metagRoot

F459841

General Info

Members	Datasets	Scaffolds	Average Seq Length
529	218	529	115

Family's Representative Sequence

Representative Sequence	3300044684\|Ga0466966_0059424\|Ga0466966_0059424_1958_2308
Length	116
Sequence	MHPELMRQVAMARMADFNRNAARYRRARQATFRRPQPVRTAIQLRASACREELERLALLSERPLREGGDWIVADVDGVAVAAVSVEDGTTVYDPFRPTSQAVSLLRLRRKQVLTAA

Samples

	Sample ID	Description	Type	Environment
1	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
6	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
7	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
12	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
13	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
14	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
15	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
16	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
17	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
18	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
19	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
20	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
21	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
22	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
23	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
24	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
25	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
26	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
27	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
28	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
29	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
30	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
31	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
32	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
33	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
34	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
35	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
36	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
37	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
38	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
39	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
40	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
41	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
42	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
43	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
44	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
45	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
46	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
47	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
48	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
49	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
50	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
51	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
52	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
53	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
54	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
55	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
56	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
57	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
58	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
59	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
60	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
61	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
62	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
63	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
64	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
65	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
66	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
67	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
68	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
69	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
70	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
71	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
72	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
74	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
101	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
102	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
103	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
104	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
105	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
106	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
107	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
108	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
109	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
110	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
111	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
112	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
113	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
114	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
115	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
116	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
117	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
118	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
119	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
120	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
121	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
122	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
123	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
124	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
125	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
126	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
127	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
128	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
129	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
130	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
131	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
132	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
133	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
134	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
135	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
136	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
137	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
138	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
139	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
140	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
141	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
142	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
143	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
144	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
145	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
146	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
147	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
148	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
149	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
150	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
151	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
152	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
153	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
154	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
155	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
156	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
157	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
158	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
159	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
160	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
161	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
162	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
163	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
164	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
165	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
166	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
167	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
168	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
169	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
170	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
171	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
172	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
173	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
174	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
175	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
176	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
177	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
178	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
179	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
180	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
181	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
182	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
