 5876
44 Ga0070673_100031751 3300005364 Bacteria 3967
45 Ga0070673_100875187 3300005364 Bacteria 832
46 Ga0070688_100008377 3300005365 Bacteria 5609
47 Ga0070688_100559179 3300005365 Bacteria 871
48 Ga0070659_100051353 3300005366 Bacteria 3242
49 Ga0070659_100061159 3300005366 Bacteria 2976
50 Ga0070667_100040773 3300005367 Bacteria 3895
51 Ga0070714_100012361 3300005435 Bacteria 6815
52 Ga0070714_100111152 3300005435 Bacteria 2426
53 Ga0070714_100559087 3300005435 Bacteria 1096
54 Ga0070713_100124160 3300005436 Bacteria 2268
55 Ga0070713_100239524 3300005436 Bacteria 1652
56 Ga0070710_10538118 3300005437 Bacteria 805
57 Ga0070701_10170917 3300005438 Bacteria 1266
58 Ga0070711_100132580 3300005439 Bacteria 1858
59 Ga0070694_100063429 3300005444 Bacteria 2527
60 Ga0070708_100012302 3300005445 Bacteria 6978
61 Ga0070708_100947054 3300005445 Bacteria 808
62 Ga0070663_100043593 3300005455 Bacteria 3158
63 Ga0070663_100053366 3300005455 Bacteria 2885
64 Ga0070663_100321798 3300005455 Bacteria 1244
65 Ga0070678_100010774 3300005456 Bacteria 5603
66 Ga0070662_100057466 3300005457 Bacteria 2827
67 Ga0070662_100269523 3300005457 Bacteria 1374
68 Ga0068867_100049040 3300005459 Bacteria 3108
69 Ga0068867_100104614 3300005459 Bacteria 2167
70 Ga0070685_10004790 3300005466 Bacteria 6852
71 Ga0070706_100061798 3300005467 Bacteria 3459
72 Ga0070698_100502033 3300005471 Bacteria 1151
73 Ga0070684_100053678 3300005535 Bacteria 3510
74 Ga0070697_100026383 3300005536 Bacteria 4640
75 Ga0070697_100169504 3300005536 Bacteria 1847
76 Ga0068853_100015409 3300005539 Bacteria 6281
77 Ga0068853_100641131 3300005539 Bacteria 1011
78 Ga0070672_100000676 3300005543 Bacteria 20037
79 Ga0070672_100114694 3300005543 Bacteria 2200
80 Ga0070672_100267547 3300005543 Bacteria 1443
81 Ga0070672_100418801 3300005543 Bacteria 1150
82 Ga0070672_100773101 3300005543 Bacteria 844
83 Ga0070686_100162485 3300005544 Bacteria 1574
84 Ga0070695_100004097 3300005545 Bacteria 8517
85 Ga0070696_100000861 3300005546 Bacteria 19604
86 Ga0070696_100206962 3300005546 Bacteria 1467
87 Ga0070665_100006072 3300005548 Bacteria 12347
88 Ga0070665_100368653 3300005548 Bacteria 1443
89 Ga0070704_100111095 3300005549 Bacteria 2086
90 Ga0068855_100061462 3300005563 Bacteria 4389
91 Ga0070664_100093228 3300005564 Bacteria 2609
92 Ga0068854_100119185 3300005578 Bacteria 2001
93 Ga0070702_100399115 3300005615 Bacteria 983
94 Ga0068859_100002586 3300005617 Bacteria 18412
95 Ga0068859_100048953 3300005617 Bacteria 4245
96 Ga0068859_100380849 3300005617 Bacteria 1506
97 Ga0068859_100453154 3300005617 Bacteria 1379
98 Ga0068864_100124860 3300005618 Bacteria 2305
99 Ga0068870_10111506 3300005840 Bacteria 1563
100 Ga0068863_100005191 3300005841 Bacteria 12848
101 Ga0068858_100014526 3300005842 Bacteria 7419
102 Ga0068858_100644780 3300005842 Bacteria 1029
103 Ga0068860_100003598 3300005843 Bacteria 15930
104 Ga0068860_100094545 3300005843 Bacteria 2849
105 Ga0068862_100100804 3300005844 Bacteria 2525
106 Ga0081455_10174405 3300005937 Bacteria 1634
107 Ga0081538_10011617 3300005981 Bacteria 7119
108 Ga0081538_10035239 3300005981 Bacteria 3291
109 Ga0070717_10188340 3300006028 Bacteria 1802
110 Ga0075365_10091842 3300006038 Bacteria 2069
111 Ga0075364_10261717 3300006051 Bacteria 1176
112 Ga0075362_10150435 3300006177 Bacteria 1116
113 Ga0075366_10199108 3300006195 Bacteria 1218
114 Ga0097621_100001774 3300006237 Bacteria 14795
115 Ga0097621_100017679 3300006237 Bacteria 5422
116 Ga0068871_100000977 3300006358 Bacteria 19153
117 Ga0068871_100005924 3300006358 Bacteria 8604
118 Ga0068871_100078799 3300006358 Bacteria 2725
119 Ga0075430_100487808 3300006846 Bacteria 1017
120 Ga0075431_100032383 3300006847 Bacteria 5386
121 Ga0075431_100194086 3300006847 Bacteria 2079
122 Ga0075433_10010306 3300006852 Bacteria 7495
123 Ga0075434_100059396 3300006871 Bacteria 3801
124 Ga0075434_100504865 3300006871 Bacteria 1230
125 Ga0068865_100013688 3300006881 Bacteria 5137
126 Ga0068865_100126659 3300006881 Bacteria 1907
127 Ga0075436_100023439 3300006914 Bacteria 4240
128 Ga0075436_100191109 3300006914 Bacteria 1449
129 Ga0097620_100002586 3300006931 Bacteria 18412
130 Ga0097620_100048946 3300006931 Bacteria 4245
131 Ga0097620_100380878 3300006931 Bacteria 1506
132 Ga0097620_100453237 3300006931 Bacteria 1379
133 Ga0105240_10034639 3300009093 Bacteria 6511
134 Ga0105240_10120073 3300009093 Bacteria 3166
135 Ga0105240_10395029 3300009093 Bacteria 1559
136 Ga0105240_10596335 3300009093 Bacteria 1217
137 Ga0111539_10000294 3300009094 Bacteria 60290
138 Ga0105245_10023458 3300009098 Bacteria 5416
139 Ga0105245_10145516 3300009098 Bacteria 2236
140 Ga0105247_10109179 3300009101 Bacteria 1778
141 Ga0114129_10863459 3300009147 Bacteria 1149
142 Ga0105241_10383592 3300009174 Bacteria 1228
143 Ga0105242_10260438 3300009176 Bacteria 1566
144 Ga0105242_10294552 3300009176 Bacteria 1479
145 Ga0105248_10000997 3300009177 Bacteria 31307
146 Ga0105248_10014429 3300009177 Bacteria 8696
147 Ga0105248_10285540 3300009177 Bacteria 1858
148 Ga0105237_10002299 3300009545 Bacteria 23749
149 Ga0105237_10011073 3300009545 Bacteria 9560
150 Ga0105238_10009996 3300009551 Bacteria 9516
151 Ga0105238_10081917 3300009551 Bacteria 3217
152 Ga0105249_10123114 3300009553 Bacteria 2467
153 Ga0105028_101436 3300009993 Bacteria 2517
154 Ga0105239_10020752 3300010375 Bacteria 7249
155 Ga0105239_10237542 3300010375 Bacteria 2046
156 Ga0105239_10273907 3300010375 Bacteria 1899
157 Ga0105239_10903726 3300010375 Bacteria 1013
158 Ga0157371_10213576 3300013102 Bacteria 1385
159 Ga0157370_10030755 3300013104 Bacteria 5260
160 Ga0157370_10624341 3300013104 Bacteria 986
161 Ga0157369_10095542 3300013105 Bacteria 3171
162 Ga0157378_10000764 3300013297 Bacteria 29926
163 Ga0157378_10607455 3300013297 Bacteria 1105
164 Ga0163162_10006138 3300013306 Bacteria 11630
165 Ga0163162_10125990 3300013306 Bacteria 2667
166 Ga0163162_10552805 3300013306 Bacteria 1279
167 Ga0157372_11122356 3300013307 Bacteria 909
168 Ga0157375_10000197 3300013308 Bacteria 56238
169 Ga0157375_10056713 3300013308 Bacteria 3869
170 Ga0163163_10015347 3300014325 Bacteria 7079
171 Ga0163163_10052473 3300014325 Bacteria 4023
172 Ga0157380_10047668 3300014326 Bacteria 3371
173 Ga0157377_10111730 3300014745 Bacteria 1643
174 Ga0157379_10000050 3300014968 Bacteria 74545
175 Ga0157376_10005076 3300014969 Bacteria 9181
176 Ga0157376_10147079 3300014969 Bacteria 2121
177 Ga0182005_1020871 3300015265 Bacteria 1799
178 Ga0213873_10017146 3300021358 Bacteria 1648
179 Ga0213876_10093523 3300021384 Bacteria 1593
180 Ga0213876_10094171 3300021384 Bacteria 1587
181 Ga0213875_10004961 3300021388 Bacteria 7217
182 Ga0209436_100097 3300025208 Bacteria 42571
183 Ga0209026_1000013 3300025250 Bacteria 415633
184 Ga0209759_1000149 3300025256 Bacteria 120932
185 Ga0209129_1001082 3300025258 Bacteria 16013
