F459843

General Info

Members Datasets Scaffolds Average Seq Length
529 272 523 190

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0613744|Ga0466960_0613744_16_591
Length 186
Sequence MLARVNRPSYHHGDLRAVILGEAARLVAERGADGVSLRELARSAGVSHAAPAHHFTDRRGLFTALATQGFRLLAEALADARGHFTDAALAYVRFAIEHPGHYRVMFDRSLLDAADAELAAAEALSRGVATLRDPQARADPGAAQLAAWSLVHGFSMLWLNDAVNPDVKADDPMVTVERIAKMLFDE

Samples

Sample ID Description Type Environment
1 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
2 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
6 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.8
Nodule 0.19
Rhizoplane 11.72
Rhizosphere 69.57
Stem 0
Stem Tuber 0
Unclassified 4.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10016806 3300001990 Bacteria 2362
2 JGI24735J21928_10054162 3300002067 Bacteria 1156
3 JGI24749J21850_1007195 3300002076 Bacteria 1547
4 JGI24744J21845_10000674 3300002077 Bacteria 6251
5 JGI24034J26672_10016434 3300002239 Bacteria 1140
6 JGI24742J22300_10049594 3300002244 Bacteria 758
7 JGI24751J29686_10010461 3300002459 Bacteria 1912
8 Ga0055540_1000071 3300003792 Bacteria 117607
9 Ga0070676_10036315 3300005328 Bacteria 2839
10 Ga0070690_100024161 3300005330 Bacteria 3737
11 Ga0070677_10184515 3300005333 Bacteria 996
12 Ga0068869_100023810 3300005334 Bacteria 4236
13 Ga0070666_10152356 3300005335 Bacteria 1613
14 Ga0070666_10209351 3300005335 Bacteria 1373
15 Ga0070680_100544464 3300005336 Bacteria 995
16 Ga0068868_100000247 3300005338 Bacteria 36780
17 Ga0070689_100227933 3300005340 Bacteria 1531
18 Ga0070691_10013420 3300005341 Bacteria 3751
19 Ga0070691_10131087 3300005341 Bacteria 1271
20 Ga0070692_10047773 3300005345 Bacteria 2216
21 Ga0070668_100006741 3300005347 Bacteria 8511
22 Ga0070668_100069955 3300005347 Bacteria 2731
23 Ga0070668_100210071 3300005347 Bacteria 1601
24 Ga0070669_100021840 3300005353 Bacteria 4577
25 Ga0070669_100058808 3300005353 Bacteria 2822
26 Ga0070675_100240857 3300005354 Bacteria 1581
27 Ga0070671_100000923 3300005355 Bacteria 21454
28 Ga0070671_100196755 3300005355 Bacteria 1709
29 Ga0070671_100399464 3300005355 Bacteria 1176
30 Ga0070674_100001479 3300005356 Bacteria 12527
31 Ga0070674_100165420 3300005356 Bacteria 1682
32 Ga0070674_100277773 3300005356 Bacteria 1326
33 Ga0070673_100157963 3300005364 Bacteria 1926
34 Ga0070673_100313676 3300005364 Bacteria 1384
35 Ga0070659_100030907 3300005366 Bacteria 4146
36 Ga0070659_100043264 3300005366 Bacteria 3522
37 Ga0070667_100001027 3300005367 Bacteria 25488
38 Ga0070667_100008266 3300005367 Bacteria 8624
39 Ga0070667_100034855 3300005367 Bacteria 4213
40 Ga0070667_100117804 3300005367 Bacteria 2307
41 Ga0070667_100850216 3300005367 Bacteria 848
42 Ga0070667_101159425 3300005367 Bacteria 723
43 Ga0070709_10148882 3300005434 Bacteria 1616
44 Ga0070714_100245103 3300005435 Bacteria 1655
45 Ga0070710_10021801 3300005437 Bacteria 3344
46 Ga0070701_10000386 3300005438 Bacteria 14839
47 Ga0070701_10247538 3300005438 Bacteria 1075
48 Ga0070711_100051705 3300005439 Bacteria 2823
49 Ga0070711_100065413 3300005439 Bacteria 2543
50 Ga0070705_100005612 3300005440 Bacteria 6123
51 Ga0070705_100171216 3300005440 Bacteria 1462
52 Ga0070700_100420586 3300005441 Bacteria 1010
53 Ga0070694_100598641 3300005444 Bacteria 887
54 Ga0070663_100088531 3300005455 Bacteria 2289
55 Ga0070663_100174112 3300005455 Bacteria 1665