183	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
184	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
185	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
186	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
187	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
188	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
189	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
190	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
191	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
192	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
193	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
194	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
195	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
196	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
197	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
198	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
199	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
200	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
201	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
202	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
203	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
204	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
205	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
206	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
207	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
208	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
209	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
210	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
211	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
212	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
213	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
214	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
215	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
216	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
217	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
218	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.73
Metatranscriptomes	2.27
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.19
Nodule	0
Rhizoplane	10.21
Rhizosphere	89.22
Stem	0
Stem Tuber	0
Unclassified	0.38

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH1_10165460	3300003323	Bacteria	1664
2	Ga0070658_10073144	3300005327	Bacteria	2810
3	Ga0070683_100129799	3300005329	Bacteria	2385
4	Ga0070683_100366323	3300005329	Bacteria	1372
5	Ga0070683_100616390	3300005329	Bacteria	1039
6	Ga0070683_101574501	3300005329	Bacteria	632
7	Ga0070690_101729702	3300005330	Bacteria	509
8	Ga0070680_100037484	3300005336	Bacteria	3917
9	Ga0070680_100108482	3300005336	Bacteria	2309
10	Ga0070682_100225513	3300005337	Bacteria	1337
11	Ga0070682_100362089	3300005337	Bacteria	1085
12	Ga0070682_100522096	3300005337	Bacteria	924
13	Ga0070682_100812638	3300005337	Bacteria	761
14	Ga0068868_100317308	3300005338	Bacteria	1327
15	Ga0068868_101657357	3300005338	Bacteria	602
16	Ga0070660_100051424	3300005339	Bacteria	3173
17	Ga0070660_100560862	3300005339	Bacteria	953
18	Ga0070660_101905139	3300005339	Unclassified	507
19	Ga0070689_100695891	3300005340	Bacteria	887
20	Ga0070691_10090143	3300005341	Bacteria	1511
21	Ga0070661_100123530	3300005344	Bacteria	1940
22	Ga0070671_100614051	3300005355	Bacteria	940
23	Ga0070659_100032341	3300005366	Bacteria	4056
24	Ga0070659_101047228	3300005366	Bacteria	718
25	Ga0070659_101626901	3300005366	Unclassified	577
26	Ga0070709_10005227	3300005434	Bacteria	7023
27	Ga0070709_10045926	3300005434	Bacteria	2714
28	Ga0070714_100008658	3300005435	Bacteria	7956
29	Ga0070714_100024330	3300005435	Bacteria	4984
30	Ga0070714_100033947	3300005435	Bacteria	4271
31	Ga0070714_100037311	3300005435	Bacteria	4083
32	Ga0070714_100070280	3300005435	Bacteria	3026
33	Ga0070714_100401584	3300005435	Bacteria	1295
34	Ga0070714_102018027	3300005435	Bacteria	562
35	Ga0070713_100041466	3300005436	Bacteria	3750
36	Ga0070713_100130919	3300005436	Bacteria	2212
37	Ga0070713_100595324	3300005436	Bacteria	1050
38	Ga0070713_102492242	3300005436	Unclassified	500
39	Ga0070710_10003439	3300005437	Bacteria	7503
40	Ga0070710_10009232	3300005437	Bacteria	4820
41	Ga0070710_10362156	3300005437	Bacteria	963
42	Ga0070711_100027039	3300005439	Bacteria	3763
43	Ga0070711_100047147	3300005439	Bacteria	2940
44	Ga0070711_100462746	3300005439	Bacteria	1040
45	Ga0070711_100592735	3300005439	Unclassified	924
46	Ga0070711_102023504	3300005439	Unclassified	507
47	Ga0070705_100234719	3300005440	Bacteria	1278
48	Ga0070694_100089405	3300005444	Bacteria	2158
49	Ga0070694_100721798	3300005444	Bacteria	812
50	Ga0070662_100583750	3300005457	Bacteria	939
51	Ga0070681_10051474	3300005458	Bacteria	4108
52	Ga0070681_10079821	3300005458	Bacteria	3228
53	Ga0070681_10342328	3300005458	Bacteria	1405
54	Ga0070706_100336286	3300005467	Bacteria	1408
55	Ga0070707_100001986	3300005468	Bacteria	19582
56	Ga0070707_101137191	3300005468	Bacteria	747
57	Ga0070707_101381501	3300005468	Bacteria	671
58	Ga0070698_100219347	3300005471	Bacteria	1836
59	Ga0070679_100072110	3300005530	Bacteria	3445
60	Ga0070679_100078303	3300005530	Bacteria	3294
61	Ga0070684_100064797	3300005535	Bacteria	3206
62	Ga0070684_100201828	3300005535	Bacteria	1811
63	Ga0070684_101925879	3300005535	Bacteria	558
64	Ga0070697_100773346	3300005536	Bacteria	849
65	Ga0070697_100804516	3300005536	Bacteria	832
66	Ga0068853_100895866	3300005539	Bacteria	852
67	Ga0070695_100000814	3300005545	Bacteria	16811
68	Ga0070695_101083295	3300005545	Bacteria	655
69	Ga0070693_100784384	3300005547	Bacteria	705
70	Ga0070704_100064573	3300005549	Bacteria	2632
71	Ga0068855_100248344	3300005563	Bacteria	1985
72	Ga0068855_100294375	3300005563	Unclassified	1799
73	Ga0070664_100174483	3300005564	Bacteria	1908
74	Ga0068856_100145685	3300005614	Bacteria	2376
75	Ga0068856_100632822	3300005614	Bacteria	1090
76	Ga0068856_100843316	3300005614	Bacteria	936
77	Ga0070702_100352085	3300005615	Bacteria	1037
78	Ga0068852_100097658	3300005616	Bacteria	2643
79	Ga0068863_100412618	3300005841	Bacteria	1322
80	Ga0068860_101537212	3300005843	Unclassified	687
81	Ga0070717_10007800	3300006028	Bacteria	7966
82	Ga0070717_10056185	3300006028	Bacteria	3251
83	Ga0070717_10088713	3300006028	Bacteria	2607
84	Ga0070715_10021489	3300006163	Bacteria	2503
85	Ga0070715_10069226	3300006163	Bacteria	1572
86	Ga0070716_100019365	3300006173	Bacteria	3556
87	Ga0070716_100373935	3300006173	Bacteria	1016
88	Ga0070716_100389974	3300006173	Bacteria	998
89	Ga0070716_101579568	3300006173	Bacteria	538
90	Ga0070712_100016542	3300006175	Bacteria	4765
91	Ga0070712_100210879	3300006175	Bacteria	1531
92	Ga0070712_100470114	3300006175	Bacteria	1050
93	Ga0070712_100576985	3300006175	Bacteria	950
94	Ga0070712_101122520	3300006175	Unclassified	683
95	Ga0075433_10491832	3300006852	Unclassified	1080
96	Ga0075433_10624501	3300006852	Bacteria	945
97	Ga0075434_100157187	3300006871	Bacteria	2293
98	Ga0075434_101608288	3300006871	Bacteria	658
99	Ga0075435_101322390	3300007076	Unclassified	631
100	Ga0105240_10407593	3300009093	Unclassified	1530
101	Ga0105240_10490071	3300009093	Bacteria	1369
102	Ga0105240_12268068	3300009093	Bacteria	562
103	Ga0105245_10079742	3300009098	Bacteria	2990
104	Ga0105241_10727162	3300009174	Bacteria	908
105	Ga0105248_10088356	3300009177	Bacteria	3488
106	Ga0105237_10011717	3300009545	Bacteria	9272
107	Ga0105237_10466644	3300009545	Bacteria	1268
108	Ga0105237_10821067	3300009545	Bacteria	937
109	Ga0105238_10450213	3300009551	Bacteria	1284
110	Ga0105238_10685846	3300009551	Bacteria	1036
111	Ga0105249_10988960	3300009553	Bacteria	910
112	Ga0105239_10452822	3300010375	Bacteria	1456
113	Ga0105239_11977906	3300010375	Bacteria	677
114	Ga0157373_10948097	3300013100	Bacteria	640
115	Ga0157371_10563760	3300013102	Bacteria	845
116	Ga0157370_11082174	3300013104	Bacteria	725
117	Ga0157369_10654885	3300013105	Bacteria	1083
118	Ga0157369_10954431	3300013105	Bacteria	879
119	Ga0157374_10053595	3300013296	Bacteria	3760
120	Ga0157374_10091287	3300013296	Bacteria	2904
121	Ga0157378_11332222	3300013297	Unclassified	760
122	Ga0157372_10162489	3300013307	Bacteria	2581
123	Ga0157372_10314130	3300013307	Bacteria	1824
124	Ga0157372_10990119	3300013307	Unclassified	974
125	Ga0157372_11557328	3300013307	Bacteria	761
126	Ga0182008_10068894	3300014497	Unclassified	1741
127	Ga0182008_10372733	3300014497	Bacteria	761
128	Ga0182008_10956873	3300014497	Unclassified	508
129	Ga0157377_10998008	3300014745	Bacteria	634
130	Ga0157376_10432611	3300014969	Bacteria	1279
131	Ga0157376_12521369	3300014969	Bacteria	554
132	Ga0197907_10394550	3300020069	Bacteria	733
133	Ga0197907_10497667	3300020069	Bacteria	634
134	Ga0206356_10802283	3300020070	Bacteria	511
135	Ga0206356_10989153	3300020070	Bacteria	2931
136	Ga0206349_1852444	3300020075	Bacteria	613
137	Ga0206350_11436359	3300020080	Bacteria	605