186 Ga0209233_1000102 3300025261 Bacteria 285774
187 Ga0209673_1002249 3300025273 Bacteria 13924
188 Ga0209130_1000004 3300025284 Bacteria 633436
189 Ga0209025_1000077 3300025294 Bacteria 271958
190 Ga0209025_1000179 3300025294 Bacteria 157965
191 Ga0209564_1000650 3300025295 Bacteria 52044
192 Ga0209758_1001247 3300025297 Bacteria 31568
193 Ga0209758_1002011 3300025297 Bacteria 21870
194 Ga0209256_1002461 3300025299 Bacteria 15057
195 Ga0207426_1000003 3300025302 Bacteria 1063212
196 Ga0207426_1000191 3300025302 Bacteria 151850
197 Ga0207680_10033810 3300025903 Bacteria 2920
198 Ga0207680_10086983 3300025903 Bacteria 1978
199 Ga0207645_10056721 3300025907 Bacteria 2500
200 Ga0207645_10113029 3300025907 Bacteria 1759
201 Ga0207643_10059272 3300025908 Bacteria 2184
202 Ga0207643_10253670 3300025908 Bacteria 1084
203 Ga0207705_10039487 3300025909 Bacteria 3384
204 Ga0207705_10574015 3300025909 Bacteria 877
205 Ga0207684_10041138 3300025910 Bacteria 3920
206 Ga0207654_10189866 3300025911 Bacteria 1346
207 Ga0207695_10095233 3300025913 Bacteria 2982
208 Ga0207695_10277015 3300025913 Bacteria 1572
209 Ga0207671_10002344 3300025914 Bacteria 20412
210 Ga0207671_10025241 3300025914 Bacteria 4465
211 Ga0207663_10602727 3300025916 Bacteria 863
212 Ga0207662_10202892 3300025918 Bacteria 1284
213 Ga0207657_10028957 3300025919 Bacteria 5046
214 Ga0207657_10203913 3300025919 Bacteria 1590
215 Ga0207646_10134904 3300025922 Bacteria 2222
216 Ga0207694_10010848 3300025924 Bacteria 6878
217 Ga0207650_10012822 3300025925 Bacteria 5792
218 Ga0207650_10088087 3300025925 Bacteria 2367
219 Ga0207650_10123133 3300025925 Bacteria 2021
220 Ga0207659_10001541 3300025926 Bacteria 13677
221 Ga0207687_10013039 3300025927 Bacteria 5430
222 Ga0207687_10174646 3300025927 Bacteria 1660
223 Ga0207700_10190911 3300025928 Bacteria 1721
224 Ga0207700_10666948 3300025928 Bacteria 928
225 Ga0207664_10051588 3300025929 Bacteria 3249
226 Ga0207644_10007848 3300025931 Bacteria 6972
227 Ga0207644_10112180 3300025931 Bacteria 2063
228 Ga0207690_10060371 3300025932 Bacteria 2573
229 Ga0207690_10127950 3300025932 Bacteria 1855
230 Ga0207709_10150108 3300025935 Bacteria 1613
231 Ga0207704_10025603 3300025938 Bacteria 3221
232 Ga0207704_10132363 3300025938 Bacteria 1730
233 Ga0207704_10227515 3300025938 Bacteria 1384
234 Ga0207704_10610556 3300025938 Bacteria 894
235 Ga0207691_10006850 3300025940 Bacteria 10999
236 Ga0207691_10109854 3300025940 Bacteria 2453
237 Ga0207691_10369449 3300025940 Bacteria 1225
238 Ga0207691_10598411 3300025940 Bacteria 933
239 Ga0207711_10007088 3300025941 Bacteria 9390
240 Ga0207711_10115056 3300025941 Bacteria 2396
241 Ga0207689_10016674 3300025942 Bacteria 6217
242 Ga0207689_10377634 3300025942 Bacteria 1180
243 Ga0207679_10069764 3300025945 Bacteria 2646
244 Ga0207667_10037929 3300025949 Bacteria 5150
245 Ga0207651_10006051 3300025960 Bacteria 6284
246 Ga0207651_10119561 3300025960 Bacteria 1995
247 Ga0207668_10185115 3300025972 Bacteria 1646
248 Ga0207640_10197349 3300025981 Bacteria 1522
249 Ga0207658_10232692 3300025986 Bacteria 1556
250 Ga0207677_10011645 3300026023 Bacteria 5020
251 Ga0207677_10221577 3300026023 Bacteria 1517
252 Ga0207703_10063994 3300026035 Bacteria 3017
253 Ga0207703_10582311 3300026035 Bacteria 1057
254 Ga0207639_10004467 3300026041 Bacteria 9440
255 Ga0207678_10075269 3300026067 Bacteria 2892
256 Ga0207678_10101334 3300026067 Bacteria 2459
257 Ga0207641_10001463 3300026088 Bacteria 23157
258 Ga0207641_10070881 3300026088 Bacteria 2996
259 Ga0207641_10399688 3300026088 Bacteria 1319
260 Ga0207648_10073369 3300026089 Bacteria 2982
261 Ga0207648_10086130 3300026089 Bacteria 2741
262 Ga0207676_10025695 3300026095 Bacteria 4372
263 Ga0207674_10057534 3300026116 Bacteria 3941
264 Ga0207675_100073763 3300026118 Bacteria 3193
265 Ga0207683_10007131 3300026121 Bacteria 9582
266 Ga0207683_10215926 3300026121 Bacteria 1747
267 Ga0207683_10522349 3300026121 Bacteria 1097
268 Ga0207428_10043523 3300027907 Bacteria 3625
269 Ga0268266_10000472 3300028379 Bacteria 58159
270 Ga0268266_10323988 3300028379 Bacteria 1443
271 Ga0268266_10545057 3300028379 Bacteria 1111
272 Ga0268266_10609201 3300028379 Bacteria 1049
273 Ga0268266_11057265 3300028379 Bacteria 785
274 Ga0268265_10515376 3300028380 Bacteria 1129
275 Ga0268264_10005331 3300028381 Bacteria 10895
276 Ga0268264_10137685 3300028381 Bacteria 2173
277 Ga0265319_1031568 3300028563 Bacteria 1843
278 Ga0265338_10037552 3300028800 Bacteria 4607
279 Ga0265338_10091789 3300028800 Bacteria 2507
280 Ga0265760_10005225 3300031090 Bacteria 3719
281 Ga0265328_10000577 3300031239 Bacteria 16979
282 Ga0265320_10015215 3300031240 Bacteria 4355
283 Ga0265325_10036919 3300031241 Bacteria 2586
284 Ga0265325_10072945 3300031241 Bacteria 1719
285 Ga0265314_10015545 3300031711 Bacteria 6038
286 Ga0265314_10017597 3300031711 Bacteria 5604
287 Ga0265314_10203822 3300031711 Bacteria 1167
288 Ga0307413_10472846 3300031824 Bacteria 1000
289 Ga0307406_10216141 3300031901 Bacteria 1422
290 Ga0307416_100159947 3300032002 Bacteria 2080
291 Ga0307416_100601829 3300032002 Bacteria 1179
292 Ga0307414_10583326 3300032004 Bacteria 1001
293 Ga0307411_10215830 3300032005 Bacteria 1485
294 Ga0373936_0009161 3300035113 Bacteria 3731
295 Ga0373954_0095797 3300035118 Bacteria 1429
296 Ga0373924_0044504 3300035410 Bacteria 1824
297 Ga0373935_0015697 3300035692 Bacteria 4580
298 Ga0373927_0010170 3300035695 Bacteria 6290
299 Ga0373937_0886836 3300036401 Bacteria 841
300 Ga0373925_0021842 3300037068 Bacteria 4665
301 Ga0395900_0037149 3300037418 Bacteria 5023
302 Ga0395900_0605666 3300037418 Bacteria 1036
303 Ga0395905_0001510 3300037471 Bacteria 27815
304 Ga0395905_0046373 3300037471 Bacteria 4075
305 Ga0436364_0622955 3300037853 Bacteria 6062
306 Ga0436364_1051528 3300037853 Bacteria 1765
307 Ga0395901_0022725 3300038443 Bacteria 6431
308 Ga0395901_0225679 3300038443 Bacteria 1957
309 Ga0395901_0382175 3300038443 Bacteria 1449
310 Ga0436365_0701971 3300039437 Bacteria 1501
311 Ga0436365_0945779 3300039437 Bacteria 1836
312 Ga0436365_1625021 3300039437 Bacteria 851
313 Ga0436360_0007524 3300039438 Bacteria 1367
314 Ga0436362_0093681 3300039453 Bacteria 3241
315 Ga0436362_1255939 3300039453 Bacteria 2161
316 Ga0439431_0012539 3300041997 Bacteria 1949
317 Ga0439463_085943 3300042016 Bacteria 809
318 Ga0450915_005089 3300042119 Bacteria 800
319 Ga0450907_011232 3300042146 Bacteria 1488
320 Ga0439464_0018622 3300042439 Bacteria 1890
321 Ga0451577_0149261 3300042876 Bacteria 2103
322 Ga0451577_0659411 3300042876 Bacteria 949
323 Ga0466972_0018818 3300044658 Bacteria 3452
324 Ga0466963_0025369 3300044694 Bacteria 3780
325 Ga0453684_0075492 3300044712 Bacteria 4236
326 Ga0451576_0000003 3300045051 Bacteria 1550573
327 Ga0451576_0381888 3300045051 Bacteria 1476
328 Ga0466967_0061585 3300045976 Bacteria 3329