56 Ga0070663_100277301 3300005455 Bacteria 1335
57 Ga0070678_100016997 3300005456 Bacteria 4670
58 Ga0070678_100023341 3300005456 Bacteria 4121
59 Ga0070662_100019843 3300005457 Bacteria 4571
60 Ga0070662_100374657 3300005457 Bacteria 1170
61 Ga0070662_100875050 3300005457 Bacteria 766
62 Ga0068867_100018261 3300005459 Bacteria 4983
63 Ga0068867_100215706 3300005459 Bacteria 1544
64 Ga0068867_101071714 3300005459 Bacteria 734
65 Ga0070707_100524685 3300005468 Bacteria 1146
66 Ga0070697_100298024 3300005536 Bacteria 1386
67 Ga0068853_100001631 3300005539 Bacteria 16398
68 Ga0070672_100099142 3300005543 Bacteria 2361
69 Ga0070686_100425186 3300005544 Bacteria 1016
70 Ga0070695_100013704 3300005545 Bacteria 4874
71 Ga0070696_100009364 3300005546 Bacteria 6557
72 Ga0070696_100062644 3300005546 Bacteria 2604
73 Ga0070693_100098400 3300005547 Bacteria 1777
74 Ga0070665_100021205 3300005548 Bacteria 6532
75 Ga0070665_100107369 3300005548 Bacteria 2794
76 Ga0070665_100269785 3300005548 Bacteria 1703
77 Ga0070704_100003757 3300005549 Bacteria 8741
78 Ga0068855_100677716 3300005563 Bacteria 1105
79 Ga0068854_100047088 3300005578 Bacteria 3072
80 Ga0068854_100263236 3300005578 Bacteria 1381
81 Ga0070702_100002393 3300005615 Bacteria 8076
82 Ga0070702_100195079 3300005615 Bacteria 1336
83 Ga0070702_100591328 3300005615 Bacteria 830
84 Ga0068852_100130102 3300005616 Bacteria 2317
85 Ga0068859_100002325 3300005617 Bacteria 19318
86 Ga0068859_100229941 3300005617 Bacteria 1942
87 Ga0068864_100093578 3300005618 Bacteria 2655
88 Ga0068864_100414935 3300005618 Bacteria 1282
89 Ga0068864_101341715 3300005618 Bacteria 716
90 Ga0068866_10000253 3300005718 Bacteria 25012
91 Ga0068866_10066913 3300005718 Bacteria 1884
92 Ga0068861_100016600 3300005719 Bacteria 5212
93 Ga0068861_100372857 3300005719 Bacteria 1258
94 Ga0068861_100770304 3300005719 Bacteria 900
95 Ga0068863_100046189 3300005841 Bacteria 4133
96 Ga0068863_100611897 3300005841 Bacteria 1079
97 Ga0068858_100015971 3300005842 Bacteria 7051
98 Ga0068858_100208351 3300005842 Bacteria 1850
99 Ga0068858_100278901 3300005842 Bacteria 1591
100 Ga0068860_100003457 3300005843 Bacteria 16245
101 Ga0068860_100297519 3300005843 Bacteria 1580
102 Ga0068862_100002241 3300005844 Bacteria 17329
103 Ga0068862_100296463 3300005844 Bacteria 1486
104 Ga0081455_10091834 3300005937 Bacteria 2458
105 Ga0075365_10014960 3300006038 Bacteria 4680
106 Ga0075365_10021474 3300006038 Bacteria 4029
107 Ga0075365_10055957 3300006038 Bacteria 2621
108 Ga0075365_10121860 3300006038 Bacteria 1799
109 Ga0075363_100001910 3300006048 Bacteria 8247
110 Ga0075363_100008777 3300006048 Bacteria 4725
111 Ga0075363_100013277 3300006048 Bacteria 3987
112 Ga0075363_100029764 3300006048 Bacteria 2821
113 Ga0075363_100057782 3300006048 Bacteria 2083
114 Ga0075363_100063201 3300006048 Bacteria 1997
115 Ga0075363_100093085 3300006048 Bacteria 1661
116 Ga0075363_100325677 3300006048 Bacteria 894
117 Ga0075364_10002940 3300006051 Bacteria 9607
118 Ga0075364_10003555 3300006051 Bacteria 8873
119 Ga0075364_10004886 3300006051 Bacteria 7765
120 Ga0075364_10005466 3300006051 Bacteria 7386
121 Ga0075364_10027526 3300006051 Bacteria 3632
122 Ga0075364_10029027 3300006051 Bacteria 3545
123 Ga0075364_10041307 3300006051 Bacteria 2995
124 Ga0075364_10148247 3300006051 Bacteria 1580
125 Ga0070715_10033821 3300006163 Bacteria 2092