138	Ga0206354_11244338	3300020081	Bacteria	1365
139	Ga0206353_11954450	3300020082	Bacteria	2665
140	Ga0224712_10025428	3300022467	Bacteria	2081
141	Ga0224712_10197100	3300022467	Bacteria	914
142	Ga0224712_10298936	3300022467	Bacteria	752
143	Ga0224712_10408332	3300022467	Bacteria	648
144	Ga0207692_10005324	3300025898	Bacteria	5149
145	Ga0207692_10028126	3300025898	Bacteria	2655
146	Ga0207692_10068332	3300025898	Bacteria	1863
147	Ga0207685_10067479	3300025905	Bacteria	1439
148	Ga0207699_10017684	3300025906	Bacteria	3760
149	Ga0207699_10056405	3300025906	Bacteria	2341
150	Ga0207699_10995300	3300025906	Bacteria	620
151	Ga0207699_11447100	3300025906	Unclassified	508
152	Ga0207705_10079078	3300025909	Bacteria	2394
153	Ga0207684_10398312	3300025910	Bacteria	1183
154	Ga0207707_10158917	3300025912	Bacteria	1976
155	Ga0207707_10389603	3300025912	Bacteria	1197
156	Ga0207695_10252136	3300025913	Bacteria	1664
157	Ga0207671_10027756	3300025914	Bacteria	4232
158	Ga0207671_10521592	3300025914	Bacteria	947
159	Ga0207693_10000282	3300025915	Bacteria	47278
160	Ga0207693_10231790	3300025915	Bacteria	1450
161	Ga0207663_10007649	3300025916	Bacteria	5617
162	Ga0207663_10717703	3300025916	Unclassified	792
163	Ga0207663_11293401	3300025916	Unclassified	587
164	Ga0207660_10319830	3300025917	Bacteria	1239
165	Ga0207660_10724895	3300025917	Unclassified	811
166	Ga0207657_10000988	3300025919	Bacteria	30190
167	Ga0207657_11178567	3300025919	Bacteria	583
168	Ga0207649_11187328	3300025920	Bacteria	603
169	Ga0207652_10425497	3300025921	Bacteria	1197
170	Ga0207652_11050150	3300025921	Bacteria	714
171	Ga0207646_10346744	3300025922	Bacteria	1342
172	Ga0207646_10528197	3300025922	Bacteria	1062
173	Ga0207646_11094956	3300025922	Bacteria	701
174	Ga0207694_10705017	3300025924	Bacteria	851
175	Ga0207700_10045424	3300025928	Bacteria	3241
176	Ga0207700_10079100	3300025928	Bacteria	2559
177	Ga0207664_10007295	3300025929	Bacteria	7666
178	Ga0207664_10035721	3300025929	Bacteria	3836
179	Ga0207664_10044965	3300025929	Bacteria	3460
180	Ga0207664_10190897	3300025929	Unclassified	1763
181	Ga0207664_10363048	3300025929	Bacteria	1283
182	Ga0207644_10406528	3300025931	Unclassified	1114
183	Ga0207644_10485660	3300025931	Bacteria	1018
184	Ga0207644_10810793	3300025931	Bacteria	783
185	Ga0207690_10053245	3300025932	Bacteria	2714
186	Ga0207690_10435728	3300025932	Unclassified	1051
187	Ga0207665_10001074	3300025939	Bacteria	18382
188	Ga0207665_10050605	3300025939	Bacteria	2794
189	Ga0207665_10716247	3300025939	Bacteria	787
190	Ga0207665_11285156	3300025939	Unclassified	583
191	Ga0207711_10108441	3300025941	Bacteria	2466
192	Ga0207661_10074555	3300025944	Bacteria	2781
193	Ga0207667_10458885	3300025949	Bacteria	1294
194	Ga0207712_10718254	3300025961	Bacteria	873
195	Ga0207677_11445945	3300026023	Bacteria	634
196	Ga0207702_10116059	3300026078	Bacteria	2388
197	Ga0207702_10633061	3300026078	Bacteria	1051
198	Ga0207698_10207099	3300026142	Bacteria	1761
199	Ga0265334_10019463	3300028573	Bacteria	2792
200	Ga0265322_10244659	3300028654	Bacteria	515
201	Ga0265336_10017499	3300028666	Bacteria	2333
202	Ga0265336_10065008	3300028666	Bacteria	1091
203	Ga0265338_10000924	3300028800	Bacteria	49511
204	Ga0265338_10003221	3300028800	Bacteria	23276
205	Ga0265338_10116893	3300028800	Bacteria	2135
206	Ga0265324_10021117	3300029957	Bacteria	2336
207	Ga0265324_10051196	3300029957	Bacteria	1419
208	Ga0265313_10113507	3300031595	Bacteria	1189
209	Ga0373926_0024316	3300035083	Bacteria	2109
210	Ga0373923_0185933	3300035111	Bacteria	956
211	Ga0373936_0093672	3300035113	Bacteria	1261
212	Ga0373945_0153433	3300035116	Unclassified	935
213	Ga0373956_0110362	3300035119	Bacteria	1280
214	Ga0373943_0004768	3300035170	Bacteria	6129
215	Ga0373943_0558916	3300035170	Bacteria	672
216	Ga0373943_0775987	3300035170	Bacteria	570
217	Ga0373946_0050098	3300035171	Bacteria	1743
218	Ga0373955_0501032	3300035172	Bacteria	742
219	Ga0373924_0427892	3300035410	Unclassified	593
220	Ga0373931_0088921	3300035691	Bacteria	1718
221	Ga0373931_0372046	3300035691	Unclassified	899
222	Ga0373935_0387249	3300035692	Bacteria	1002
223	Ga0373933_0069500	3300035724	Bacteria	2141
224	Ga0373947_0000371	3300035725	Bacteria	25349
225	Ga0373937_0000725	3300036401	Bacteria	28683
226	Ga0373937_0328754	3300036401	Bacteria	1447
227	Ga0373937_1768689	3300036401	Unclassified	565
228	Ga0373925_0001462	3300037068	Bacteria	20386
229	Ga0395899_0045692	3300037312	Bacteria	3263
230	Ga0395899_0982444	3300037312	Bacteria	510
231	Ga0395898_0109506	3300037466	Bacteria	2648
232	Ga0395905_0308059	3300037471	Bacteria	1472
233	Ga0436363_0758919	3300039450	Bacteria	544
234	Ga0451789_0943147	3300041443	Unclassified	829
235	Ga0466972_0049299	3300044658	Bacteria	2034
236	Ga0466972_0200849	3300044658	Bacteria	934
237	Ga0466965_0024499	3300044683	Bacteria	2920
238	Ga0466965_0244381	3300044683	Bacteria	961
239	Ga0466966_0059424	3300044684	Bacteria	2414
240	Ga0466966_0122629	3300044684	Bacteria	1595
241	Ga0466966_0358564	3300044684	Bacteria	876
242	Ga0466961_0008333	3300044693	Bacteria	6599
243	Ga0466961_0014252	3300044693	Bacteria	5103
244	Ga0466961_0030814	3300044693	Bacteria	3446
245	Ga0466961_0048840	3300044693	Bacteria	2705
246	Ga0466963_0000102	3300044694	Bacteria	30465
247	Ga0466963_0003617	3300044694	Bacteria	8883
248	Ga0466963_0005276	3300044694	Bacteria	7547
249	Ga0466963_0012870	3300044694	Bacteria	5125
250	Ga0466963_0013692	3300044694	Bacteria	4987
251	Ga0466963_0019443	3300044694	Bacteria	4261
252	Ga0466963_0035681	3300044694	Bacteria	3240
253	Ga0466963_0038174	3300044694	Bacteria	3139
254	Ga0466963_0070780	3300044694	Bacteria	2346
255	Ga0466963_0103188	3300044694	Bacteria	1953
256	Ga0466963_0348803	3300044694	Bacteria	1042
257	Ga0466963_0390204	3300044694	Bacteria	981
258	Ga0466963_0526818	3300044694	Unclassified	834
259	Ga0466963_0913593	3300044694	Bacteria	618
260	Ga0466964_0003428	3300044706	Bacteria	5785
261	Ga0466964_0006069	3300044706	Bacteria	4504
262	Ga0466964_0007107	3300044706	Bacteria	4188
263	Ga0466964_0026692	3300044706	Bacteria	2262
264	Ga0466964_0034062	3300044706	Bacteria	2031
265	Ga0466964_0051181	3300044706	Bacteria	1696
266	Ga0466964_0068165	3300044706	Unclassified	1498
267	Ga0466971_0015053	3300044719	Bacteria	3402
268	Ga0466971_0021563	3300044719	Bacteria	2866
269	Ga0466971_0063321	3300044719	Bacteria	1674
270	Ga0466971_0081435	3300044719	Bacteria	1476
271	Ga0466971_0344630	3300044719	Bacteria	720
272	Ga0466968_0001167	3300044735	Bacteria	9315
273	Ga0466968_0010565	3300044735	Bacteria	3582
274	Ga0466968_0023275	3300044735	Bacteria	2522
275	Ga0466968_0037625	3300044735	Bacteria	2031
276	Ga0466968_0160200	3300044735	Bacteria	1038
277	Ga0466968_0327472	3300044735	Bacteria	741
278	Ga0466970_0038292	3300044765	Bacteria	2543
279	Ga0466957_0005373	3300044842	Bacteria	7191
280	Ga0466957_0005782	3300044842	Bacteria	6952
281	Ga0466957_0008474	3300044842	Bacteria	5849
282	Ga0466957_0010928	3300044842	Bacteria	5221
283	Ga0466957_0012050	3300044842	Bacteria	4998
284	Ga0466957_0325143	3300044842	Unclassified	1038
285	Ga0466957_0688260	3300044842	Bacteria	721
286	Ga0466957_1301988	3300044842	Bacteria	527
287	Ga0466960_0061333	3300044901	Bacteria	1846
288	Ga0466960_0063635	3300044901	Bacteria	1816
289	Ga0466959_0082093	3300045049	Unclassified	2322
290	Ga0466959_0166385	3300045049	Bacteria	1548
291	Ga0466958_0005167	3300045836	Bacteria	6983
292	Ga0466958_0005361	3300045836	Bacteria	6889
293	Ga0466958_0010780	3300045836	Bacteria	5128
294	Ga0466958_0023292	3300045836	Bacteria	3632
295	Ga0466958_0023638	3300045836	Bacteria	3610
296	Ga0466958_0098786	3300045836	Bacteria	1813
297	Ga0466958_0106069	3300045836	Bacteria	1751
298	Ga0466958_0198218	3300045836	Bacteria	1277
299	Ga0466958_0979555	3300045836	Unclassified	552
300	Ga0466967_0000094	3300045976	Bacteria	31562
301	Ga0466967_0039568	3300045976	Bacteria	4054
302	Ga0466967_0053118	3300045976	Bacteria	3560
303	Ga0466967_0066834	3300045976	Bacteria	3204
304	Ga0466967_0076521	3300045976	Bacteria	3010
305	Ga0466967_0217266	3300045976	Bacteria	1815
306	Ga0466967_0218412	3300045976	Bacteria	1810
307	Ga0466967_0275727	3300045976	Bacteria	1612
308	Ga0466967_0449437	3300045976	Bacteria	1259
309	Ga0466967_0531299	3300045976	Bacteria	1156
310	Ga0466967_0742378	3300045976	Bacteria	973
311	Ga0495592_0000050	3300046454	Bacteria	111971
312	Ga0495592_0002810	3300046454	Bacteria	12341
313	Ga0495592_0140719	3300046454	Unclassified	1679
314	Ga0495603_0295877	3300046455	Bacteria	930
315	Ga0495629_0110268	3300046459	Bacteria	1918
316	Ga0495629_0294950	3300046459	Bacteria	1111
317	Ga0495651_0000028	3300046462	Bacteria	105473
318	Ga0495651_0106647	3300046462	Bacteria	2076
319	Ga0495653_0001289	3300046463	Bacteria	19386
320	Ga0495653_0005665	3300046463	Bacteria	10200
321	Ga0495653_0039159	3300046463	Bacteria	3715
322	Ga0495653_0564850	3300046463	Bacteria	703
323	Ga0495653_0838902	3300046463	Unclassified	550