329 Ga0466967_0239200 3300045976 Bacteria 1731
330 Ga0495592_0152896 3300046454 Bacteria 1594
331 Ga0495592_0235817 3300046454 Bacteria 1216
332 Ga0495629_0035236 3300046459 Bacteria 3537
333 Ga0495629_0035919 3300046459 Bacteria 3500
334 Ga0495638_0016472 3300046460 Bacteria 4950
335 Ga0495580_0005176 3300046472 Bacteria 10847
336 Ga0495605_0015141 3300046474 Bacteria 4203
337 Ga0495664_0082898 3300046477 Bacteria 1924
338 Ga0495607_0237519 3300046501 Bacteria 883
339 Ga0495620_0116069 3300046515 Bacteria 1058
340 Ga0495628_0240607 3300046516 Bacteria 1354
341 Ga0495630_0067951 3300046517 Bacteria 2679
342 Ga0495630_0218305 3300046517 Bacteria 1456
343 Ga0495631_0017845 3300046518 Bacteria 3350
344 Ga0495643_0072231 3300046522 Bacteria 1810
345 Ga0495648_0121580 3300046524 Bacteria 1403
346 Ga0495648_0322889 3300046524 Bacteria 715
347 Ga0495665_0036139 3300046531 Bacteria 2637
348 Ga0495586_0201715 3300046535 Bacteria 1128
349 Ga0495609_0055123 3300046538 Bacteria 1764
350 Ga0495668_0014729 3300046616 Bacteria 4579
351 Ga0495634_0094788 3300046642 Bacteria 1934
352 Ga0495611_0095496 3300046648 Bacteria 1376
353 Ga0495625_0023224 3300046660 Bacteria 4740
354 Ga0495625_0221463 3300046660 Bacteria 1240
355 Ga0495657_0052454 3300046675 Bacteria 2734
356 Ga0495658_0342609 3300046683 Bacteria 949
357 Ga0495613_0175601 3300046689 Bacteria 1519
358 Ga0495671_0246988 3300046692 Bacteria 862
359 Ga0495649_0075109 3300046694 Bacteria 1810
360 Ga0495581_0089424 3300047315 Bacteria 1786
361 Ga0495604_0090665 3300047317 Bacteria 2269
362 Ga0495674_0003679 3300047319 Bacteria 14916
363 Ga0495672_0040567 3300047320 Bacteria 2822
364 Ga0495673_0094411 3300047469 Bacteria 1218
365 Ga0495684_0046811 3300047471 Bacteria 3309
366 Ga0495626_0047128 3300048091 Bacteria 2005
367 Ga0496102_0735109 3300048905 Bacteria 910
368 Ga0496102_0822290 3300048905 Bacteria 851
369 Ga0496103_0358760 3300048906 Bacteria 937
370 Ga0496106_0000163 3300048909 Bacteria 48064
371 Ga0496108_0017169 3300048911 Bacteria 5920
372 Ga0496109_0332465 3300048912 Bacteria 1434
373 Ga0496110_0379968 3300048913 Bacteria 1287
374 Ga0496113_0120693 3300048916 Bacteria 2049
375 Ga0496114_0258060 3300048917 Bacteria 1534
376 Ga0496121_0107819 3300048924 Bacteria 2132
377 Ga0496125_0035760 3300048928 Bacteria 4350
378 Ga0495678_036401 3300049459 Bacteria 2008
379 Ga0501031_0091189 3300049568 Bacteria 1987
380 Ga0501032_0158339 3300049569 Bacteria 1487
381 Ga0501032_0321367 3300049569 Bacteria 999
382 Ga0501033_0023020 3300049570 Bacteria 4696
383 Ga0501033_0034921 3300049570 Bacteria 3769
384 Ga0501034_0444364 3300049571 Bacteria 1215
385 Ga0501036_0010306 3300049572 Bacteria 7710
386 Ga0501036_0048456 3300049572 Bacteria 3597
387 Ga0501036_0168543 3300049572 Bacteria 1845
388 Ga0501037_0149297 3300049573 Bacteria 1671
389 Ga0501037_0489685 3300049573 Bacteria 835
390 Ga0501038_0005181 3300049574 Bacteria 12128
391 Ga0501038_0051968 3300049574 Bacteria 3534
392 Ga0501039_0009913 3300049575 Bacteria 7264
393 Ga0501039_0087963 3300049575 Bacteria 2420
394 Ga0501039_0234895 3300049575 Bacteria 1441
395 Ga0501040_0001092 3300049576 Bacteria 17152
396 Ga0501040_0001555 3300049576 Bacteria 14603
397 Ga0501041_0000468 3300049577 Bacteria 20479
398 Ga0501041_0010094 3300049577 Bacteria 5563
399 Ga0501041_0037205 3300049577 Bacteria 2948
400 Ga0501041_0119879 3300049577 Bacteria 1635
401 Ga0501042_0021351 3300049578 Bacteria 4511
402 Ga0501042_0047525 3300049578 Bacteria 3060
403 Ga0501043_0000075 3300049579 Bacteria 86156
404 Ga0501043_0064894 3300049579 Bacteria 2867
405 Ga0501043_0236214 3300049579 Bacteria 1411
406 Ga0501046_0000195 3300049580 Bacteria 62300
407 Ga0501046_0007800 3300049580 Bacteria 9391
408 Ga0501046_0023531 3300049580 Bacteria 5066
409 Ga0501047_0000145 3300049581 Bacteria 86319
410 Ga0501047_0045907 3300049581 Bacteria 4223
411 Ga0501048_0001016 3300049582 Bacteria 20962
412 Ga0501048_0066450 3300049582 Bacteria 2549
413 Ga0501067_0152134 3300049583 Bacteria 1289
414 Ga0501068_0073869 3300049584 Bacteria 2083
415 Ga0501068_0143408 3300049584 Bacteria 1498
416 Ga0501068_0172549 3300049584 Bacteria 1365
417 Ga0501070_0175063 3300049586 Bacteria 1767
418 Ga0501071_0000051 3300049587 Bacteria 39618
419 Ga0501071_0199279 3300049587 Bacteria 1503
420 Ga0501072_0001092 3300049588 Bacteria 20169
421 Ga0501072_0001642 3300049588 Bacteria 16720
422 Ga0501072_0029967 3300049588 Bacteria 4252
423 Ga0501073_0028518 3300049589 Bacteria 3989
424 Ga0501073_0029687 3300049589 Bacteria 3907
425 Ga0501073_0049897 3300049589 Bacteria 2934
426 Ga0501073_0089981 3300049589 Bacteria 2134
427 Ga0501073_0144998 3300049589 Bacteria 1645
428 Ga0501073_0168574 3300049589 Bacteria 1516
429 Ga0501074_0003789 3300049590 Bacteria 10742
430 Ga0501074_0138330 3300049590 Bacteria 1742
431 Ga0501075_0000116 3300049591 Bacteria 38606
432 Ga0501075_0007468 3300049591 Bacteria 7580
433 Ga0501075_0037154 3300049591 Bacteria 3637
434 Ga0501075_0513578 3300049591 Bacteria 914
435 Ga0501076_0000821 3300049592 Bacteria 20162
436 Ga0501076_0088195 3300049592 Bacteria 2493
437 Ga0501076_0430017 3300049592 Bacteria 1086
438 Ga0501077_0001156 3300049593 Bacteria 15933
439 Ga0501077_0073156 3300049593 Bacteria 2171
440 Ga0501079_0000020 3300049741 Bacteria 63869
441 Ga0501079_0020373 3300049741 Bacteria 5068
442 Ga0501079_0025533 3300049741 Bacteria 4530
443 Ga0501079_0228453 3300049741 Bacteria 1454
444 Ga0501080_0004977 3300049742 Bacteria 11832
445 Ga0501080_0012211 3300049742 Bacteria 7871
446 Ga0501080_0057613 3300049742 Bacteria 3617
447 Ga0501080_0362232 3300049742 Bacteria 1308
448 Ga0501081_0000583 3300049743 Bacteria 20746
449 Ga0501081_0023219 3300049743 Bacteria 4156
450 Ga0501081_0046498 3300049743 Bacteria 2983
451 Ga0501083_0010169 3300049744 Bacteria 6630
452 Ga0501083_0061338 3300049744 Bacteria 2510
453 Ga0501083_0065391 3300049744 Bacteria 2422
454 Ga0501083_0084655 3300049744 Bacteria 2099
455 Ga0501083_0208568 3300049744 Bacteria 1274
456 Ga0501083_0580478 3300049744 Bacteria 729
457 Ga0501035_0012299 3300049822 Bacteria 7913
458 Ga0501035_0018173 3300049822 Bacteria 6476
459 Ga0501035_0700360 3300049822 Bacteria 817
460 Ga0501044_0215651 3300049823 Bacteria 1872
461 Ga0501044_0216149 3300049823 Bacteria 1869
462 Ga0501044_0334950 3300049823 Bacteria 1435
463 Ga0501045_0003929 3300049824 Bacteria 10240
464 Ga0501045_0005600 3300049824 Bacteria 8692
465 Ga0501045_0077367 3300049824 Bacteria 2451
466 nmdc:mga00v17_270840_c1 3300050491 Bacteria 1102
467 nmdc:mga00v17_69602_c1 3300050491 Bacteria 2178
468 nmdc:mga0yw44_52735_c1 3300050492 Bacteria 2467
469 nmdc:mga06z11_82802_c1 3300050494 Bacteria 1726
470 nmdc:mga0qj67_405489_c1 3300050509 Bacteria 1100
471 nmdc:mga06r32_133937_c1 3300050510 Bacteria 2452
472 nmdc:mga06r32_323122_c1 3300050510 Bacteria 1528