126 Ga0070716_100006495 3300006173 Bacteria 5714
127 Ga0070716_100009985 3300006173 Bacteria 4748
128 Ga0070712_100000630 3300006175 Bacteria 20763
129 Ga0070712_100010036 3300006175 Bacteria 5969
130 Ga0075362_10019583 3300006177 Bacteria 2817
131 Ga0075362_10034957 3300006177 Bacteria 2193
132 Ga0075367_10012728 3300006178 Bacteria 4499
133 Ga0075367_10044422 3300006178 Bacteria 2605
134 Ga0075367_10158220 3300006178 Bacteria 1408
135 Ga0075367_10412295 3300006178 Bacteria 855
136 Ga0075367_10493423 3300006178 Bacteria 777
137 Ga0075369_10000029 3300006186 Bacteria 39213
138 Ga0075369_10003831 3300006186 Bacteria 5516
139 Ga0075369_10015259 3300006186 Bacteria 3081
140 Ga0075369_10036929 3300006186 Bacteria 2080
141 Ga0075369_10065658 3300006186 Bacteria 1591
142 Ga0075369_10186922 3300006186 Bacteria 954
143 Ga0075369_10209419 3300006186 Bacteria 901
144 Ga0097621_100021985 3300006237 Bacteria 4944
145 Ga0075370_10008923 3300006353 Bacteria 5181
146 Ga0075370_10015782 3300006353 Bacteria 4052
147 Ga0075370_10054635 3300006353 Bacteria 2268
148 Ga0075370_10098182 3300006353 Bacteria 1694
149 Ga0068871_100030788 3300006358 Bacteria 4229
150 Ga0068871_100398198 3300006358 Bacteria 1226
151 Ga0075428_100015186 3300006844 Bacteria 8542
152 Ga0075430_100066825 3300006846 Bacteria 3019
153 Ga0075430_100089275 3300006846 Bacteria 2579
154 Ga0075431_100531261 3300006847 Bacteria 1165
155 Ga0068865_100007152 3300006881 Bacteria 6855
156 Ga0068865_100469822 3300006881 Bacteria 1043
157 Ga0068865_100947991 3300006881 Bacteria 751
158 Ga0097620_100002325 3300006931 Bacteria 19318
159 Ga0097620_100229951 3300006931 Bacteria 1942
160 Ga0105250_10033603 3300009092 Bacteria 2060
161 Ga0105250_10119224 3300009092 Bacteria 1084
162 Ga0111539_11205972 3300009094 Bacteria 879
163 Ga0111539_11487474 3300009094 Bacteria 785
164 Ga0105245_10066244 3300009098 Bacteria 3269
165 Ga0105245_10216136 3300009098 Bacteria 1847
166 Ga0105247_10001591 3300009101 Bacteria 16075
167 Ga0105247_10005195 3300009101 Bacteria 8231
168 Ga0105247_10456329 3300009101 Bacteria 922
169 Ga0105247_10665857 3300009101 Bacteria 779
170 Ga0114129_10034110 3300009147 Bacteria 7189
171 Ga0105243_10006202 3300009148 Bacteria 9246
172 Ga0105243_11766178 3300009148 Bacteria 649
173 Ga0105241_10029929 3300009174 Bacteria 4066
174 Ga0105241_10170691 3300009174 Bacteria 1796
175 Ga0105242_10021147 3300009176 Bacteria 5106
176 Ga0105242_10236828 3300009176 Bacteria 1639
177 Ga0105248_10068663 3300009177 Bacteria 3979
178 Ga0105237_10004429 3300009545 Bacteria 16276
179 Ga0105237_10059248 3300009545 Bacteria 3831
180 Ga0105238_11507965 3300009551 Bacteria 701
181 Ga0105249_10009395 3300009553 Bacteria 8556
182 Ga0105249_10417794 3300009553 Bacteria 1374
183 Ga0105249_10492954 3300009553 Bacteria 1269
184 Ga0099796_10026567 3300010159 Bacteria 1840
185 Ga0105239_10007880 3300010375 Bacteria 12176
186 Ga0105239_10532214 3300010375 Bacteria 1337
187 Ga0105246_10139703 3300011119 Bacteria 1820
188 Ga0157373_10345128 3300013100 Bacteria 1061
189 Ga0157371_10408788 3300013102 Bacteria 994
190 Ga0157369_10632832 3300013105 Bacteria 1104
191 Ga0157374_10007942 3300013296 Bacteria 9063
192 Ga0157374_10411134 3300013296 Bacteria 1351
193 Ga0157378_10002404 3300013297 Bacteria 16640
194 Ga0157378_10021567 3300013297 Bacteria 5665
195 Ga0163162_10275826 3300013306 Bacteria 1813