324	Ga0495653_0955102	3300046463	Unclassified	508
325	Ga0495580_0004702	3300046472	Bacteria	11446
326	Ga0495582_0003512	3300046473	Bacteria	8836
327	Ga0495605_0370916	3300046474	Bacteria	598
328	Ga0495639_0000481	3300046475	Bacteria	19003
329	Ga0495664_0006065	3300046477	Bacteria	6664
330	Ga0495664_0164078	3300046477	Bacteria	1348
331	Ga0495664_0225910	3300046477	Bacteria	1133
332	Ga0495664_0248175	3300046477	Bacteria	1076
333	Ga0495664_0262876	3300046477	Bacteria	1043
334	Ga0495664_0547795	3300046477	Unclassified	689
335	Ga0495664_0566758	3300046477	Unclassified	676
336	Ga0495584_0019684	3300046491	Bacteria	3429
337	Ga0495594_0796415	3300046499	Bacteria	533
338	Ga0495607_0053355	3300046501	Bacteria	2337
339	Ga0495608_0002062	3300046511	Bacteria	14459
340	Ga0495608_0048015	3300046511	Bacteria	2837
341	Ga0495608_0081771	3300046511	Bacteria	2098
342	Ga0495608_0167776	3300046511	Unclassified	1393
343	Ga0495618_0001024	3300046514	Bacteria	19164
344	Ga0495618_0051562	3300046514	Bacteria	2599
345	Ga0495618_0113005	3300046514	Unclassified	1739
346	Ga0495618_0130561	3300046514	Bacteria	1607
347	Ga0495618_0279690	3300046514	Bacteria	1041
348	Ga0495628_0000060	3300046516	Bacteria	87173
349	Ga0495628_0008128	3300046516	Bacteria	9029
350	Ga0495628_0321985	3300046516	Unclassified	1141
351	Ga0495628_0354432	3300046516	Bacteria	1078
352	Ga0495628_0447383	3300046516	Unclassified	939
353	Ga0495630_0000995	3300046517	Bacteria	19714
354	Ga0495630_0101997	3300046517	Bacteria	2170
355	Ga0495630_0104039	3300046517	Bacteria	2148
356	Ga0495630_0221223	3300046517	Unclassified	1445
357	Ga0495666_0000688	3300046526	Bacteria	15346
358	Ga0495642_0519802	3300046528	Unclassified	527
359	Ga0495652_0000969	3300046529	Bacteria	32863
360	Ga0495652_0008136	3300046529	Bacteria	9590
361	Ga0495652_0010648	3300046529	Bacteria	8330
362	Ga0495652_0096000	3300046529	Bacteria	2415
363	Ga0495652_0141504	3300046529	Bacteria	1891
364	Ga0495665_0004703	3300046531	Bacteria	7364
365	Ga0495640_0203567	3300046533	Unclassified	1254
366	Ga0495640_0229531	3300046533	Bacteria	1168
367	Ga0495586_0033309	3300046535	Bacteria	2765
368	Ga0495587_0000062	3300046536	Bacteria	91862
369	Ga0495587_0086090	3300046536	Bacteria	1819
370	Ga0495587_0139273	3300046536	Unclassified	1385
371	Ga0495587_0394646	3300046536	Unclassified	769
372	Ga0495645_0000207	3300046543	Bacteria	42086
373	Ga0495645_0004423	3300046543	Bacteria	9598
374	Ga0495645_0055416	3300046543	Bacteria	2879
375	Ga0495667_0009415	3300046559	Bacteria	6617
376	Ga0495667_0071626	3300046559	Bacteria	2260
377	Ga0495667_0694724	3300046559	Unclassified	631
378	Ga0495656_0017577	3300046615	Bacteria	2731
379	Ga0495634_0024255	3300046642	Bacteria	4259
380	Ga0495634_0038991	3300046642	Bacteria	3237
381	Ga0495634_0068329	3300046642	Bacteria	2348
382	Ga0495634_0134930	3300046642	Bacteria	1571
383	Ga0495634_0221227	3300046642	Bacteria	1168
384	Ga0495611_0025819	3300046648	Bacteria	2562
385	Ga0495635_0009343	3300046663	Bacteria	6852
386	Ga0495635_0074020	3300046663	Bacteria	2333
387	Ga0495635_0191008	3300046663	Unclassified	1390
388	Ga0495635_0417440	3300046663	Unclassified	890
389	Ga0495635_0678416	3300046663	Unclassified	669
390	Ga0495588_0607589	3300046674	Unclassified	573
391	Ga0495657_0014967	3300046675	Bacteria	5690
392	Ga0495657_0477377	3300046675	Bacteria	728
393	Ga0495657_0525376	3300046675	Bacteria	689
394	Ga0495599_0000202	3300046678	Bacteria	39562
395	Ga0495599_0052755	3300046678	Bacteria	2547
396	Ga0495599_0068408	3300046678	Bacteria	2217
397	Ga0495599_0235787	3300046678	Bacteria	1116
398	Ga0495623_0000230	3300046679	Bacteria	35964
399	Ga0495623_0276655	3300046679	Bacteria	935
400	Ga0495646_0017844	3300046680	Bacteria	4497
401	Ga0495646_0019601	3300046680	Bacteria	4279
402	Ga0495647_0000670	3300046681	Bacteria	10187
403	Ga0495658_0782852	3300046683	Bacteria	611
404	Ga0495613_0005595	3300046689	Bacteria	9434
405	Ga0495613_0028992	3300046689	Bacteria	4115
406	Ga0495613_0516690	3300046689	Bacteria	802
407	Ga0495624_0126911	3300046690	Bacteria	1565
408	Ga0495670_0054914	3300046691	Bacteria	1997
409	Ga0495589_0073821	3300046794	Bacteria	1664
410	Ga0495600_0008576	3300046809	Bacteria	6286
411	Ga0495600_0042913	3300046809	Bacteria	2949
412	Ga0495600_0172045	3300046809	Bacteria	1398
413	Ga0495600_0247676	3300046809	Unclassified	1134
414	Ga0495581_0017948	3300047315	Bacteria	4111
415	Ga0495581_0236512	3300047315	Bacteria	1068
416	Ga0495581_0277642	3300047315	Bacteria	979
417	Ga0495604_0000262	3300047317	Bacteria	46873
418	Ga0495604_0045005	3300047317	Bacteria	3446
419	Ga0495674_0147744	3300047319	Bacteria	1972
420	Ga0495674_0476548	3300047319	Bacteria	1000
421	Ga0495674_0507958	3300047319	Unclassified	963
422	Ga0495674_0937249	3300047319	Bacteria	667
423	Ga0495676_0019630	3300047321	Bacteria	5942
424	Ga0495676_0032491	3300047321	Bacteria	4404
425	Ga0495676_0400808	3300047321	Unclassified	910
426	Ga0495676_0701014	3300047321	Bacteria	655
427	Ga0495680_0020304	3300047322	Bacteria	5592
428	Ga0495680_0034009	3300047322	Bacteria	4123
429	Ga0495680_0285333	3300047322	Unclassified	1162
430	Ga0495680_0608752	3300047322	Bacteria	730
431	Ga0495675_0000020	3300047444	Bacteria	111526
432	Ga0495675_0045314	3300047444	Bacteria	2801
433	Ga0495684_0012195	3300047471	Bacteria	6630
434	Ga0495684_0016556	3300047471	Bacteria	5679
435	Ga0495684_0039015	3300047471	Bacteria	3640
436	Ga0495684_0133613	3300047471	Bacteria	1862
437	Ga0495593_0001863	3300047673	Bacteria	12556
438	Ga0495593_0014233	3300047673	Bacteria	4523
439	Ga0495593_0603945	3300047673	Bacteria	551
440	Ga0495602_0000222	3300048088	Bacteria	53050
441	Ga0495602_0039532	3300048088	Bacteria	4342
442	Ga0495602_0217204	3300048088	Unclassified	1446
443	Ga0495602_0902414	3300048088	Unclassified	588
444	Ga0495614_0001717	3300048089	Bacteria	9568
445	Ga0496100_0041479	3300048903	Bacteria	2933
446	Ga0496100_0206156	3300048903	Bacteria	1436
447	Ga0496100_0208200	3300048903	Bacteria	1429
448	Ga0496101_0011809	3300048904	Bacteria	5809
449	Ga0496101_0515753	3300048904	Bacteria	945
450	Ga0496102_0021075	3300048905	Bacteria	5764
451	Ga0496102_0082856	3300048905	Bacteria	2958
452	Ga0496102_1141931	3300048905	Bacteria	699
453	Ga0496102_1283529	3300048905	Bacteria	651
454	Ga0496103_0014385	3300048906	Bacteria	4700
455	Ga0496103_0018723	3300048906	Bacteria	4155
456	Ga0496104_0014672	3300048907	Bacteria	7078
457	Ga0496104_0015903	3300048907	Bacteria	6828
458	Ga0496105_0019886	3300048908	Bacteria	5418
459	Ga0496105_0029719	3300048908	Bacteria	4473
460	Ga0496105_0453627	3300048908	Bacteria	1012
461	Ga0496106_0259759	3300048909	Bacteria	1390
462	Ga0496106_0427281	3300048909	Bacteria	1065
463	Ga0496106_0598504	3300048909	Bacteria	883
464	Ga0496107_0009770	3300048910	Bacteria	6654
465	Ga0496107_0076515	3300048910	Bacteria	2437
466	Ga0496107_0323184	3300048910	Unclassified	1148
467	Ga0496108_0009079	3300048911	Bacteria	8054
468	Ga0496108_0034402	3300048911	Bacteria	4210
469	Ga0496108_0071809	3300048911	Bacteria	2921
470	Ga0496108_0521562	3300048911	Bacteria	1037
471	Ga0496109_0003892	3300048912	Bacteria	12470
472	Ga0496109_0010667	3300048912	Bacteria	7860
473	Ga0496109_0603730	3300048912	Bacteria	1033
474	Ga0496110_0134934	3300048913	Bacteria	2230
475	Ga0496110_0141353	3300048913	Bacteria	2176
476	Ga0496110_0525975	3300048913	Bacteria	1076
477	Ga0496111_0036366	3300048914	Bacteria	3520
478	Ga0496111_0046870	3300048914	Bacteria	3113
479	Ga0496111_0096509	3300048914	Bacteria	2170
480	Ga0496111_0279040	3300048914	Bacteria	1239
481	Ga0496111_0999759	3300048914	Bacteria	599
482	Ga0496112_0098299	3300048915	Bacteria	2896
483	Ga0496112_0106028	3300048915	Bacteria	2780
484	Ga0496112_0655954	3300048915	Bacteria	979
485	Ga0496112_0914666	3300048915	Bacteria	799
486	Ga0496113_0029330	3300048916	Bacteria	3971
487	Ga0496113_0131356	3300048916	Bacteria	1965
488	Ga0496113_0133676	3300048916	Bacteria	1948
489	Ga0496114_0017907	3300048917	Bacteria	5725
490	Ga0496114_0052601	3300048917	Bacteria	3393
491	Ga0496114_0066011	3300048917	Bacteria	3033
492	Ga0496114_1682285	3300048917	Bacteria	523
493	Ga0496115_0048713	3300048918	Bacteria	3389
494	Ga0496115_0061199	3300048918	Bacteria	3035
495	Ga0496115_0079276	3300048918	Bacteria	2673
496	Ga0496115_0118095	3300048918	Bacteria	2181
497	Ga0496115_0209041	3300048918	Bacteria	1612
498	Ga0501067_0337534	3300049583	Bacteria	840
499	nmdc:mga0n895_25551_c1	3300050512	Bacteria	5582
500	nmdc:mga0rr50_1139521_c1	3300050513	Unclassified	663
501	nmdc:mga0a205_551650_c1	3300050515	Unclassified	1007
502	nmdc:mga0a205_95152_c1	3300050515	Bacteria	2877
503	Ga0495601_0000218	3300053077	Bacteria	30705
504	Ga0495601_0005907	3300053077	Bacteria	7136
505	Ga0495601_0053519	3300053077	Bacteria	2551
506	Ga0495601_0158768	3300053077	Unclassified	1477
507	Ga0495601_0202888	3300053077	Bacteria	1295
508	Ga0495601_0203688	3300053077	Bacteria	1293
509	Ga0495601_0467905	3300053077	Unclassified	815