473 nmdc:mga08y16_238_c1 3300050511 Bacteria 49219
474 nmdc:mga0n895_27890_c1 3300050512 Bacteria 5365
475 nmdc:mga08x19_51428_c1 3300050514 Bacteria 2647
476 nmdc:mga0a205_89941_c1 3300050515 Bacteria 2967
477 Ga0500557_011175 3300053105 Bacteria 2279
478 Ga0500618_006136 3300053125 Bacteria 3559
479 Ga0500658_0004963 3300053134 Bacteria 4957
480 Ga0500658_0041432 3300053134 Bacteria 1847
481 Ga0500559_0029444 3300053136 Bacteria 2351
482 Ga0500568_0000444 3300053139 Bacteria 31072
483 Ga0500568_0000725 3300053139 Bacteria 23622
484 Ga0500590_000591 3300053148 Bacteria 12831
485 Ga0500616_0000522 3300053153 Bacteria 48622
486 Ga0500627_0109374 3300053158 Bacteria 1244
487 Ga0500633_0000270 3300053160 Bacteria 7598
488 Ga0500611_009441 3300053727 Bacteria 1546
489 Ga0500611_036910 3300053727 Bacteria 1049
490 Ga0501084_0016473 3300054114 Bacteria 6139
491 Ga0501084_0033823 3300054114 Bacteria 4276
492 Ga0501084_0044341 3300054114 Bacteria 3723
493 Ga0501084_0150006 3300054114 Bacteria 1965
494 Ga0501084_0160786 3300054114 Bacteria 1895
495 Ga0587069_014313 3300059642 Bacteria 1104
496 Ga0501082_0000771 3300060353 Bacteria 28072
497 Ga0501082_0023373 3300060353 Bacteria 5332
498 Ga0501082_0062682 3300060353 Bacteria 3201
499 Ga0530510_0007886 3300061734 Bacteria 7426
500 Ga0530510_0066231 3300061734 Bacteria 2618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100875187 Ga0070673_1008751871 208
2 3300005617 Ga0068859_100453154 Ga0068859_1004531541 208
3 3300006931 Ga0097620_100453237 Ga0097620_1004532372 208
4 3300005337 Ga0070682_100211575 Ga0070682_1002115752 210
5 3300005455 Ga0070663_100043593 Ga0070663_1000435934 210
6 3300005578 Ga0068854_100119185 Ga0068854_1001191854 210
7 3300025981 Ga0207640_10197349 Ga0207640_101973491 210
8 3300045051 Ga0451576_0000003 Ga0451576_0000003_81158_81793 210
9 3300005617 Ga0068859_100380849 Ga0068859_1003808492 215
10 3300006931 Ga0097620_100380878 Ga0097620_1003808782 215
11 3300032002 Ga0307416_100601829 Ga0307416_1006018292 216
12 3300005435 Ga0070714_100559087 Ga0070714_1005590871 217
13 3300005437 Ga0070710_10538118 Ga0070710_105381181 217
14 3300005467 Ga0070706_100061798 Ga0070706_1000617982 217
15 3300005536 Ga0070697_100026383 Ga0070697_1000263835 217
16 3300005543 Ga0070672_100418801 Ga0070672_1004188012 217
17 3300005937 Ga0081455_10174405 Ga0081455_101744052 217
18 3300025910 Ga0207684_10041138 Ga0207684_100411382 217
19 3300036401 Ga0373937_0886836 Ga0373937_0886836_65_721 217
20 3300039437 Ga0436365_1625021 Ga0436365_1625021_40_696 217
21 3300039438 Ga0436360_0007524 Ga0436360_0007524_177_857 217
22 3300044694 Ga0466963_0025369 Ga0466963_0025369_2674_3330 217
23 3300045976 Ga0466967_0061585 Ga0466967_0061585_852_1508 217
24 3300046517 Ga0495630_0218305 Ga0495630_0218305_500_1207 217
25 3300047471 Ga0495684_0046811 Ga0495684_0046811_2264_2920 217
26 3300049569 Ga0501032_0321367 Ga0501032_0321367_268_924 217
27 3300049571 Ga0501034_0444364 Ga0501034_0444364_350_1006 217
28 iso_pu_bacteria 2510917030 2511196398 217
29 iso_pu_bacteria 2513237090 2513612438 217
30 iso_pu_bacteria 2582581298 2585224604 217
31 iso_pu_bacteria 2585427529 2585546725 217
32 iso_pu_bacteria 2643221629 2644164949 217
33 iso_pu_bacteria 2643221662 2644345782 217
34 iso_pu_bacteria 2791355123 2792752457 217
35 iso_pu_bacteria 2856364286 2856367286 217
36 iso_pu_bacteria 2869285874 2869287569 217
37 iso_pu_bacteria 2871429161 2871431093 217
38 iso_pu_bacteria 2874146452 2874150365 217
39 iso_pu_bacteria 2874155637 2874157420 217
40 iso_pu_bacteria 2876413966 2876416516 217
41 iso_pu_bacteria 2878745973 2878747706 217
42 iso_pu_bacteria 2903492973 2903498822 217
43 iso_pu_bacteria 2906308376 2906310107 217
44 iso_pu_bacteria 2906321335 2906322979 217
45 iso_pu_bacteria 2937813078 2937815393 217
46 iso_pu_bacteria 2939669807 2939673093 217
47 iso_pu_bacteria 2958041894 2958055086 217
48 iso_pu_bacteria 2958130278 2958131971 217
49 iso_pu_bacteria 2958179912 2958181774 217
50 iso_pu_bacteria 2961077736 2961079618 217
51 iso_pu_bacteria 2968117919 2968120267 217
52 iso_pu_bacteria 2977843712 2977846621 217
53 iso_pu_bacteria 2977864932 2977868500 217
54 iso_pu_bacteria 8004387939 8004390305 217
55 iso_pu_bacteria 8004714634 8004716369 217
56 3300005293 Ga0065715_10364253 Ga0065715_103642531 218
57 3300005327 Ga0070658_10006622 Ga0070658_100066227 218
58 3300005331 Ga0070670_100077243 Ga0070670_1000772432 218
59 3300005331 Ga0070670_100078399 Ga0070670_1000783992 218
60 3300005334 Ga0068869_100323978 Ga0068869_1003239781 218
61 3300005335 Ga0070666_10026904 Ga0070666_100269042 218
62 3300005336 Ga0070680_100080949 Ga0070680_1000809491 218
63 3300005337 Ga0070682_100005616 Ga0070682_1000056162 218
64 3300005338 Ga0068868_100021409 Ga0068868_1000214092 218
65 3300005343 Ga0070687_100234410 Ga0070687_1002344102 218
66 3300005344 Ga0070661_100162073 Ga0070661_1001620732 218
67 3300005354 Ga0070675_100002968 Ga0070675_10000296810 218
68 3300005355 Ga0070671_100005081 Ga0070671_1000050816 218
69 3300005364 Ga0070673_100012281 Ga0070673_1000122812 218
70 3300005367 Ga0070667_100040773 Ga0070667_1000407732 218
71 3300005435 Ga0070714_100012361 Ga0070714_1000123615 218
72 3300005435 Ga0070714_100111152 Ga0070714_1001111521 218
73 3300005436 Ga0070713_100124160 Ga0070713_1001241601 218
74 3300005436 Ga0070713_100239524 Ga0070713_1002395242 218
75 3300005439 Ga0070711_100132580 Ga0070711_1001325801 218
76 3300005455 Ga0070663_100053366 Ga0070663_1000533663 218
77 3300005457 Ga0070662_100269523 Ga0070662_1002695231 218
78 3300005459 Ga0068867_100104614 Ga0068867_1001046142 218
79 3300005466 Ga0070685_10004790 Ga0070685_100047902 218
80 3300005543 Ga0070672_100000676 Ga0070672_10000067618 218
81 3300005543 Ga0070672_100267547 Ga0070672_1002675472 218
82 3300005544 Ga0070686_100162485 Ga0070686_1001624852 218
83 3300005545 Ga0070695_100004097 Ga0070695_1000040977 218
84 3300005546 Ga0070696_100000861 Ga0070696_10000086110 218
85 3300005546 Ga0070696_100206962 Ga0070696_1002069621 218
86 3300005549 Ga0070704_100111095 Ga0070704_1001110951 218
87 3300005563 Ga0068855_100061462 Ga0068855_1000614625 218
88 3300005564 Ga0070664_100093228 Ga0070664_1000932282 218
89 3300005615 Ga0070702_100399115 Ga0070702_1003991151 218
90 3300005617 Ga0068859_100002586 Ga0068859_1000025864 218
91 3300005618 Ga0068864_100124860 Ga0068864_1001248602 218
92 3300005841 Ga0068863_100005191 Ga0068863_10000519110 218
93 3300005842 Ga0068858_100014526 Ga0068858_1000145266 218
94 3300005843 Ga0068860_100003598 Ga0068860_1000035989 218
95 3300006028 Ga0070717_10188340 Ga0070717_101883404 218
96 3300006237 Ga0097621_100001774 Ga0097621_1000017747 218
97 3300006237 Ga0097621_100017679 Ga0097621_1000176793 218
98 3300006358 Ga0068871_100000977 Ga0068871_10000097710 218
99 3300006358 Ga0068871_100005924 Ga0068871_1000059249 218