196 Ga0163162_10354110 3300013306 Bacteria 1601
197 Ga0163162_10640044 3300013306 Bacteria 1187
198 Ga0163162_11276480 3300013306 Bacteria 834
199 Ga0157372_10000917 3300013307 Bacteria 32072
200 Ga0157372_10316922 3300013307 Bacteria 1816
201 Ga0157375_10000573 3300013308 Bacteria 32942
202 Ga0157375_10213928 3300013308 Bacteria 2085
203 Ga0157375_10726657 3300013308 Bacteria 1145
204 Ga0163163_10146429 3300014325 Bacteria 2406
205 Ga0157380_10001337 3300014326 Bacteria 16040
206 Ga0157380_10813494 3300014326 Bacteria 953
207 Ga0157377_10020243 3300014745 Bacteria 3484
208 Ga0157377_10824267 3300014745 Bacteria 686
209 Ga0157379_10070948 3300014968 Bacteria 3117
210 Ga0157379_11277098 3300014968 Bacteria 708
211 Ga0157376_10439966 3300014969 Bacteria 1269
212 Ga0157376_10713664 3300014969 Bacteria 1009
213 Ga0163161_10009207 3300017792 Bacteria 6828
214 Ga0163161_10222222 3300017792 Bacteria 1463
215 Ga0209051_1000033 3300025303 Bacteria 380540
216 Ga0207692_10005720 3300025898 Bacteria 4998
217 Ga0207642_10000191 3300025899 Bacteria 17844
218 Ga0207710_10000350 3300025900 Bacteria 33273
219 Ga0207710_10394020 3300025900 Bacteria 710
220 Ga0207688_10003159 3300025901 Bacteria 8988
221 Ga0207680_10086354 3300025903 Bacteria 1984
222 Ga0207647_10018984 3300025904 Bacteria 4632
223 Ga0207647_10169355 3300025904 Bacteria 1272
224 Ga0207685_10118305 3300025905 Bacteria 1159
225 Ga0207645_10027579 3300025907 Bacteria 3666
226 Ga0207643_10033643 3300025908 Bacteria 2869
227 Ga0207654_10109669 3300025911 Bacteria 1715
228 Ga0207671_10009509 3300025914 Bacteria 8120
229 Ga0207671_10012463 3300025914 Bacteria 6832
230 Ga0207671_10191419 3300025914 Bacteria 1595
231 Ga0207693_10000197 3300025915 Bacteria 54675
232 Ga0207693_10000771 3300025915 Bacteria 28766
233 Ga0207663_10001796 3300025916 Bacteria 10120
234 Ga0207657_10483760 3300025919 Bacteria 970
235 Ga0207646_10646109 3300025922 Bacteria 948
236 Ga0207659_10193259 3300025926 Bacteria 1621
237 Ga0207700_10060412 3300025928 Bacteria 2871
238 Ga0207664_10274519 3300025929 Bacteria 1478
239 Ga0207644_10043133 3300025931 Bacteria 3200
240 Ga0207644_10477585 3300025931 Bacteria 1026
241 Ga0207690_10052314 3300025932 Bacteria 2735
242 Ga0207690_10060667 3300025932 Bacteria 2568
243 Ga0207706_10013062 3300025933 Bacteria 7557
244 Ga0207706_10054084 3300025933 Bacteria 3543
245 Ga0207706_10257455 3300025933 Bacteria 1524
246 Ga0207706_10861460 3300025933 Bacteria 767
247 Ga0207686_10015647 3300025934 Bacteria 4244
248 Ga0207709_10087674 3300025935 Bacteria 2024
249 Ga0207669_10004626 3300025937 Bacteria 6076
250 Ga0207669_10072386 3300025937 Bacteria 2170
251 Ga0207704_10000448 3300025938 Bacteria 18392
252 Ga0207704_10942308 3300025938 Bacteria 728
253 Ga0207665_10002506 3300025939 Bacteria 12363
254 Ga0207665_10008287 3300025939 Bacteria 6862
255 Ga0207691_10127428 3300025940 Bacteria 2251
256 Ga0207691_10985942 3300025940 Bacteria 703
257 Ga0207711_10048064 3300025941 Bacteria 3650
258 Ga0207711_10336748 3300025941 Bacteria 1396
259 Ga0207689_10009089 3300025942 Bacteria 8603
260 Ga0207689_10069905 3300025942 Bacteria 2884
261 Ga0207667_10021416 3300025949 Bacteria 7164
262 Ga0207667_10504168 3300025949 Bacteria 1227
263 Ga0207651_10236280 3300025960 Bacteria 1487
264 Ga0207712_10010767 3300025961 Bacteria 5814
265 Ga0207712_10309859 3300025961 Bacteria 1299