510	Ga0495601_0975539	3300053077	Unclassified	533
511	Ga0495612_0003098	3300053078	Bacteria	6890
512	Ga0495612_0016785	3300053078	Bacteria	2932
513	Ga0495612_0308191	3300053078	Bacteria	711
514	Ga0495655_0004634	3300053083	Bacteria	2368
515	Ga0495595_0063170	3300053084	Bacteria	1738
516	Ga0495595_0124640	3300053084	Bacteria	1256
517	Ga0495595_0204444	3300053084	Bacteria	983
518	Ga0495595_0256357	3300053084	Unclassified	876
519	Ga0495595_0287766	3300053084	Bacteria	826
520	Ga0495619_0001137	3300053085	Bacteria	17476
521	Ga0495619_0032960	3300053085	Bacteria	3363
522	Ga0495619_0333784	3300053085	Bacteria	1049
523	Ga0495619_0524733	3300053085	Unclassified	813
524	Ga0500566_0237195	3300053094	Unclassified	896
525	Ga0466962_0000096	3300061719	Bacteria	35253
526	Ga0466962_0020166	3300061719	Bacteria	3204
527	Ga0466962_0060040	3300061719	Bacteria	1815
528	Ga0466962_0074919	3300061719	Bacteria	1617
529	Ga0466962_0131907	3300061719	Bacteria	1208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005536	Ga0070697_100804516	Ga0070697_1008045162	97
2	3300005435	Ga0070714_100070280	Ga0070714_1000702803	98
3	3300005436	Ga0070713_102492242	Ga0070713_1024922421	98
4	3300006173	Ga0070716_100373935	Ga0070716_1003739352	98
5	3300025906	Ga0207699_11447100	Ga0207699_114471001	98
6	3300025939	Ga0207665_11285156	Ga0207665_112851562	98
7	3300044706	Ga0466964_0034062	Ga0466964_0034062_1692_2003	103
8	3300046459	Ga0495629_0110268	Ga0495629_0110268_1344_1655	103
9	3300046678	Ga0495599_0068408	Ga0495599_0068408_92_403	103
10	3300046689	Ga0495613_0516690	Ga0495613_0516690_264_575	103
11	3300047315	Ga0495581_0277642	Ga0495581_0277642_305_616	103
12	3300047673	Ga0495593_0014233	Ga0495593_0014233_238_549	103
13	3300005337	Ga0070682_100522096	Ga0070682_1005220962	106
14	3300005539	Ga0068853_100895866	Ga0068853_1008958662	106
15	3300005545	Ga0070695_100000814	Ga0070695_1000008149	106
16	3300009545	Ga0105237_10011717	Ga0105237_100117179	106
17	3300013100	Ga0157373_10948097	Ga0157373_109480971	106
18	3300044706	Ga0466964_0068165	Ga0466964_0068165_83_403	106
19	3300046463	Ga0495653_0564850	Ga0495653_0564850_228_575	106
20	3300046529	Ga0495652_0096000	Ga0495652_0096000_19_366	106
21	3300046533	Ga0495640_0203567	Ga0495640_0203567_704_1051	106
22	3300048088	Ga0495602_0902414	Ga0495602_0902414_36_383	106
23	3300048905	Ga0496102_0021075	Ga0496102_0021075_4361_4681	106
24	3300037471	Ga0395905_0308059	Ga0395905_0308059_666_992	108
25	3300044683	Ga0466965_0024499	Ga0466965_0024499_1037_1366	109
26	3300044693	Ga0466961_0030814	Ga0466961_0030814_1466_1795	109
27	3300044694	Ga0466963_0003617	Ga0466963_0003617_3570_3899	109
28	3300044719	Ga0466971_0021563	Ga0466971_0021563_623_952	109
29	3300044735	Ga0466968_0023275	Ga0466968_0023275_587_916	109
30	3300044842	Ga0466957_0010928	Ga0466957_0010928_1299_1628	109
31	3300045836	Ga0466958_0023292	Ga0466958_0023292_1694_2023	109
32	3300045976	Ga0466967_0053118	Ga0466967_0053118_664_993	109
33	3300045976	Ga0466967_0742378	Ga0466967_0742378_141_470	109
34	3300061719	Ga0466962_0000096	Ga0466962_0000096_30188_30517	109
35	3300044684	Ga0466966_0358564	Ga0466966_0358564_112_444	110
36	3300047322	Ga0495680_0608752	Ga0495680_0608752_67_399	110
37	3300053077	Ga0495601_0203688	Ga0495601_0203688_47_379	110
38	3300013104	Ga0157370_11082174	Ga0157370_110821741	111
39	3300013105	Ga0157369_10654885	Ga0157369_106548852	111
40	3300013307	Ga0157372_10990119	Ga0157372_109901192	111
41	3300014969	Ga0157376_12521369	Ga0157376_125213692	111
42	3300035170	Ga0373943_0775987	Ga0373943_0775987_147_482	111
43	3300035172	Ga0373955_0501032	Ga0373955_0501032_23_358	111
44	3300035724	Ga0373933_0069500	Ga0373933_0069500_620_955	111
45	3300036401	Ga0373937_0328754	Ga0373937_0328754_72_407	111
46	3300036401	Ga0373937_1768689	Ga0373937_1768689_218_553	111
47	3300046459	Ga0495629_0294950	Ga0495629_0294950_477_812	111
48	3300046474	Ga0495605_0370916	Ga0495605_0370916_242_577	111
49	3300046477	Ga0495664_0262876	Ga0495664_0262876_641_976	111
50	3300046477	Ga0495664_0566758	Ga0495664_0566758_269_604	111
51	3300046491	Ga0495584_0019684	Ga0495584_0019684_284_619	111
52	3300046501	Ga0495607_0053355	Ga0495607_0053355_1890_2225	111
53	3300046511	Ga0495608_0081771	Ga0495608_0081771_1736_2071	111
54	3300046514	Ga0495618_0279690	Ga0495618_0279690_283_618	111
55	3300046517	Ga0495630_0104039	Ga0495630_0104039_664_999	111
56	3300046528	Ga0495642_0519802	Ga0495642_0519802_150_485	111
57	3300046529	Ga0495652_0141504	Ga0495652_0141504_386_721	111
58	3300046533	Ga0495640_0229531	Ga0495640_0229531_745_1080	111
59	3300046535	Ga0495586_0033309	Ga0495586_0033309_2388_2723	111
60	3300046536	Ga0495587_0086090	Ga0495587_0086090_637_972	111
61	3300046543	Ga0495645_0055416	Ga0495645_0055416_138_473	111
62	3300046615	Ga0495656_0017577	Ga0495656_0017577_1222_1557	111
63	3300046675	Ga0495657_0525376	Ga0495657_0525376_287_622	111
64	3300046678	Ga0495599_0235787	Ga0495599_0235787_140_475	111
65	3300046680	Ga0495646_0019601	Ga0495646_0019601_3464_3799	111
66	3300046691	Ga0495670_0054914	Ga0495670_0054914_14_349	111
67	3300046794	Ga0495589_0073821	Ga0495589_0073821_843_1178	111
68	3300047321	Ga0495676_0701014	Ga0495676_0701014_75_410	111
69	3300048088	Ga0495602_0217204	Ga0495602_0217204_584_919	111
70	3300048903	Ga0496100_0208200	Ga0496100_0208200_549_884	111
71	3300048907	Ga0496104_0014672	Ga0496104_0014672_334_669	111
72	3300048907	Ga0496104_0015903	Ga0496104_0015903_1670_2005	111
73	3300048908	Ga0496105_0029719	Ga0496105_0029719_706_1041	111
74	3300048909	Ga0496106_0427281	Ga0496106_0427281_358_693	111
75	3300048910	Ga0496107_0323184	Ga0496107_0323184_43_378	111
76	3300048911	Ga0496108_0009079	Ga0496108_0009079_5952_6287	111
77	3300048912	Ga0496109_0003892	Ga0496109_0003892_81_416	111
78	3300048913	Ga0496110_0134934	Ga0496110_0134934_155_490	111
79	3300048914	Ga0496111_0036366	Ga0496111_0036366_3128_3463	111
80	3300048916	Ga0496113_0133676	Ga0496113_0133676_346_681	111
81	3300048917	Ga0496114_0017907	Ga0496114_0017907_4201_4536	111
82	3300048917	Ga0496114_0066011	Ga0496114_0066011_1693_2028	111
83	3300048918	Ga0496115_0118095	Ga0496115_0118095_100_435	111
84	3300053077	Ga0495601_0202888	Ga0495601_0202888_381_716	111
85	3300053077	Ga0495601_0975539	Ga0495601_0975539_149_484	111
86	3300005467	Ga0070706_100336286	Ga0070706_1003362862	112
87	3300005468	Ga0070707_100001986	Ga0070707_10000198620	112
88	3300005471	Ga0070698_100219347	Ga0070698_1002193474	112
89	3300044683	Ga0466965_0244381	Ga0466965_0244381_444_821	112
90	3300044684	Ga0466966_0122629	Ga0466966_0122629_218_595	112
91	3300044693	Ga0466961_0008333	Ga0466961_0008333_2733_3110	112
92	3300045049	Ga0466959_0082093	Ga0466959_0082093_462_839	112
93	3300045836	Ga0466958_0979555	Ga0466958_0979555_100_477	112
94	3300006175	Ga0070712_101122520	Ga0070712_1011225202	113
95	3300037312	Ga0395899_0045692	Ga0395899_0045692_1662_2003	113
96	3300037466	Ga0395898_0109506	Ga0395898_0109506_1467_1808	113
97	3300053083	Ga0495655_0004634	Ga0495655_0004634_1924_2265	113
98	3300044694	Ga0466963_0000102	Ga0466963_0000102_15769_16113	114
99	3300044694	Ga0466963_0038174	Ga0466963_0038174_1861_2241	114
100	3300044706	Ga0466964_0007107	Ga0466964_0007107_3642_4022	114
101	3300044842	Ga0466957_0008474	Ga0466957_0008474_4209_4553	114
102	3300044842	Ga0466957_0688260	Ga0466957_0688260_269_649	114
103	3300045836	Ga0466958_0005167	Ga0466958_0005167_14_358	114
104	3300045836	Ga0466958_0023638	Ga0466958_0023638_537_917	114
105	3300045976	Ga0466967_0000094	Ga0466967_0000094_8686_9030	114
106	3300045976	Ga0466967_0217266	Ga0466967_0217266_1323_1667	114
107	3300045976	Ga0466967_0218412	Ga0466967_0218412_628_1008	114
108	3300005329	Ga0070683_100616390	Ga0070683_1006163902	115
109	3300005338	Ga0068868_101657357	Ga0068868_1016573571	115
110	3300005340	Ga0070689_100695891	Ga0070689_1006958912	115
111	3300005434	Ga0070709_10005227	Ga0070709_100052272	115
112	3300005435	Ga0070714_100037311	Ga0070714_1000373114	115
113	3300005435	Ga0070714_100401584	Ga0070714_1004015842	115
114	3300005436	Ga0070713_100041466	Ga0070713_1000414664	115
115	3300005437	Ga0070710_10003439	Ga0070710_100034394	115
116	3300005439	Ga0070711_100027039	Ga0070711_1000270392	115
117	3300005439	Ga0070711_102023504	Ga0070711_1020235041	115
118	3300005440	Ga0070705_100234719	Ga0070705_1002347192	115
119	3300005468	Ga0070707_101137191	Ga0070707_1011371912	115
120	3300005536	Ga0070697_100773346	Ga0070697_1007733462	115
121	3300005549	Ga0070704_100064573	Ga0070704_1000645732	115
122	3300006028	Ga0070717_10088713	Ga0070717_100887135	115
123	3300006163	Ga0070715_10021489	Ga0070715_100214893	115
124	3300006173	Ga0070716_100019365	Ga0070716_1000193654	115
125	3300006852	Ga0075433_10491832	Ga0075433_104918322	115
126	3300006871	Ga0075434_101608288	Ga0075434_1016082882	115
127	3300007076	Ga0075435_101322390	Ga0075435_1013223901	115
128	3300009093	Ga0105240_10407593	Ga0105240_104075931	115