100 3300006846 Ga0075430_100487808 Ga0075430_1004878082 218
101 3300006914 Ga0075436_100023439 Ga0075436_1000234394 218
102 3300006914 Ga0075436_100191109 Ga0075436_1001911092 218
103 3300006931 Ga0097620_100002586 Ga0097620_1000025864 218
104 3300009093 Ga0105240_10120073 Ga0105240_101200736 218
105 3300009093 Ga0105240_10395029 Ga0105240_103950293 218
106 3300009098 Ga0105245_10023458 Ga0105245_100234585 218
107 3300009147 Ga0114129_10863459 Ga0114129_108634591 218
108 3300009174 Ga0105241_10383592 Ga0105241_103835922 218
109 3300009176 Ga0105242_10260438 Ga0105242_102604381 218
110 3300009176 Ga0105242_10294552 Ga0105242_102945523 218
111 3300009177 Ga0105248_10000997 Ga0105248_1000099719 218
112 3300009177 Ga0105248_10014429 Ga0105248_100144294 218
113 3300009551 Ga0105238_10081917 Ga0105238_100819172 218
114 3300010375 Ga0105239_10237542 Ga0105239_102375422 218
115 3300013102 Ga0157371_10213576 Ga0157371_102135762 218
116 3300013104 Ga0157370_10030755 Ga0157370_100307557 218
117 3300013104 Ga0157370_10624341 Ga0157370_106243411 218
118 3300013105 Ga0157369_10095542 Ga0157369_100955423 218
119 3300013297 Ga0157378_10000764 Ga0157378_1000076420 218
120 3300013306 Ga0163162_10006138 Ga0163162_100061389 218
121 3300013306 Ga0163162_10552805 Ga0163162_105528052 218
122 3300013307 Ga0157372_11122356 Ga0157372_111223562 218
123 3300013308 Ga0157375_10000197 Ga0157375_100001973 218
124 3300014325 Ga0163163_10015347 Ga0163163_100153472 218
125 3300014968 Ga0157379_10000050 Ga0157379_1000005019 218
126 3300021384 Ga0213876_10093523 Ga0213876_100935231 218
127 3300025903 Ga0207680_10033810 Ga0207680_100338103 218
128 3300025903 Ga0207680_10086983 Ga0207680_100869832 218
129 3300025909 Ga0207705_10039487 Ga0207705_100394872 218
130 3300025911 Ga0207654_10189866 Ga0207654_101898662 218
131 3300025913 Ga0207695_10277015 Ga0207695_102770153 218
132 3300025916 Ga0207663_10602727 Ga0207663_106027271 218
133 3300025918 Ga0207662_10202892 Ga0207662_102028921 218
134 3300025919 Ga0207657_10203913 Ga0207657_102039133 218
135 3300025925 Ga0207650_10012822 Ga0207650_100128223 218
136 3300025925 Ga0207650_10088087 Ga0207650_100880873 218
137 3300025925 Ga0207650_10123133 Ga0207650_101231332 218
138 3300025926 Ga0207659_10001541 Ga0207659_100015413 218
139 3300025927 Ga0207687_10013039 Ga0207687_100130395 218
140 3300025927 Ga0207687_10174646 Ga0207687_101746462 218
141 3300025928 Ga0207700_10190911 Ga0207700_101909112 218
142 3300025928 Ga0207700_10666948 Ga0207700_106669481 218
143 3300025929 Ga0207664_10051588 Ga0207664_100515882 218
144 3300025931 Ga0207644_10007848 Ga0207644_100078483 218
145 3300025931 Ga0207644_10112180 Ga0207644_101121802 218
146 3300025938 Ga0207704_10610556 Ga0207704_106105562 218
147 3300025940 Ga0207691_10006850 Ga0207691_100068509 218
148 3300025941 Ga0207711_10007088 Ga0207711_100070889 218
149 3300025941 Ga0207711_10115056 Ga0207711_101150562 218
150 3300025942 Ga0207689_10377634 Ga0207689_103776342 218
151 3300025945 Ga0207679_10069764 Ga0207679_100697642 218
152 3300025949 Ga0207667_10037929 Ga0207667_100379294 218
153 3300025960 Ga0207651_10006051 Ga0207651_100060512 218
154 3300025986 Ga0207658_10232692 Ga0207658_102326922 218
155 3300026023 Ga0207677_10011645 Ga0207677_100116454 218
156 3300026067 Ga0207678_10075269 Ga0207678_100752693 218
157 3300026067 Ga0207678_10101334 Ga0207678_101013342 218
158 3300026088 Ga0207641_10001463 Ga0207641_1000146316 218
159 3300026088 Ga0207641_10070881 Ga0207641_100708812 218
160 3300026088 Ga0207641_10399688 Ga0207641_103996882 218
161 3300026089 Ga0207648_10073369 Ga0207648_100733693 218
162 3300026095 Ga0207676_10025695 Ga0207676_100256952 218
163 3300028381 Ga0268264_10005331 Ga0268264_100053319 218
164 3300028381 Ga0268264_10137685 Ga0268264_101376853 218
165 3300028563 Ga0265319_1031568 Ga0265319_10315683 218
166 3300028800 Ga0265338_10037552 Ga0265338_100375526 218
167 3300028800 Ga0265338_10091789 Ga0265338_100917891 218
168 3300031090 Ga0265760_10005225 Ga0265760_100052256 218
169 3300031239 Ga0265328_10000577 Ga0265328_1000057717 218
170 3300031240 Ga0265320_10015215 Ga0265320_100152152 218
171 3300031241 Ga0265325_10036919 Ga0265325_100369194 218
172 3300031241 Ga0265325_10072945 Ga0265325_100729451 218
173 3300031711 Ga0265314_10015545 Ga0265314_100155455 218
174 3300031711 Ga0265314_10017597 Ga0265314_100175974 218
175 3300031711 Ga0265314_10203822 Ga0265314_102038221 218
176 3300031824 Ga0307413_10472846 Ga0307413_104728461 218
177 3300031901 Ga0307406_10216141 Ga0307406_102161412 218
178 3300032004 Ga0307414_10583326 Ga0307414_105833262 218
179 3300032005 Ga0307411_10215830 Ga0307411_102158302 218
180 3300035113 Ga0373936_0009161 Ga0373936_0009161_2813_3559 218
181 3300035118 Ga0373954_0095797 Ga0373954_0095797_373_1032 218
182 3300035410 Ga0373924_0044504 Ga0373924_0044504_775_1521 218
183 3300035692 Ga0373935_0015697 Ga0373935_0015697_1330_2076 218
184 3300037068 Ga0373925_0021842 Ga0373925_0021842_1442_2188 218
185 3300038443 Ga0395901_0382175 Ga0395901_0382175_678_1373 218
186 3300039437 Ga0436365_0701971 Ga0436365_0701971_27_686 218
187 3300039437 Ga0436365_0945779 Ga0436365_0945779_212_871 218
188 3300042016 Ga0439463_085943 Ga0439463_085943_117_776 218
189 3300042119 Ga0450915_005089 Ga0450915_005089_65_724 218
190 3300042439 Ga0439464_0018622 Ga0439464_0018622_899_1558 218
191 3300042876 Ga0451577_0149261 Ga0451577_0149261_838_1590 218
192 3300042876 Ga0451577_0659411 Ga0451577_0659411_261_920 218
193 3300045051 Ga0451576_0381888 Ga0451576_0381888_82_741 218
194 3300046454 Ga0495592_0152896 Ga0495592_0152896_329_988 218
195 3300046459 Ga0495629_0035236 Ga0495629_0035236_1604_2293 218
196 3300046460 Ga0495638_0016472 Ga0495638_0016472_3273_3932 218
197 3300046472 Ga0495580_0005176 Ga0495580_0005176_2377_3066 218
198 3300046515 Ga0495620_0116069 Ga0495620_0116069_121_780 218
199 3300046516 Ga0495628_0240607 Ga0495628_0240607_433_1179 218
200 3300046517 Ga0495630_0067951 Ga0495630_0067951_1841_2587 218
201 3300046522 Ga0495643_0072231 Ga0495643_0072231_220_879 218
202 3300046524 Ga0495648_0322889 Ga0495648_0322889_14_673 218
203 3300046531 Ga0495665_0036139 Ga0495665_0036139_1879_2568 218
204 3300046535 Ga0495586_0201715 Ga0495586_0201715_25_771 218
205 3300046660 Ga0495625_0221463 Ga0495625_0221463_531_1190 218
206 3300046683 Ga0495658_0342609 Ga0495658_0342609_176_865 218
207 3300046689 Ga0495613_0175601 Ga0495613_0175601_606_1295 218
208 3300047315 Ga0495581_0089424 Ga0495581_0089424_917_1606 218
209 3300047319 Ga0495674_0003679 Ga0495674_0003679_6128_6874 218
210 3300047320 Ga0495672_0040567 Ga0495672_0040567_1819_2478 218
211 3300048905 Ga0496102_0735109 Ga0496102_0735109_172_858 218
212 3300048916 Ga0496113_0120693 Ga0496113_0120693_103_762 218
213 3300049569 Ga0501032_0158339 Ga0501032_0158339_27_686 218