266 Ga0207712_10635438 3300025961 Bacteria 926
267 Ga0207668_10000838 3300025972 Bacteria 18580
268 Ga0207668_10001862 3300025972 Bacteria 12311
269 Ga0207668_10172380 3300025972 Bacteria 1698
270 Ga0207640_10098742 3300025981 Bacteria 2042
271 Ga0207640_10100082 3300025981 Bacteria 2030
272 Ga0207658_10001213 3300025986 Bacteria 20454
273 Ga0207658_10002007 3300025986 Bacteria 15172
274 Ga0207658_10071799 3300025986 Bacteria 2622
275 Ga0207658_10577108 3300025986 Bacteria 1008
276 Ga0207677_10019286 3300026023 Bacteria 4116
277 Ga0207677_10473708 3300026023 Bacteria 1077
278 Ga0207703_10089322 3300026035 Bacteria 2588
279 Ga0207703_10180753 3300026035 Bacteria 1861
280 Ga0207639_10058617 3300026041 Bacteria 2963
281 Ga0207639_10074378 3300026041 Bacteria 2668
282 Ga0207678_10092312 3300026067 Bacteria 2588
283 Ga0207678_10352041 3300026067 Bacteria 1270
284 Ga0207708_10061648 3300026075 Bacteria 2864
285 Ga0207641_10192423 3300026088 Bacteria 1875
286 Ga0207641_10770994 3300026088 Bacteria 950
287 Ga0207648_10001458 3300026089 Bacteria 26029
288 Ga0207648_10037813 3300026089 Bacteria 4249
289 Ga0207676_10084097 3300026095 Bacteria 2593
290 Ga0207675_100213826 3300026118 Bacteria 1855
291 Ga0207675_100260165 3300026118 Bacteria 1681
292 Ga0207675_100376170 3300026118 Bacteria 1396
293 Ga0207683_10000996 3300026121 Bacteria 25929
294 Ga0207683_10203526 3300026121 Bacteria 1800
295 Ga0207683_11031634 3300026121 Bacteria 763
296 Ga0207698_10026087 3300026142 Bacteria 4129
297 Ga0268266_10022186 3300028379 Bacteria 5411
298 Ga0268266_10259443 3300028379 Bacteria 1610
299 Ga0268265_10008991 3300028380 Bacteria 6757
300 Ga0268264_10068754 3300028381 Bacteria 2994
301 Ga0268264_10112323 3300028381 Bacteria 2389
302 Ga0265327_10005208 3300031251 Bacteria 10976
303 Ga0307413_10545004 3300031824 Bacteria 940
304 Ga0307410_10408446 3300031852 Bacteria 1099
305 Ga0307406_10227077 3300031901 Bacteria 1391
306 Ga0307407_10150927 3300031903 Bacteria 1510
307 Ga0307407_10320971 3300031903 Bacteria 1087
308 Ga0307409_100048149 3300031995 Bacteria 3241
309 Ga0307409_100198582 3300031995 Bacteria 1792
310 Ga0307416_100024922 3300032002 Bacteria 4376
311 Ga0307416_100026378 3300032002 Bacteria 4281
312 Ga0307414_10099403 3300032004 Bacteria 2186
313 Ga0307415_100033433 3300032126 Bacteria 3338
314 Ga0373940_0157197 3300035088 Bacteria 728
315 Ga0373960_0029783 3300035121 Bacteria 1516
316 Ga0373960_0046488 3300035121 Bacteria 1274
317 Ga0373942_0110630 3300035207 Bacteria 849
318 Ga0373931_0013996 3300035691 Bacteria 3915
319 Ga0436365_1781365 3300039437 Bacteria 36167
320 Ga0436363_0132291 3300039450 Bacteria 2319
321 Ga0436363_1541626 3300039450 Bacteria 706
322 Ga0439461_0006924 3300041410 Bacteria 1990
323 Ga0439466_0019022 3300041411 Bacteria 2460
324 Ga0439465_0001890 3300041413 Bacteria 6858
325 Ga0439442_005512 3300042002 Bacteria 2530
326 Ga0439445_0055087 3300042004 Bacteria 1079
327 Ga0439434_0034004 3300042435 Bacteria 1556
328 Ga0466972_0013402 3300044658 Bacteria 4116
329 Ga0466972_0029543 3300044658 Bacteria 2699
330 Ga0466972_0032861 3300044658 Bacteria 2546
331 Ga0466972_0108762 3300044658 Bacteria 1310
332 Ga0466972_0218331 3300044658 Bacteria 892
333 Ga0466965_0005462 3300044683 Bacteria 5730
334 Ga0466965_0008336 3300044683 Bacteria 4793
335 Ga0466965_0022542 3300044683 Bacteria 3036