129	3300009177	Ga0105248_10088356	Ga0105248_100883563	115
130	3300009545	Ga0105237_10821067	Ga0105237_108210672	115
131	3300013296	Ga0157374_10053595	Ga0157374_100535956	115
132	3300014497	Ga0182008_10068894	Ga0182008_100688942	115
133	3300014745	Ga0157377_10998008	Ga0157377_109980082	115
134	3300022467	Ga0224712_10408332	Ga0224712_104083321	115
135	3300025898	Ga0207692_10028126	Ga0207692_100281263	115
136	3300025906	Ga0207699_10056405	Ga0207699_100564052	115
137	3300025910	Ga0207684_10398312	Ga0207684_103983122	115
138	3300025915	Ga0207693_10231790	Ga0207693_102317902	115
139	3300025916	Ga0207663_10007649	Ga0207663_100076492	115
140	3300025916	Ga0207663_11293401	Ga0207663_112934012	115
141	3300025922	Ga0207646_10346744	Ga0207646_103467441	115
142	3300025922	Ga0207646_10528197	Ga0207646_105281972	115
143	3300025928	Ga0207700_10045424	Ga0207700_100454245	115
144	3300025929	Ga0207664_10044965	Ga0207664_100449653	115
145	3300025929	Ga0207664_10363048	Ga0207664_103630482	115
146	3300025931	Ga0207644_10485660	Ga0207644_104856602	115
147	3300025931	Ga0207644_10810793	Ga0207644_108107932	115
148	3300025939	Ga0207665_10001074	Ga0207665_100010749	115
149	3300025941	Ga0207711_10108441	Ga0207711_101084412	115
150	3300026023	Ga0207677_11445945	Ga0207677_114459451	115
151	3300028573	Ga0265334_10019463	Ga0265334_100194634	115
152	3300028654	Ga0265322_10244659	Ga0265322_102446592	115
153	3300028666	Ga0265336_10017499	Ga0265336_100174992	115
154	3300028666	Ga0265336_10065008	Ga0265336_100650082	115
155	3300028800	Ga0265338_10000924	Ga0265338_1000092433	115
156	3300028800	Ga0265338_10003221	Ga0265338_1000322131	115
157	3300028800	Ga0265338_10116893	Ga0265338_101168932	115
158	3300029957	Ga0265324_10021117	Ga0265324_100211173	115
159	3300029957	Ga0265324_10051196	Ga0265324_100511962	115
160	3300031595	Ga0265313_10113507	Ga0265313_101135072	115
161	3300035691	Ga0373931_0088921	Ga0373931_0088921_279_626	115
162	3300035691	Ga0373931_0372046	Ga0373931_0372046_158_505	115
163	3300037312	Ga0395899_0982444	Ga0395899_0982444_123_470	115
164	3300039450	Ga0436363_0758919	Ga0436363_0758919_164_511	115
165	3300044658	Ga0466972_0200849	Ga0466972_0200849_519_869	115
166	3300044684	Ga0466966_0059424	Ga0466966_0059424_1958_2308	115
167	3300044693	Ga0466961_0014252	Ga0466961_0014252_46_396	115
168	3300044693	Ga0466961_0048840	Ga0466961_0048840_2251_2598	115
169	3300044694	Ga0466963_0070780	Ga0466963_0070780_191_541	115
170	3300044694	Ga0466963_0348803	Ga0466963_0348803_471_818	115
171	3300044706	Ga0466964_0026692	Ga0466964_0026692_364_714	115
172	3300044719	Ga0466971_0015053	Ga0466971_0015053_928_1275	115
173	3300044735	Ga0466968_0001167	Ga0466968_0001167_3298_3648	115
174	3300044842	Ga0466957_0005782	Ga0466957_0005782_2587_2937	115
175	3300044901	Ga0466960_0063635	Ga0466960_0063635_977_1324	115
176	3300045049	Ga0466959_0166385	Ga0466959_0166385_108_458	115
177	3300045836	Ga0466958_0005361	Ga0466958_0005361_2616_2966	115
178	3300045976	Ga0466967_0531299	Ga0466967_0531299_26_373	115
179	3300046454	Ga0495592_0002810	Ga0495592_0002810_10778_11125	115
180	3300046462	Ga0495651_0106647	Ga0495651_0106647_1034_1381	115
181	3300046463	Ga0495653_0039159	Ga0495653_0039159_103_450	115
182	3300046463	Ga0495653_0955102	Ga0495653_0955102_136_483	115
183	3300046477	Ga0495664_0225910	Ga0495664_0225910_100_447	115
184	3300046499	Ga0495594_0796415	Ga0495594_0796415_151_498	115
185	3300046511	Ga0495608_0167776	Ga0495608_0167776_384_731	115
186	3300046514	Ga0495618_0113005	Ga0495618_0113005_1311_1658	115
187	3300046516	Ga0495628_0008128	Ga0495628_0008128_2206_2553	115
188	3300046516	Ga0495628_0447383	Ga0495628_0447383_422_769	115
189	3300046517	Ga0495630_0221223	Ga0495630_0221223_110_457	115
190	3300046529	Ga0495652_0010648	Ga0495652_0010648_4200_4547	115
191	3300046536	Ga0495587_0139273	Ga0495587_0139273_602_949	115
192	3300046536	Ga0495587_0394646	Ga0495587_0394646_12_359	115
193	3300046543	Ga0495645_0004423	Ga0495645_0004423_5806_6153	115
194	3300046559	Ga0495667_0071626	Ga0495667_0071626_1784_2131	115
195	3300046642	Ga0495634_0068329	Ga0495634_0068329_721_1068	115
196	3300046642	Ga0495634_0134930	Ga0495634_0134930_327_674	115
197	3300046663	Ga0495635_0074020	Ga0495635_0074020_1342_1689	115
198	3300046663	Ga0495635_0417440	Ga0495635_0417440_76_423	115
199	3300046675	Ga0495657_0477377	Ga0495657_0477377_243_590	115
200	3300046678	Ga0495599_0052755	Ga0495599_0052755_1814_2161	115
201	3300046679	Ga0495623_0276655	Ga0495623_0276655_446_793	115
202	3300046809	Ga0495600_0042913	Ga0495600_0042913_156_503	115
203	3300046809	Ga0495600_0247676	Ga0495600_0247676_133_480	115
204	3300047317	Ga0495604_0045005	Ga0495604_0045005_2152_2499	115
205	3300047319	Ga0495674_0507958	Ga0495674_0507958_230_577	115
206	3300047322	Ga0495680_0285333	Ga0495680_0285333_380_727	115
207	3300047444	Ga0495675_0045314	Ga0495675_0045314_1699_2046	115
208	3300047471	Ga0495684_0133613	Ga0495684_0133613_493_840	115
209	3300047673	Ga0495593_0603945	Ga0495593_0603945_67_414	115
210	3300048088	Ga0495602_0039532	Ga0495602_0039532_143_490	115
211	3300048903	Ga0496100_0041479	Ga0496100_0041479_1674_2021	115
212	3300048904	Ga0496101_0011809	Ga0496101_0011809_3410_3757	115
213	3300048905	Ga0496102_0082856	Ga0496102_0082856_1284_1631	115
214	3300048906	Ga0496103_0014385	Ga0496103_0014385_764_1111	115
215	3300048908	Ga0496105_0019886	Ga0496105_0019886_783_1130	115
216	3300048910	Ga0496107_0009770	Ga0496107_0009770_3135_3482	115
217	3300048911	Ga0496108_0071809	Ga0496108_0071809_1841_2188	115
218	3300048912	Ga0496109_0603730	Ga0496109_0603730_298_645	115
219	3300048913	Ga0496110_0141353	Ga0496110_0141353_555_902	115
220	3300048914	Ga0496111_0046870	Ga0496111_0046870_1393_1740	115
221	3300048915	Ga0496112_0098299	Ga0496112_0098299_709_1056	115
222	3300048916	Ga0496113_0029330	Ga0496113_0029330_1347_1694	115
223	3300048917	Ga0496114_0052601	Ga0496114_0052601_1427_1774	115
224	3300048917	Ga0496114_1682285	Ga0496114_1682285_153_500	115
225	3300048918	Ga0496115_0048713	Ga0496115_0048713_1568_1915	115
226	3300050513	nmdc:mga0rr50_1139521_c1	nmdc:mga0rr50_1139521_c1_177_524	115
227	3300050515	nmdc:mga0a205_551650_c1	nmdc:mga0a205_551650_c1_35_382	115
228	3300053077	Ga0495601_0053519	Ga0495601_0053519_1065_1412	115
229	3300053077	Ga0495601_0467905	Ga0495601_0467905_121_468	115
230	3300053078	Ga0495612_0003098	Ga0495612_0003098_5461_5808	115
231	3300053084	Ga0495595_0204444	Ga0495595_0204444_566_913	115
232	3300053084	Ga0495595_0256357	Ga0495595_0256357_19_366	115
233	3300053085	Ga0495619_0333784	Ga0495619_0333784_143_490	115
234	3300061719	Ga0466962_0074919	Ga0466962_0074919_204_551	115
235	3300003323	rootH1_10165460	rootH1_101654602	116
236	3300005327	Ga0070658_10073144	Ga0070658_100731444	116
237	3300005329	Ga0070683_100129799	Ga0070683_1001297994	116
238	3300005329	Ga0070683_100366323	Ga0070683_1003663232	116
239	3300005329	Ga0070683_101574501	Ga0070683_1015745011	116
240	3300005330	Ga0070690_101729702	Ga0070690_1017297021	116
241	3300005336	Ga0070680_100037484	Ga0070680_1000374844	116
242	3300005336	Ga0070680_100108482	Ga0070680_1001084823	116
243	3300005337	Ga0070682_100225513	Ga0070682_1002255132	116
244	3300005337	Ga0070682_100362089	Ga0070682_1003620891	116
245	3300005337	Ga0070682_100812638	Ga0070682_1008126381	116
246	3300005338	Ga0068868_100317308	Ga0068868_1003173081	116
247	3300005339	Ga0070660_100051424	Ga0070660_1000514242	116
248	3300005339	Ga0070660_100560862	Ga0070660_1005608622	116
249	3300005339	Ga0070660_101905139	Ga0070660_1019051391	116
250	3300005341	Ga0070691_10090143	Ga0070691_100901432	116
251	3300005344	Ga0070661_100123530	Ga0070661_1001235302	116
252	3300005355	Ga0070671_100614051	Ga0070671_1006140512	116
253	3300005366	Ga0070659_100032341	Ga0070659_1000323414	116
254	3300005366	Ga0070659_101047228	Ga0070659_1010472282	116
255	3300005366	Ga0070659_101626901	Ga0070659_1016269011	116
256	3300005434	Ga0070709_10045926	Ga0070709_100459262	116
257	3300005435	Ga0070714_100008658	Ga0070714_1000086583	116
258	3300005435	Ga0070714_100024330	Ga0070714_1000243304	116
259	3300005435	Ga0070714_100033947	Ga0070714_1000339477	116
260	3300005435	Ga0070714_102018027	Ga0070714_1020180271	116
261	3300005436	Ga0070713_100130919	Ga0070713_1001309193	116
262	3300005436	Ga0070713_100595324	Ga0070713_1005953242	116
263	3300005437	Ga0070710_10009232	Ga0070710_100092327	116
264	3300005437	Ga0070710_10362156	Ga0070710_103621562	116
265	3300005439	Ga0070711_100047147	Ga0070711_1000471475	116
266	3300005439	Ga0070711_100462746	Ga0070711_1004627462	116
267	3300005439	Ga0070711_100592735	Ga0070711_1005927352	116
268	3300005444	Ga0070694_100089405	Ga0070694_1000894052	116
269	3300005444	Ga0070694_100721798	Ga0070694_1007217982	116
270	3300005457	Ga0070662_100583750	Ga0070662_1005837502	116
271	3300005458	Ga0070681_10051474	Ga0070681_100514742	116
272	3300005458	Ga0070681_10079821	Ga0070681_100798214	116