214 3300049570 Ga0501033_0023020 Ga0501033_0023020_3601_4260 218
215 3300049572 Ga0501036_0010306 Ga0501036_0010306_6803_7462 218
216 3300049572 Ga0501036_0048456 Ga0501036_0048456_1424_2083 218
217 3300049574 Ga0501038_0005181 Ga0501038_0005181_10865_11524 218
218 3300049575 Ga0501039_0009913 Ga0501039_0009913_1449_2108 218
219 3300049575 Ga0501039_0087963 Ga0501039_0087963_1588_2247 218
220 3300049576 Ga0501040_0001092 Ga0501040_0001092_3002_3661 218
221 3300049576 Ga0501040_0001555 Ga0501040_0001555_1605_2264 218
222 3300049577 Ga0501041_0000468 Ga0501041_0000468_5961_6620 218
223 3300049577 Ga0501041_0010094 Ga0501041_0010094_3047_3706 218
224 3300049578 Ga0501042_0021351 Ga0501042_0021351_3659_4318 218
225 3300049579 Ga0501043_0236214 Ga0501043_0236214_22_681 218
226 3300049580 Ga0501046_0007800 Ga0501046_0007800_1434_2093 218
227 3300049584 Ga0501068_0143408 Ga0501068_0143408_654_1316 218
228 3300049584 Ga0501068_0172549 Ga0501068_0172549_209_868 218
229 3300049586 Ga0501070_0175063 Ga0501070_0175063_174_833 218
230 3300049587 Ga0501071_0000051 Ga0501071_0000051_7489_8148 218
231 3300049588 Ga0501072_0001092 Ga0501072_0001092_17226_17885 218
232 3300049588 Ga0501072_0001642 Ga0501072_0001642_1519_2178 218
233 3300049589 Ga0501073_0089981 Ga0501073_0089981_327_986 218
234 3300049589 Ga0501073_0168574 Ga0501073_0168574_785_1444 218
235 3300049590 Ga0501074_0003789 Ga0501074_0003789_606_1265 218
236 3300049591 Ga0501075_0000116 Ga0501075_0000116_12250_12909 218
237 3300049591 Ga0501075_0007468 Ga0501075_0007468_1234_1893 218
238 3300049592 Ga0501076_0000821 Ga0501076_0000821_17781_18440 218
239 3300049592 Ga0501076_0430017 Ga0501076_0430017_411_1070 218
240 3300049593 Ga0501077_0001156 Ga0501077_0001156_11786_12445 218
241 3300049741 Ga0501079_0000020 Ga0501079_0000020_4947_5606 218
242 3300049741 Ga0501079_0020373 Ga0501079_0020373_803_1462 218
243 3300049742 Ga0501080_0004977 Ga0501080_0004977_316_975 218
244 3300049742 Ga0501080_0012211 Ga0501080_0012211_1107_1766 218
245 3300049743 Ga0501081_0000583 Ga0501081_0000583_7484_8143 218
246 3300049743 Ga0501081_0023219 Ga0501081_0023219_2347_3006 218
247 3300049744 Ga0501083_0010169 Ga0501083_0010169_3749_4405 218
248 3300049744 Ga0501083_0061338 Ga0501083_0061338_1706_2365 218
249 3300049744 Ga0501083_0084655 Ga0501083_0084655_537_1196 218
250 3300049744 Ga0501083_0208568 Ga0501083_0208568_17_676 218
251 3300049822 Ga0501035_0012299 Ga0501035_0012299_7136_7795 218
252 3300049822 Ga0501035_0018173 Ga0501035_0018173_294_953 218
253 3300049822 Ga0501035_0700360 Ga0501035_0700360_95_757 218
254 3300049823 Ga0501044_0215651 Ga0501044_0215651_1114_1773 218
255 3300049823 Ga0501044_0334950 Ga0501044_0334950_598_1260 218
256 3300049824 Ga0501045_0003929 Ga0501045_0003929_9427_10086 218
257 3300049824 Ga0501045_0005600 Ga0501045_0005600_2302_2961 218
258 3300050509 nmdc:mga0qj67_405489_c1 nmdc:mga0qj67_405489_c1_91_750 218
259 3300050514 nmdc:mga08x19_51428_c1 nmdc:mga08x19_51428_c1_1802_2458 218
260 3300053134 Ga0500658_0041432 Ga0500658_0041432_959_1618 218
261 3300053139 Ga0500568_0000725 Ga0500568_0000725_4690_5349 218
262 3300053153 Ga0500616_0000522 Ga0500616_0000522_4776_5435 218
263 3300053727 Ga0500611_009441 Ga0500611_009441_736_1395 218
264 3300053727 Ga0500611_036910 Ga0500611_036910_352_1011 218
265 3300054114 Ga0501084_0016473 Ga0501084_0016473_4188_4847 218
266 3300054114 Ga0501084_0044341 Ga0501084_0044341_459_1118 218
267 3300054114 Ga0501084_0160786 Ga0501084_0160786_1139_1798 218
268 3300059642 Ga0587069_014313 Ga0587069_014313_267_923 218
269 3300060353 Ga0501082_0000771 Ga0501082_0000771_16159_16818 218
270 3300060353 Ga0501082_0023373 Ga0501082_0023373_4042_4701 218
271 3300061734 Ga0530510_0066231 Ga0530510_0066231_1266_1925 218
272 iso_pu_bacteria 2844533157 2844537549 218
273 3300005345 Ga0070692_10003986 Ga0070692_100039863 219
274 3300005356 Ga0070674_100610349 Ga0070674_1006103491 219
275 3300005438 Ga0070701_10170917 Ga0070701_101709172 219
276 3300005444 Ga0070694_100063429 Ga0070694_1000634292 219
277 3300005445 Ga0070708_100012302 Ga0070708_1000123023 219
278 3300005445 Ga0070708_100947054 Ga0070708_1009470541 219
279 3300005471 Ga0070698_100502033 Ga0070698_1005020331 219
280 3300005536 Ga0070697_100169504 Ga0070697_1001695042 219
281 3300005981 Ga0081538_10011617 Ga0081538_100116174 219
282 3300005981 Ga0081538_10035239 Ga0081538_100352394 219
283 3300006038 Ga0075365_10091842 Ga0075365_100918421 219
284 3300006051 Ga0075364_10261717 Ga0075364_102617171 219
285 3300006358 Ga0068871_100078799 Ga0068871_1000787991 219
286 3300009093 Ga0105240_10596335 Ga0105240_105963351 219
287 3300009094 Ga0111539_10000294 Ga0111539_1000029412 219
288 3300009098 Ga0105245_10145516 Ga0105245_101455163 219
289 3300009993 Ga0105028_101436 Ga0105028_1014362 219
290 3300013297 Ga0157378_10607455 Ga0157378_106074552 219
291 3300013306 Ga0163162_10125990 Ga0163162_101259901 219
292 3300014969 Ga0157376_10147079 Ga0157376_101470792 219
293 3300021384 Ga0213876_10094171 Ga0213876_100941712 219
294 3300021388 Ga0213875_10004961 Ga0213875_100049617 219
295 3300025294 Ga0209025_1000077 Ga0209025_1000077113 219
296 3300025294 Ga0209025_1000179 Ga0209025_100017995 219
297 3300025297 Ga0209758_1002011 Ga0209758_100201111 219
298 3300025302 Ga0207426_1000191 Ga0207426_1000191116 219
299 3300025922 Ga0207646_10134904 Ga0207646_101349042 219
300 3300026118 Ga0207675_100073763 Ga0207675_1000737634 219
301 3300026121 Ga0207683_10215926 Ga0207683_102159262 219
302 3300027907 Ga0207428_10043523 Ga0207428_100435233 219
303 3300032002 Ga0307416_100159947 Ga0307416_1001599474 219
304 3300037853 Ga0436364_0622955 Ga0436364_0622955_2058_2720 219
305 3300037853 Ga0436364_1051528 Ga0436364_1051528_1052_1714 219
306 3300041997 Ga0439431_0012539 Ga0439431_0012539_468_1136 219
307 3300042146 Ga0450907_011232 Ga0450907_011232_760_1428 219
308 3300045976 Ga0466967_0239200 Ga0466967_0239200_760_1422 219
309 3300046694 Ga0495649_0075109 Ga0495649_0075109_1012_1680 219
310 3300047469 Ga0495673_0094411 Ga0495673_0094411_293_961 219
311 3300049568 Ga0501031_0091189 Ga0501031_0091189_1185_1847 219
312 3300049570 Ga0501033_0034921 Ga0501033_0034921_2590_3252 219
313 3300049572 Ga0501036_0168543 Ga0501036_0168543_227_889 219
314 3300049573 Ga0501037_0149297 Ga0501037_0149297_504_1166 219
315 3300049573 Ga0501037_0489685 Ga0501037_0489685_55_717 219
316 3300049574 Ga0501038_0051968 Ga0501038_0051968_1225_1887 219
317 3300049575 Ga0501039_0234895 Ga0501039_0234895_555_1217 219
318 3300049577 Ga0501041_0037205 Ga0501041_0037205_1890_2552 219
319 3300049577 Ga0501041_0119879 Ga0501041_0119879_717_1379 219
320 3300049578 Ga0501042_0047525 Ga0501042_0047525_1364_2026 219
321 3300049579 Ga0501043_0000075 Ga0501043_0000075_63616_64278 219
322 3300049579 Ga0501043_0064894 Ga0501043_0064894_2185_2847 219