336 Ga0466965_0170010 3300044683 Bacteria 1146
337 Ga0466965_0193128 3300044683 Bacteria 1077
338 Ga0466966_0182702 3300044684 Bacteria 1272
339 Ga0466963_0404870 3300044694 Bacteria 962
340 Ga0466964_0214081 3300044706 Bacteria 932
341 Ga0466971_0041015 3300044719 Bacteria 2079
342 Ga0466968_0003285 3300044735 Bacteria 5960
343 Ga0466968_0014027 3300044735 Bacteria 3161
344 Ga0466968_0015206 3300044735 Bacteria 3047
345 Ga0466968_0026654 3300044735 Bacteria 2374
346 Ga0466968_0089099 3300044735 Bacteria 1365
347 Ga0466968_0269612 3300044735 Bacteria 812
348 Ga0466970_0010485 3300044765 Bacteria 4704
349 Ga0466970_0032671 3300044765 Bacteria 2749
350 Ga0466970_0082898 3300044765 Bacteria 1734
351 Ga0466970_0136593 3300044765 Bacteria 1349
352 Ga0466970_0312981 3300044765 Bacteria 887
353 Ga0466970_0417401 3300044765 Bacteria 767
354 Ga0466957_0006105 3300044842 Bacteria 6801
355 Ga0466957_0199021 3300044842 Bacteria 1315
356 Ga0466960_0000170 3300044901 Bacteria 22220
357 Ga0466960_0034568 3300044901 Bacteria 2356
358 Ga0466960_0289730 3300044901 Bacteria 920
359 Ga0466960_0613744 3300044901 Bacteria 647
360 Ga0466959_0029803 3300045049 Bacteria 4042
361 Ga0466959_0049160 3300045049 Bacteria 3098
362 Ga0466959_0088750 3300045049 Bacteria 2222
363 Ga0466958_0040633 3300045836 Bacteria 2795
364 Ga0466958_0053725 3300045836 Bacteria 2443
365 Ga0466967_0008716 3300045976 Bacteria 7468
366 Ga0466967_0024083 3300045976 Bacteria 4999
367 Ga0466967_0097833 3300045976 Bacteria 2679
368 Ga0466967_0488815 3300045976 Bacteria 1207
369 Ga0495629_0040272 3300046459 Bacteria 3287
370 Ga0495641_0027228 3300046461 Bacteria 2782
371 Ga0495582_0120795 3300046473 Bacteria 1476
372 Ga0495662_0075464 3300046476 Bacteria 1636
373 Ga0495606_0026353 3300046507 Bacteria 4145
374 Ga0495608_0283452 3300046511 Bacteria 1028
375 Ga0495630_0273459 3300046517 Bacteria 1291
376 Ga0495648_0018539 3300046524 Bacteria 4922
377 Ga0495654_0269469 3300046530 Bacteria 703
378 Ga0495665_0071847 3300046531 Bacteria 1822
379 Ga0495640_0021572 3300046533 Bacteria 4726
380 Ga0495658_0050303 3300046683 Bacteria 2357
381 Ga0495581_0039376 3300047315 Bacteria 2736
382 Ga0495604_0250973 3300047317 Bacteria 1206
383 Ga0495674_0143225 3300047319 Bacteria 2008
384 Ga0495672_0002524 3300047320 Bacteria 16717
385 Ga0495672_0296171 3300047320 Bacteria 768
386 Ga0495673_0001014 3300047469 Bacteria 24774
387 Ga0495684_0741904 3300047471 Bacteria 647
388 Ga0495593_0006211 3300047673 Bacteria 7024
389 Ga0496100_0000029 3300048903 Bacteria 110710
390 Ga0496100_0000780 3300048903 Bacteria 15181
391 Ga0496100_0001560 3300048903 Bacteria 11268
392 Ga0496100_0002719 3300048903 Bacteria 9042
393 Ga0496100_0217054 3300048903 Bacteria 1402
394 Ga0496101_0000015 3300048904 Bacteria 252368
395 Ga0496101_0000031 3300048904 Bacteria 195195
396 Ga0496101_0015234 3300048904 Bacteria 5176
397 Ga0496101_0051263 3300048904 Bacteria 2973
398 Ga0496102_0000065 3300048905 Bacteria 161370
399 Ga0496102_0002030 3300048905 Bacteria 17497
400 Ga0496102_0005978 3300048905 Bacteria 10367
401 Ga0496102_0016754 3300048905 Bacteria 6408
402 Ga0496102_0028265 3300048905 Bacteria 5008
403 Ga0496102_0055426 3300048905 Bacteria 3615
404 Ga0496102_0126813 3300048905 Bacteria 2386
405 Ga0496102_0206799 3300048905 Bacteria 1850
406 Ga0496102_0723573 3300048905 Bacteria 918
407 Ga0496103_0000048 3300048906 Bacteria 160911