273	3300005458	Ga0070681_10342328	Ga0070681_103423282	116
274	3300005468	Ga0070707_101381501	Ga0070707_1013815012	116
275	3300005530	Ga0070679_100072110	Ga0070679_1000721104	116
276	3300005530	Ga0070679_100078303	Ga0070679_1000783034	116
277	3300005535	Ga0070684_100064797	Ga0070684_1000647973	116
278	3300005535	Ga0070684_100201828	Ga0070684_1002018283	116
279	3300005535	Ga0070684_101925879	Ga0070684_1019258791	116
280	3300005545	Ga0070695_101083295	Ga0070695_1010832951	116
281	3300005547	Ga0070693_100784384	Ga0070693_1007843841	116
282	3300005563	Ga0068855_100248344	Ga0068855_1002483442	116
283	3300005563	Ga0068855_100294375	Ga0068855_1002943753	116
284	3300005564	Ga0070664_100174483	Ga0070664_1001744833	116
285	3300005614	Ga0068856_100145685	Ga0068856_1001456852	116
286	3300005614	Ga0068856_100632822	Ga0068856_1006328222	116
287	3300005614	Ga0068856_100843316	Ga0068856_1008433161	116
288	3300005615	Ga0070702_100352085	Ga0070702_1003520852	116
289	3300005616	Ga0068852_100097658	Ga0068852_1000976582	116
290	3300005841	Ga0068863_100412618	Ga0068863_1004126183	116
291	3300005843	Ga0068860_101537212	Ga0068860_1015372122	116
292	3300006028	Ga0070717_10007800	Ga0070717_100078009	116
293	3300006028	Ga0070717_10056185	Ga0070717_100561854	116
294	3300006163	Ga0070715_10069226	Ga0070715_100692263	116
295	3300006173	Ga0070716_100389974	Ga0070716_1003899742	116
296	3300006173	Ga0070716_101579568	Ga0070716_1015795681	116
297	3300006175	Ga0070712_100016542	Ga0070712_1000165422	116
298	3300006175	Ga0070712_100210879	Ga0070712_1002108791	116
299	3300006175	Ga0070712_100470114	Ga0070712_1004701141	116
300	3300006175	Ga0070712_100576985	Ga0070712_1005769851	116
301	3300006852	Ga0075433_10624501	Ga0075433_106245011	116
302	3300006871	Ga0075434_100157187	Ga0075434_1001571873	116
303	3300009093	Ga0105240_10490071	Ga0105240_104900712	116
304	3300009093	Ga0105240_12268068	Ga0105240_122680682	116
305	3300009098	Ga0105245_10079742	Ga0105245_100797424	116
306	3300009174	Ga0105241_10727162	Ga0105241_107271622	116
307	3300009545	Ga0105237_10466644	Ga0105237_104666442	116
308	3300009551	Ga0105238_10450213	Ga0105238_104502132	116
309	3300009551	Ga0105238_10685846	Ga0105238_106858462	116
310	3300009553	Ga0105249_10988960	Ga0105249_109889602	116
311	3300010375	Ga0105239_10452822	Ga0105239_104528222	116
312	3300010375	Ga0105239_11977906	Ga0105239_119779062	116
313	3300013102	Ga0157371_10563760	Ga0157371_105637602	116
314	3300013105	Ga0157369_10954431	Ga0157369_109544312	116
315	3300013296	Ga0157374_10091287	Ga0157374_100912872	116
316	3300013297	Ga0157378_11332222	Ga0157378_113322222	116
317	3300013307	Ga0157372_10162489	Ga0157372_101624892	116
318	3300013307	Ga0157372_10314130	Ga0157372_103141302	116
319	3300013307	Ga0157372_11557328	Ga0157372_115573281	116
320	3300014497	Ga0182008_10372733	Ga0182008_103727332	116
321	3300014497	Ga0182008_10956873	Ga0182008_109568732	116
322	3300014969	Ga0157376_10432611	Ga0157376_104326112	116
323	3300020069	Ga0197907_10394550	Ga0197907_103945501	116
324	3300020069	Ga0197907_10497667	Ga0197907_104976671	116
325	3300020070	Ga0206356_10802283	Ga0206356_108022831	116
326	3300020070	Ga0206356_10989153	Ga0206356_109891532	116
327	3300020075	Ga0206349_1852444	Ga0206349_18524442	116
328	3300020080	Ga0206350_11436359	Ga0206350_114363591	116
329	3300020081	Ga0206354_11244338	Ga0206354_112443382	116
330	3300020082	Ga0206353_11954450	Ga0206353_119544504	116
331	3300022467	Ga0224712_10025428	Ga0224712_100254281	116
332	3300022467	Ga0224712_10197100	Ga0224712_101971002	116
333	3300022467	Ga0224712_10298936	Ga0224712_102989362	116
334	3300025898	Ga0207692_10005324	Ga0207692_100053242	116
335	3300025898	Ga0207692_10068332	Ga0207692_100683324	116
336	3300025905	Ga0207685_10067479	Ga0207685_100674793	116
337	3300025906	Ga0207699_10017684	Ga0207699_100176844	116
338	3300025906	Ga0207699_10995300	Ga0207699_109953002	116
339	3300025909	Ga0207705_10079078	Ga0207705_100790782	116
340	3300025912	Ga0207707_10158917	Ga0207707_101589172	116
341	3300025912	Ga0207707_10389603	Ga0207707_103896032	116
342	3300025913	Ga0207695_10252136	Ga0207695_102521362	116
343	3300025914	Ga0207671_10027756	Ga0207671_100277564	116
344	3300025914	Ga0207671_10521592	Ga0207671_105215922	116
345	3300025915	Ga0207693_10000282	Ga0207693_1000028225	116
346	3300025916	Ga0207663_10717703	Ga0207663_107177032	116
347	3300025917	Ga0207660_10319830	Ga0207660_103198303	116
348	3300025917	Ga0207660_10724895	Ga0207660_107248952	116
349	3300025919	Ga0207657_10000988	Ga0207657_100009886	116
350	3300025919	Ga0207657_11178567	Ga0207657_111785671	116
351	3300025920	Ga0207649_11187328	Ga0207649_111873281	116
352	3300025921	Ga0207652_10425497	Ga0207652_104254972	116
353	3300025921	Ga0207652_11050150	Ga0207652_110501502	116
354	3300025922	Ga0207646_11094956	Ga0207646_110949562	116
355	3300025924	Ga0207694_10705017	Ga0207694_107050172	116
356	3300025928	Ga0207700_10079100	Ga0207700_100791004	116
357	3300025929	Ga0207664_10007295	Ga0207664_100072957	116
358	3300025929	Ga0207664_10035721	Ga0207664_100357214	116
359	3300025929	Ga0207664_10190897	Ga0207664_101908972	116
360	3300025931	Ga0207644_10406528	Ga0207644_104065281	116
361	3300025932	Ga0207690_10053245	Ga0207690_100532452	116
362	3300025932	Ga0207690_10435728	Ga0207690_104357282	116
363	3300025939	Ga0207665_10050605	Ga0207665_100506054	116
364	3300025939	Ga0207665_10716247	Ga0207665_107162472	116
365	3300025944	Ga0207661_10074555	Ga0207661_100745552	116
366	3300025949	Ga0207667_10458885	Ga0207667_104588851	116
367	3300025961	Ga0207712_10718254	Ga0207712_107182542	116
368	3300026078	Ga0207702_10116059	Ga0207702_101160594	116
369	3300026078	Ga0207702_10633061	Ga0207702_106330612	116
370	3300026142	Ga0207698_10207099	Ga0207698_102070994	116
371	3300035083	Ga0373926_0024316	Ga0373926_0024316_877_1227	116
372	3300035111	Ga0373923_0185933	Ga0373923_0185933_68_418	116
373	3300035113	Ga0373936_0093672	Ga0373936_0093672_750_1100	116
374	3300035116	Ga0373945_0153433	Ga0373945_0153433_198_551	116
375	3300035119	Ga0373956_0110362	Ga0373956_0110362_863_1213	116
376	3300035170	Ga0373943_0004768	Ga0373943_0004768_5753_6103	116
377	3300035170	Ga0373943_0558916	Ga0373943_0558916_259_612	116
378	3300035171	Ga0373946_0050098	Ga0373946_0050098_244_594	116
379	3300035410	Ga0373924_0427892	Ga0373924_0427892_56_406	116
380	3300035692	Ga0373935_0387249	Ga0373935_0387249_600_950	116
381	3300035725	Ga0373947_0000371	Ga0373947_0000371_16117_16467	116
382	3300036401	Ga0373937_0000725	Ga0373937_0000725_3868_4218	116
383	3300037068	Ga0373925_0001462	Ga0373925_0001462_10062_10412	116
384	3300041443	Ga0451789_0943147	Ga0451789_0943147_396_746	116
385	3300044658	Ga0466972_0049299	Ga0466972_0049299_253_606	116
386	3300044694	Ga0466963_0005276	Ga0466963_0005276_1220_1570	116
387	3300044694	Ga0466963_0012870	Ga0466963_0012870_4657_5007	116
388	3300044694	Ga0466963_0013692	Ga0466963_0013692_4148_4501	116
389	3300044694	Ga0466963_0019443	Ga0466963_0019443_3058_3408	116
390	3300044694	Ga0466963_0035681	Ga0466963_0035681_637_987	116
391	3300044694	Ga0466963_0103188	Ga0466963_0103188_541_891	116
392	3300044694	Ga0466963_0390204	Ga0466963_0390204_65_415	116
393	3300044694	Ga0466963_0526818	Ga0466963_0526818_20_370	116
394	3300044694	Ga0466963_0913593	Ga0466963_0913593_239_589	116
395	3300044706	Ga0466964_0003428	Ga0466964_0003428_213_563	116
396	3300044706	Ga0466964_0006069	Ga0466964_0006069_4118_4471	116
397	3300044706	Ga0466964_0051181	Ga0466964_0051181_1064_1441	116
398	3300044719	Ga0466971_0063321	Ga0466971_0063321_870_1223	116
399	3300044719	Ga0466971_0081435	Ga0466971_0081435_1097_1450	116
400	3300044719	Ga0466971_0344630	Ga0466971_0344630_327_677	116
401	3300044735	Ga0466968_0010565	Ga0466968_0010565_2688_3041	116
402	3300044735	Ga0466968_0037625	Ga0466968_0037625_1184_1534	116
403	3300044735	Ga0466968_0160200	Ga0466968_0160200_362_715	116
404	3300044735	Ga0466968_0327472	Ga0466968_0327472_231_581	116
405	3300044765	Ga0466970_0038292	Ga0466970_0038292_2165_2515	116
406	3300044842	Ga0466957_0005373	Ga0466957_0005373_5710_6060	116
407	3300044842	Ga0466957_0012050	Ga0466957_0012050_918_1271	116
408	3300044842	Ga0466957_0325143	Ga0466957_0325143_46_396	116
409	3300044842	Ga0466957_1301988	Ga0466957_1301988_71_421	116
410	3300044901	Ga0466960_0061333	Ga0466960_0061333_559_909	116
411	3300045836	Ga0466958_0010780	Ga0466958_0010780_1097_1450	116
412	3300045836	Ga0466958_0098786	Ga0466958_0098786_218_568	116
413	3300045836	Ga0466958_0106069	Ga0466958_0106069_428_778	116
414	3300045836	Ga0466958_0198218	Ga0466958_0198218_25_378	116
415	3300045976	Ga0466967_0039568	Ga0466967_0039568_2912_3262	116
416	3300045976	Ga0466967_0066834	Ga0466967_0066834_2688_3038	116
417	3300045976	Ga0466967_0076521	Ga0466967_0076521_406_756	116
418	3300045976	Ga0466967_0275727	Ga0466967_0275727_842_1192	116
419	3300045976	Ga0466967_0449437	Ga0466967_0449437_834_1184	116