323 3300049580 Ga0501046_0000195 Ga0501046_0000195_21944_22606 219
324 3300049580 Ga0501046_0023531 Ga0501046_0023531_2289_2951 219
325 3300049581 Ga0501047_0000145 Ga0501047_0000145_63616_64278 219
326 3300049581 Ga0501047_0045907 Ga0501047_0045907_3442_4104 219
327 3300049582 Ga0501048_0001016 Ga0501048_0001016_20260_20922 219
328 3300049582 Ga0501048_0066450 Ga0501048_0066450_1549_2211 219
329 3300049583 Ga0501067_0152134 Ga0501067_0152134_46_708 219
330 3300049584 Ga0501068_0073869 Ga0501068_0073869_108_770 219
331 3300049587 Ga0501071_0199279 Ga0501071_0199279_581_1243 219
332 3300049588 Ga0501072_0029967 Ga0501072_0029967_2147_2809 219
333 3300049589 Ga0501073_0028518 Ga0501073_0028518_2759_3421 219
334 3300049589 Ga0501073_0029687 Ga0501073_0029687_1395_2057 219
335 3300049589 Ga0501073_0049897 Ga0501073_0049897_614_1276 219
336 3300049589 Ga0501073_0144998 Ga0501073_0144998_724_1386 219
337 3300049590 Ga0501074_0138330 Ga0501074_0138330_29_691 219
338 3300049591 Ga0501075_0037154 Ga0501075_0037154_1335_1997 219
339 3300049592 Ga0501076_0088195 Ga0501076_0088195_568_1230 219
340 3300049593 Ga0501077_0073156 Ga0501077_0073156_903_1565 219
341 3300049741 Ga0501079_0025533 Ga0501079_0025533_2705_3367 219
342 3300049741 Ga0501079_0228453 Ga0501079_0228453_425_1087 219
343 3300049742 Ga0501080_0057613 Ga0501080_0057613_1017_1679 219
344 3300049742 Ga0501080_0362232 Ga0501080_0362232_414_1082 219
345 3300049743 Ga0501081_0046498 Ga0501081_0046498_798_1460 219
346 3300049744 Ga0501083_0065391 Ga0501083_0065391_972_1634 219
347 3300049744 Ga0501083_0580478 Ga0501083_0580478_32_694 219
348 3300049824 Ga0501045_0077367 Ga0501045_0077367_359_1021 219
349 3300050491 nmdc:mga00v17_270840_c1 nmdc:mga00v17_270840_c1_397_1059 219
350 3300050491 nmdc:mga00v17_69602_c1 nmdc:mga00v17_69602_c1_927_1589 219
351 3300050492 nmdc:mga0yw44_52735_c1 nmdc:mga0yw44_52735_c1_1609_2271 219
352 3300050511 nmdc:mga08y16_238_c1 nmdc:mga08y16_238_c1_11667_12359 219
353 3300054114 Ga0501084_0033823 Ga0501084_0033823_1747_2409 219
354 3300054114 Ga0501084_0150006 Ga0501084_0150006_608_1270 219
355 3300060353 Ga0501082_0062682 Ga0501082_0062682_2319_2981 219
356 3300061734 Ga0530510_0007886 Ga0530510_0007886_5767_6429 219
357 3300002705 JGI25156J39149_1007878 JGI25156J39149_10078782 220
358 3300002739 JGI25158J39367_1001640 JGI25158J39367_10016402 220
359 3300002741 JGI25157J39369_1000850 JGI25157J39369_10008509 220
360 3300002773 JGI25152J39213_1002594 JGI25152J39213_10025947 220
361 3300002987 JGI25159J45721_1004297 JGI25159J45721_10042972 220
362 3300003214 JGI25165J46597_1000037 JGI25165J46597_1000037237 220
363 3300003215 JGI25153J46596_10002702 JGI25153J46596_100027021 220
364 3300003354 JGI25160J50197_1029079 JGI25160J50197_10290792 220
365 3300003374 JGI25161J50226_1000300 JGI25161J50226_100030017 220
366 3300003771 Ga0055526_1020804 Ga0055526_10208042 220
367 3300003775 Ga0055524_1044178 Ga0055524_10441781 220
368 3300003790 Ga0055528_1040988 Ga0055528_10409882 220
369 3300004625 Ga0055543_1000065 Ga0055543_10000659 220
370 3300005262 Ga0065165_1060654 Ga0065165_10606541 220
371 3300005327 Ga0070658_10453413 Ga0070658_104534131 220
372 3300005339 Ga0070660_100136158 Ga0070660_1001361581 220
373 3300005356 Ga0070674_100023426 Ga0070674_1000234262 220
374 3300005364 Ga0070673_100031751 Ga0070673_1000317513 220
375 3300005366 Ga0070659_100051353 Ga0070659_1000513532 220
376 3300005456 Ga0070678_100010774 Ga0070678_1000107747 220
377 3300005457 Ga0070662_100057466 Ga0070662_1000574661 220
378 3300005459 Ga0068867_100049040 Ga0068867_1000490402 220
379 3300005539 Ga0068853_100015409 Ga0068853_1000154092 220
380 3300005543 Ga0070672_100114694 Ga0070672_1001146942 220
381 3300005548 Ga0070665_100006072 Ga0070665_10000607216 220
382 3300005842 Ga0068858_100644780 Ga0068858_1006447802 220
383 3300006177 Ga0075362_10150435 Ga0075362_101504352 220
384 3300006847 Ga0075431_100194086 Ga0075431_1001940862 220
385 3300006852 Ga0075433_10010306 Ga0075433_100103063 220
386 3300006871 Ga0075434_100059396 Ga0075434_1000593963 220
387 3300006871 Ga0075434_100504865 Ga0075434_1005048651 220
388 3300009093 Ga0105240_10034639 Ga0105240_100346394 220
389 3300009545 Ga0105237_10002299 Ga0105237_1000229916 220
390 3300009545 Ga0105237_10011073 Ga0105237_100110737 220
391 3300009551 Ga0105238_10009996 Ga0105238_100099966 220
392 3300010375 Ga0105239_10020752 Ga0105239_100207526 220
393 3300010375 Ga0105239_10273907 Ga0105239_102739072 220
394 3300015265 Ga0182005_1020871 Ga0182005_10208712 220
395 3300025208 Ga0209436_100097 Ga0209436_1000976 220
396 3300025250 Ga0209026_1000013 Ga0209026_100001319 220
397 3300025256 Ga0209759_1000149 Ga0209759_100014959 220
398 3300025258 Ga0209129_1001082 Ga0209129_100108214 220
399 3300025261 Ga0209233_1000102 Ga0209233_1000102237 220
400 3300025273 Ga0209673_1002249 Ga0209673_10022499 220
401 3300025284 Ga0209130_1000004 Ga0209130_1000004454 220
402 3300025295 Ga0209564_1000650 Ga0209564_100065011 220
403 3300025297 Ga0209758_1001247 Ga0209758_10012478 220
404 3300025299 Ga0209256_1002461 Ga0209256_10024615 220
405 3300025302 Ga0207426_1000003 Ga0207426_1000003272 220
406 3300025907 Ga0207645_10113029 Ga0207645_101130292 220
407 3300025909 Ga0207705_10574015 Ga0207705_105740151 220
408 3300025913 Ga0207695_10095233 Ga0207695_100952332 220
409 3300025914 Ga0207671_10002344 Ga0207671_1000234413 220
410 3300025914 Ga0207671_10025241 Ga0207671_100252415 220
411 3300025919 Ga0207657_10028957 Ga0207657_100289573 220
412 3300025924 Ga0207694_10010848 Ga0207694_100108487 220
413 3300025932 Ga0207690_10060371 Ga0207690_100603712 220
414 3300025938 Ga0207704_10025603 Ga0207704_100256032 220
415 3300025940 Ga0207691_10109854 Ga0207691_101098542 220
416 3300025940 Ga0207691_10369449 Ga0207691_103694491 220
417 3300025960 Ga0207651_10119561 Ga0207651_101195612 220
418 3300026035 Ga0207703_10582311 Ga0207703_105823111 220
419 3300026041 Ga0207639_10004467 Ga0207639_100044672 220
420 3300026089 Ga0207648_10086130 Ga0207648_100861302 220
421 3300026121 Ga0207683_10007131 Ga0207683_100071313 220
422 3300026121 Ga0207683_10522349 Ga0207683_105223491 220
423 3300028379 Ga0268266_10000472 Ga0268266_1000047257 220
424 3300028379 Ga0268266_10609201 Ga0268266_106092011 220
425 3300035695 Ga0373927_0010170 Ga0373927_0010170_120_785 220
426 3300037418 Ga0395900_0037149 Ga0395900_0037149_2084_2899 220
427 3300037418 Ga0395900_0605666 Ga0395900_0605666_210_875 220
428 3300037471 Ga0395905_0001510 Ga0395905_0001510_6692_7357 220
429 3300037471 Ga0395905_0046373 Ga0395905_0046373_2585_3250 220
430 3300038443 Ga0395901_0022725 Ga0395901_0022725_4316_5131 220
431 3300038443 Ga0395901_0225679 Ga0395901_0225679_164_829 220
432 3300044658 Ga0466972_0018818 Ga0466972_0018818_2264_2929 220
433 3300046454 Ga0495592_0235817 Ga0495592_0235817_454_1119 220