408 Ga0496103_0003067 3300048906 Bacteria 10268
409 Ga0496103_0005902 3300048906 Bacteria 7318
410 Ga0496103_0128564 3300048906 Bacteria 1617
411 Ga0496103_0163170 3300048906 Bacteria 1429
412 Ga0496103_0215673 3300048906 Bacteria 1234
413 Ga0496104_0001343 3300048907 Bacteria 21285
414 Ga0496104_0015016 3300048907 Bacteria 7006
415 Ga0496105_0006560 3300048908 Bacteria 8952
416 Ga0496105_0068811 3300048908 Bacteria 2925
417 Ga0496105_0456931 3300048908 Bacteria 1007
418 Ga0496106_0000396 3300048909 Bacteria 31087
419 Ga0496106_0001046 3300048909 Bacteria 20352
420 Ga0496106_0018223 3300048909 Bacteria 5191
421 Ga0496106_0029597 3300048909 Bacteria 4082
422 Ga0496106_0131472 3300048909 Bacteria 1963
423 Ga0496107_0000330 3300048910 Bacteria 25647
424 Ga0496107_0005364 3300048910 Bacteria 8771
425 Ga0496107_0015942 3300048910 Bacteria 5272
426 Ga0496107_0725976 3300048910 Bacteria 730
427 Ga0496108_0001084 3300048911 Bacteria 21234
428 Ga0496108_0003464 3300048911 Bacteria 12661
429 Ga0496109_0000134 3300048912 Bacteria 75662
430 Ga0496109_0004328 3300048912 Bacteria 11860
431 Ga0496109_0098560 3300048912 Bacteria 2709
432 Ga0496109_0929347 3300048912 Bacteria 808
433 Ga0496110_0049126 3300048913 Bacteria 3699
434 Ga0496110_0136439 3300048913 Bacteria 2217
435 Ga0496110_0385935 3300048913 Bacteria 1276
436 Ga0496110_0977451 3300048913 Bacteria 754
437 Ga0496111_0057283 3300048914 Bacteria 2821
438 Ga0496111_0118958 3300048914 Bacteria 1951
439 Ga0496111_0330088 3300048914 Bacteria 1129
440 Ga0496112_0027671 3300048915 Bacteria 5468
441 Ga0496112_0034944 3300048915 Bacteria 4892
442 Ga0496112_0536910 3300048915 Bacteria 1104
443 Ga0496112_0914165 3300048915 Bacteria 799
444 Ga0496114_0001231 3300048917 Bacteria 19347
445 Ga0496114_0004867 3300048917 Bacteria 10462
446 Ga0496114_0006256 3300048917 Bacteria 9372
447 Ga0496114_0151301 3300048917 Bacteria 2013
448 Ga0496114_0627723 3300048917 Bacteria 946
449 Ga0496115_0002005 3300048918 Bacteria 14559
450 Ga0496115_0003450 3300048918 Bacteria 11356
451 Ga0496116_0000125 3300048919 Bacteria 160885
452 Ga0496117_0000111 3300048920 Bacteria 184570
453 Ga0496117_0063747 3300048920 Bacteria 2517
454 Ga0496118_0000083 3300048921 Bacteria 184570
455 Ga0496118_0076671 3300048921 Bacteria 2375
456 Ga0496119_0003439 3300048922 Bacteria 16441
457 Ga0496119_0044961 3300048922 Bacteria 2773
458 Ga0496119_0191432 3300048922 Bacteria 1065
459 Ga0496120_0034219 3300048923 Bacteria 3046
460 Ga0496121_0000004 3300048924 Bacteria 1139011
461 Ga0496121_0000728 3300048924 Bacteria 60874
462 Ga0496122_0000138 3300048925 Bacteria 169434
463 Ga0496123_0007235 3300048926 Bacteria 10535
464 Ga0496124_0000012 3300048927 Bacteria 512581
465 Ga0496125_0000003 3300048928 Bacteria 1189767
466 Ga0496126_0000001 3300048929 Bacteria 1139011
467 Ga0496126_0000220 3300048929 Bacteria 124547
468 Ga0496126_0348993 3300048929 Bacteria 1211
469 Ga0501032_0012850 3300049569 Bacteria 5968
470 Ga0501034_0008577 3300049571 Bacteria 10786
471 Ga0501036_0001872 3300049572 Bacteria 16318
472 Ga0501037_0000401 3300049573 Bacteria 36095
473 Ga0501038_0007683 3300049574 Bacteria 9941
474 Ga0501039_0003187 3300049575 Bacteria 12267
475 Ga0501043_0001795 3300049579 Bacteria 18430
476 Ga0501068_0092201 3300049584 Bacteria 1870
477 Ga0501070_0012220 3300049586 Bacteria 7244
478 Ga0501070_0348707 3300049586 Bacteria 1202