420	3300046454	Ga0495592_0000050	Ga0495592_0000050_45768_46118	116
421	3300046454	Ga0495592_0140719	Ga0495592_0140719_956_1306	116
422	3300046455	Ga0495603_0295877	Ga0495603_0295877_86_439	116
423	3300046462	Ga0495651_0000028	Ga0495651_0000028_52034_52384	116
424	3300046463	Ga0495653_0001289	Ga0495653_0001289_17966_18316	116
425	3300046463	Ga0495653_0005665	Ga0495653_0005665_3651_4001	116
426	3300046463	Ga0495653_0838902	Ga0495653_0838902_126_476	116
427	3300046472	Ga0495580_0004702	Ga0495580_0004702_1848_2198	116
428	3300046473	Ga0495582_0003512	Ga0495582_0003512_64_414	116
429	3300046475	Ga0495639_0000481	Ga0495639_0000481_10090_10440	116
430	3300046477	Ga0495664_0006065	Ga0495664_0006065_5107_5457	116
431	3300046477	Ga0495664_0164078	Ga0495664_0164078_756_1106	116
432	3300046477	Ga0495664_0248175	Ga0495664_0248175_645_995	116
433	3300046477	Ga0495664_0547795	Ga0495664_0547795_246_596	116
434	3300046511	Ga0495608_0002062	Ga0495608_0002062_2639_2989	116
435	3300046511	Ga0495608_0048015	Ga0495608_0048015_2382_2732	116
436	3300046514	Ga0495618_0001024	Ga0495618_0001024_967_1317	116
437	3300046514	Ga0495618_0051562	Ga0495618_0051562_1101_1451	116
438	3300046514	Ga0495618_0130561	Ga0495618_0130561_142_492	116
439	3300046516	Ga0495628_0000060	Ga0495628_0000060_44278_44628	116
440	3300046516	Ga0495628_0321985	Ga0495628_0321985_174_524	116
441	3300046516	Ga0495628_0354432	Ga0495628_0354432_516_866	116
442	3300046517	Ga0495630_0000995	Ga0495630_0000995_8475_8825	116
443	3300046517	Ga0495630_0101997	Ga0495630_0101997_1321_1671	116
444	3300046526	Ga0495666_0000688	Ga0495666_0000688_750_1100	116
445	3300046529	Ga0495652_0000969	Ga0495652_0000969_24312_24662	116
446	3300046529	Ga0495652_0008136	Ga0495652_0008136_4064_4414	116
447	3300046531	Ga0495665_0004703	Ga0495665_0004703_750_1100	116
448	3300046536	Ga0495587_0000062	Ga0495587_0000062_38424_38774	116
449	3300046543	Ga0495645_0000207	Ga0495645_0000207_24085_24435	116
450	3300046559	Ga0495667_0009415	Ga0495667_0009415_5550_5900	116
451	3300046559	Ga0495667_0694724	Ga0495667_0694724_67_417	116
452	3300046642	Ga0495634_0024255	Ga0495634_0024255_3859_4209	116
453	3300046642	Ga0495634_0038991	Ga0495634_0038991_112_462	116
454	3300046642	Ga0495634_0221227	Ga0495634_0221227_360_710	116
455	3300046648	Ga0495611_0025819	Ga0495611_0025819_1670_2023	116
456	3300046663	Ga0495635_0009343	Ga0495635_0009343_3246_3596	116
457	3300046663	Ga0495635_0191008	Ga0495635_0191008_977_1327	116
458	3300046663	Ga0495635_0678416	Ga0495635_0678416_250_600	116
459	3300046674	Ga0495588_0607589	Ga0495588_0607589_161_511	116
460	3300046675	Ga0495657_0014967	Ga0495657_0014967_130_480	116
461	3300046678	Ga0495599_0000202	Ga0495599_0000202_7671_8021	116
462	3300046679	Ga0495623_0000230	Ga0495623_0000230_25713_26063	116
463	3300046680	Ga0495646_0017844	Ga0495646_0017844_4079_4429	116
464	3300046681	Ga0495647_0000670	Ga0495647_0000670_1261_1611	116
465	3300046683	Ga0495658_0782852	Ga0495658_0782852_148_498	116
466	3300046689	Ga0495613_0005595	Ga0495613_0005595_22_372	116
467	3300046689	Ga0495613_0028992	Ga0495613_0028992_87_437	116
468	3300046690	Ga0495624_0126911	Ga0495624_0126911_299_652	116
469	3300046809	Ga0495600_0008576	Ga0495600_0008576_5397_5747	116
470	3300046809	Ga0495600_0172045	Ga0495600_0172045_954_1304	116
471	3300047315	Ga0495581_0017948	Ga0495581_0017948_3731_4081	116
472	3300047315	Ga0495581_0236512	Ga0495581_0236512_707_1057	116
473	3300047317	Ga0495604_0000262	Ga0495604_0000262_1081_1431	116
474	3300047319	Ga0495674_0147744	Ga0495674_0147744_1336_1686	116
475	3300047319	Ga0495674_0476548	Ga0495674_0476548_636_986	116
476	3300047319	Ga0495674_0937249	Ga0495674_0937249_175_525	116
477	3300047321	Ga0495676_0019630	Ga0495676_0019630_4708_5058	116
478	3300047321	Ga0495676_0032491	Ga0495676_0032491_2980_3333	116
479	3300047321	Ga0495676_0400808	Ga0495676_0400808_298_648	116
480	3300047322	Ga0495680_0020304	Ga0495680_0020304_5023_5373	116
481	3300047322	Ga0495680_0034009	Ga0495680_0034009_1533_1883	116
482	3300047444	Ga0495675_0000020	Ga0495675_0000020_65863_66213	116
483	3300047471	Ga0495684_0012195	Ga0495684_0012195_4908_5258	116
484	3300047471	Ga0495684_0016556	Ga0495684_0016556_1214_1564	116
485	3300047471	Ga0495684_0039015	Ga0495684_0039015_1886_2236	116
486	3300047673	Ga0495593_0001863	Ga0495593_0001863_42_392	116
487	3300048088	Ga0495602_0000222	Ga0495602_0000222_12369_12719	116
488	3300048089	Ga0495614_0001717	Ga0495614_0001717_3570_3920	116
489	3300048903	Ga0496100_0206156	Ga0496100_0206156_282_635	116
490	3300048904	Ga0496101_0515753	Ga0496101_0515753_304_654	116
491	3300048905	Ga0496102_1141931	Ga0496102_1141931_57_410	116
492	3300048905	Ga0496102_1283529	Ga0496102_1283529_66_416	116
493	3300048906	Ga0496103_0018723	Ga0496103_0018723_1858_2208	116
494	3300048908	Ga0496105_0453627	Ga0496105_0453627_77_430	116
495	3300048909	Ga0496106_0259759	Ga0496106_0259759_830_1180	116
496	3300048909	Ga0496106_0598504	Ga0496106_0598504_456_809	116
497	3300048910	Ga0496107_0076515	Ga0496107_0076515_1487_1840	116
498	3300048911	Ga0496108_0034402	Ga0496108_0034402_1249_1602	116
499	3300048911	Ga0496108_0521562	Ga0496108_0521562_299_649	116
500	3300048912	Ga0496109_0010667	Ga0496109_0010667_4096_4449	116
501	3300048913	Ga0496110_0525975	Ga0496110_0525975_319_672	116
502	3300048914	Ga0496111_0096509	Ga0496111_0096509_969_1322	116
503	3300048914	Ga0496111_0279040	Ga0496111_0279040_439_789	116
504	3300048914	Ga0496111_0999759	Ga0496111_0999759_75_425	116
505	3300048915	Ga0496112_0106028	Ga0496112_0106028_942_1292	116
506	3300048915	Ga0496112_0655954	Ga0496112_0655954_477_830	116
507	3300048915	Ga0496112_0914666	Ga0496112_0914666_118_468	116
508	3300048916	Ga0496113_0131356	Ga0496113_0131356_942_1292	116
509	3300048918	Ga0496115_0061199	Ga0496115_0061199_1476_1826	116
510	3300048918	Ga0496115_0079276	Ga0496115_0079276_2141_2491	116
511	3300048918	Ga0496115_0209041	Ga0496115_0209041_220_573	116
512	3300049583	Ga0501067_0337534	Ga0501067_0337534_415_768	116
513	3300050512	nmdc:mga0n895_25551_c1	nmdc:mga0n895_25551_c1_2807_3160	116
514	3300050515	nmdc:mga0a205_95152_c1	nmdc:mga0a205_95152_c1_488_841	116
515	3300053077	Ga0495601_0000218	Ga0495601_0000218_2382_2732	116
516	3300053077	Ga0495601_0005907	Ga0495601_0005907_522_872	116
517	3300053077	Ga0495601_0158768	Ga0495601_0158768_51_401	116
518	3300053078	Ga0495612_0016785	Ga0495612_0016785_311_661	116
519	3300053078	Ga0495612_0308191	Ga0495612_0308191_273_623	116
520	3300053084	Ga0495595_0063170	Ga0495595_0063170_1331_1681	116
521	3300053084	Ga0495595_0124640	Ga0495595_0124640_80_430	116
522	3300053084	Ga0495595_0287766	Ga0495595_0287766_72_422	116
523	3300053085	Ga0495619_0001137	Ga0495619_0001137_12492_12842	116
524	3300053085	Ga0495619_0032960	Ga0495619_0032960_280_630	116
525	3300053085	Ga0495619_0524733	Ga0495619_0524733_72_422	116
526	3300053094	Ga0500566_0237195	Ga0500566_0237195_84_434	116
527	3300061719	Ga0466962_0020166	Ga0466962_0020166_2743_3096	116
528	3300061719	Ga0466962_0060040	Ga0466962_0060040_846_1199	116
529	3300061719	Ga0466962_0131907	Ga0466962_0131907_435_785	116

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6vr2-assembly1.cif.gz_B	aminoglycoside n-2'-acetyltransferase-ia [aac(2')-ia] in complex with acetylated-tobramycin and coa	0.7683	41	114
4zbg-assembly1.cif.gz_A	crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa	0.7233	41	115
1s60-assembly1.cif.gz_A-2	aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2)	0.6949	37	115
5vrv-assembly1.cif.gz_A	2.05 angstrom resolution crystal structure of c-terminal domain (duf2156) of putative lysylphosphatidylglycerol synthetase from agrobacterium fabrum.	0.6893	39	110
2vi7-assembly2.cif.gz_C	structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa	0.6832	40	107

ID	Description	Score	Start	End	Superfamily
af_P9WKI9_1_164_3.30.540.10	Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1	0.8502	68	81	3.30.540.10
af_Q869K3_5_181_3.30.540.10	Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1	0.8366	68	81	3.30.540.10
af_P39368_4_174_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.7481	41	115	3.40.630.30
af_Q9LTQ0_232_292_3.30.160.20	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;	0.7256	40	82	3.30.160.20
af_Q9VMG0_1_216_3.40.630.30	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT)	0.7249	41	115	3.40.630.30

ID	Description	Score	Start	End
AF-A0A538CYL1-F1-model_v4	GNAT family N-acetyltransferase	0.9631	36	113
AF-A0A7V9MF45-F1-model_v4	GNAT family N-acetyltransferase	0.9562	38	115
AF-A0A2W5Y2L7-F1-model_v4	Uncharacterized protein	0.955	45	111
AF-A0A7W1NHN9-F1-model_v4	deleted	0.949	35	113
AF-A0A660KY30-F1-model_v4	Uncharacterized protein	0.9435	41	115

Feature Viewer

pLDDT	pTM	Quality
88.22	0.63	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459841

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map