434 3300046459 Ga0495629_0035919 Ga0495629_0035919_1308_1973 220
435 3300046474 Ga0495605_0015141 Ga0495605_0015141_328_993 220
436 3300046477 Ga0495664_0082898 Ga0495664_0082898_1133_1798 220
437 3300046501 Ga0495607_0237519 Ga0495607_0237519_31_696 220
438 3300046518 Ga0495631_0017845 Ga0495631_0017845_1508_2173 220
439 3300046524 Ga0495648_0121580 Ga0495648_0121580_403_1068 220
440 3300046538 Ga0495609_0055123 Ga0495609_0055123_1047_1712 220
441 3300046616 Ga0495668_0014729 Ga0495668_0014729_3183_3848 220
442 3300046642 Ga0495634_0094788 Ga0495634_0094788_971_1636 220
443 3300046648 Ga0495611_0095496 Ga0495611_0095496_143_808 220
444 3300046660 Ga0495625_0023224 Ga0495625_0023224_132_797 220
445 3300046675 Ga0495657_0052454 Ga0495657_0052454_676_1341 220
446 3300046692 Ga0495671_0246988 Ga0495671_0246988_131_796 220
447 3300047317 Ga0495604_0090665 Ga0495604_0090665_1189_1854 220
448 3300048091 Ga0495626_0047128 Ga0495626_0047128_310_975 220
449 3300048905 Ga0496102_0822290 Ga0496102_0822290_125_790 220
450 3300048906 Ga0496103_0358760 Ga0496103_0358760_20_685 220
451 3300048909 Ga0496106_0000163 Ga0496106_0000163_32027_32692 220
452 3300048924 Ga0496121_0107819 Ga0496121_0107819_837_1502 220
453 3300048928 Ga0496125_0035760 Ga0496125_0035760_1935_2600 220
454 3300049459 Ga0495678_036401 Ga0495678_036401_82_747 220
455 3300049823 Ga0501044_0216149 Ga0501044_0216149_427_1092 220
456 3300050494 nmdc:mga06z11_82802_c1 nmdc:mga06z11_82802_c1_80_745 220
457 3300050510 nmdc:mga06r32_323122_c1 nmdc:mga06r32_323122_c1_787_1452 220
458 3300050512 nmdc:mga0n895_27890_c1 nmdc:mga0n895_27890_c1_3109_3774 220
459 3300050515 nmdc:mga0a205_89941_c1 nmdc:mga0a205_89941_c1_59_724 220
460 3300053105 Ga0500557_011175 Ga0500557_011175_952_1617 220
461 3300053125 Ga0500618_006136 Ga0500618_006136_420_1085 220
462 3300053134 Ga0500658_0004963 Ga0500658_0004963_2933_3598 220
463 3300053136 Ga0500559_0029444 Ga0500559_0029444_604_1269 220
464 3300053139 Ga0500568_0000444 Ga0500568_0000444_15655_16320 220
465 3300053148 Ga0500590_000591 Ga0500590_000591_3721_4386 220
466 3300053158 Ga0500627_0109374 Ga0500627_0109374_216_881 220
467 3300053160 Ga0500633_0000270 Ga0500633_0000270_2838_3503 220
468 3300049591 Ga0501075_0513578 Ga0501075_0513578_178_894 221
469 3300006195 Ga0075366_10199108 Ga0075366_101991081 222
470 3300028379 Ga0268266_11057265 Ga0268266_110572651 222
471 3300005365 Ga0070688_100559179 Ga0070688_1005591791 223
472 3300021358 Ga0213873_10017146 Ga0213873_100171462 223
473 3300039453 Ga0436362_0093681 Ga0436362_0093681_571_1242 223
474 3300044712 Ga0453684_0075492 Ga0453684_0075492_100_780 225
475 3300000546 LJNas_1000209 LJNas_10002092 226
476 3300005330 Ga0070690_100006843 Ga0070690_1000068435 226
477 3300005334 Ga0068869_100167430 Ga0068869_1001674301 226
478 3300005336 Ga0070680_100297454 Ga0070680_1002974542 226
479 3300005337 Ga0070682_100132293 Ga0070682_1001322932 226
480 3300005340 Ga0070689_100034500 Ga0070689_1000345005 226
481 3300005343 Ga0070687_100166020 Ga0070687_1001660201 226
482 3300005353 Ga0070669_100188710 Ga0070669_1001887101 226
483 3300005354 Ga0070675_100024483 Ga0070675_1000244831 226
484 3300005365 Ga0070688_100008377 Ga0070688_1000083774 226
485 3300005366 Ga0070659_100061159 Ga0070659_1000611593 226
486 3300005455 Ga0070663_100321798 Ga0070663_1003217981 226
487 3300005535 Ga0070684_100053678 Ga0070684_1000536782 226
488 3300005539 Ga0068853_100641131 Ga0068853_1006411311 226
489 3300005543 Ga0070672_100773101 Ga0070672_1007731011 226
490 3300005548 Ga0070665_100368653 Ga0070665_1003686532 226
491 3300005617 Ga0068859_100048953 Ga0068859_1000489535 226
492 3300005840 Ga0068870_10111506 Ga0068870_101115061 226
493 3300005843 Ga0068860_100094545 Ga0068860_1000945453 226
494 3300005844 Ga0068862_100100804 Ga0068862_1001008042 226
495 3300006847 Ga0075431_100032383 Ga0075431_1000323832 226
496 3300006881 Ga0068865_100013688 Ga0068865_1000136882 226
497 3300006881 Ga0068865_100126659 Ga0068865_1001266592 226
498 3300006931 Ga0097620_100048946 Ga0097620_1000489465 226
499 3300009101 Ga0105247_10109179 Ga0105247_101091792 226
500 3300009177 Ga0105248_10285540 Ga0105248_102855402 226
501 3300009553 Ga0105249_10123114 Ga0105249_101231144 226
502 3300010375 Ga0105239_10903726 Ga0105239_109037261 226
503 3300013308 Ga0157375_10056713 Ga0157375_100567134 226
504 3300014325 Ga0163163_10052473 Ga0163163_100524732 226
505 3300014326 Ga0157380_10047668 Ga0157380_100476682 226
506 3300014745 Ga0157377_10111730 Ga0157377_101117302 226
507 3300014969 Ga0157376_10005076 Ga0157376_100050769 226
508 3300025907 Ga0207645_10056721 Ga0207645_100567212 226
509 3300025908 Ga0207643_10059272 Ga0207643_100592722 226
510 3300025908 Ga0207643_10253670 Ga0207643_102536702 226
511 3300025932 Ga0207690_10127950 Ga0207690_101279502 226
512 3300025935 Ga0207709_10150108 Ga0207709_101501081 226
513 3300025938 Ga0207704_10132363 Ga0207704_101323631 226
514 3300025938 Ga0207704_10227515 Ga0207704_102275152 226
515 3300025940 Ga0207691_10598411 Ga0207691_105984111 226
516 3300025942 Ga0207689_10016674 Ga0207689_100166744 226
517 3300025972 Ga0207668_10185115 Ga0207668_101851152 226
518 3300026023 Ga0207677_10221577 Ga0207677_102215771 226
519 3300026035 Ga0207703_10063994 Ga0207703_100639941 226
520 3300026116 Ga0207674_10057534 Ga0207674_100575344 226
521 3300028379 Ga0268266_10323988 Ga0268266_103239882 226
522 3300028379 Ga0268266_10545057 Ga0268266_105450571 226
523 3300028380 Ga0268265_10515376 Ga0268265_105153762 226
524 3300039453 Ga0436362_1255939 Ga0436362_1255939_1278_1964 226
525 3300048911 Ga0496108_0017169 Ga0496108_0017169_485_1174 226
526 3300048912 Ga0496109_0332465 Ga0496109_0332465_53_742 226
527 3300048913 Ga0496110_0379968 Ga0496110_0379968_39_728 226
528 3300048917 Ga0496114_0258060 Ga0496114_0258060_217_906 226
529 3300050510 nmdc:mga06r32_133937_c1 nmdc:mga06r32_133937_c1_212_946 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

55

195

0.95

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

215

254

0.95

PF08534

Redoxin

Redoxin

55

212

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9634 1 215
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9569 2 217
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9476 2 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9448 1 215
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9134 1 215
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9531 4 105 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9403 154 215 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9317 154 217 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9269 4 105 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9182 154 217 3.30.1020.10

Feature Viewer

pLDDT pTM Quality
89.14 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map