479 Ga0501072_0209050 3300049588 Bacteria 1555
480 Ga0501044_0005938 3300049823 Bacteria 13523
481 nmdc:mga03683_1900_c1 3300050489 Bacteria 5668
482 nmdc:mga03683_70853_c1 3300050489 Bacteria 1490
483 nmdc:mga03n38_1094_c1 3300050490 Bacteria 7480
484 nmdc:mga03n38_283494_c1 3300050490 Bacteria 885
485 nmdc:mga03n38_586191_c1 3300050490 Bacteria 634
486 nmdc:mga03n38_6617_c1 3300050490 Bacteria 4041
487 nmdc:mga03n38_78638_c1 3300050490 Bacteria 1544
488 nmdc:mga00v17_11258_c1 3300050491 Bacteria 4914
489 nmdc:mga00v17_2735_c1 3300050491 Bacteria 9051
490 nmdc:mga00v17_342650_c1 3300050491 Bacteria 972
491 nmdc:mga00v17_709_c1 3300050491 Bacteria 18242
492 nmdc:mga00v17_7262_c1 3300050491 Bacteria 5903
493 nmdc:mga00v17_7945_c1 3300050491 Bacteria 5687
494 nmdc:mga0yw44_115335_c1 3300050492 Bacteria 1725
495 nmdc:mga0yw44_143613_c1 3300050492 Bacteria 1552
496 nmdc:mga0yw44_39955_c1 3300050492 Bacteria 2784
497 nmdc:mga0yw44_52220_c1 3300050492 Bacteria 2477
498 nmdc:mga0yw44_97306_c1 3300050492 Bacteria 1869
499 nmdc:mga06z11_114332_c1 3300050494 Bacteria 1498
500 nmdc:mga06z11_4510_c1 3300050494 Bacteria 5484
501 nmdc:mga06z11_670627_c1 3300050494 Bacteria 631
502 nmdc:mga04h51_299473_c1 3300050495 Bacteria 655
503 nmdc:mga07m45_138702_c1 3300050496 Bacteria 1408
504 nmdc:mga07m45_29176_c1 3300050496 Bacteria 3049
505 nmdc:mga07m45_298627_c1 3300050496 Bacteria 937
506 nmdc:mga05p37_48789_c1 3300050507 Bacteria 5206
507 nmdc:mga0qj67_102738_c1 3300050509 Bacteria 2305
508 nmdc:mga0qj67_72636_c1 3300050509 Bacteria 2747
509 nmdc:mga06r32_595434_c1 3300050510 Bacteria 1077
510 nmdc:mga08y16_1016769_c1 3300050511 Bacteria 808
511 nmdc:mga0sz30_102937_c1 3300050516 Bacteria 1248
512 nmdc:mga0sz30_1098_c1 3300050516 Bacteria 9721
513 nmdc:mga0sz30_29439_c1 3300050516 Bacteria 2264
514 nmdc:mga0sz30_338_c1 3300050516 Bacteria 17911
515 Ga0495601_0413501 3300053077 Bacteria 874
516 Ga0500635_0012370 3300053080 Bacteria 2449
517 Ga0495619_0283714 3300053085 Bacteria 1147
518 Ga0500643_003652 3300053087 Bacteria 7271
519 Ga0500620_161830 3300053155 Bacteria 776
520 Ga0500633_0093077 3300053160 Bacteria 1103
521 Ga0466962_0099865 3300061719 Bacteria 1393
522 Ga0466962_0139135 3300061719 Bacteria 1175
523 Ga0466962_0212083 3300061719 Bacteria 947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0013402 Ga0466972_0013402_2907_3470 175
2 3300044683 Ga0466965_0005462 Ga0466965_0005462_2517_3080 175
3 3300044735 Ga0466968_0014027 Ga0466968_0014027_553_1116 175
4 3300044765 Ga0466970_0082898 Ga0466970_0082898_605_1168 175
5 3300044901 Ga0466960_0034568 Ga0466960_0034568_632_1195 175
6 3300045049 Ga0466959_0088750 Ga0466959_0088750_107_670 175
7 3300005367 Ga0070667_100001027 Ga0070667_10000102720 176
8 3300025986 Ga0207658_10002007 Ga0207658_1000200710 176
9 3300048905 Ga0496102_0016754 Ga0496102_0016754_4346_4909 176
10 3300048906 Ga0496103_0005902 Ga0496103_0005902_3396_3959 176
11 3300048921 Ga0496118_0076671 Ga0496118_0076671_1764_2327 176
12 3300048923 Ga0496120_0034219 Ga0496120_0034219_1763_2326 176
13 3300044901 Ga0466960_0613744 Ga0466960_0613744_16_591 179
14 iso_pu_bacteria 2738541264 2738667359 179
15 iso_pu_bacteria 2738541356 2739146202 179
16 iso_pu_bacteria 2842134933 2842139493 180
17 iso_pu_bacteria 2902792274 2902797187 180
18 iso_pu_bacteria 2929212328 2929217911 180
19 iso_pu_bacteria 2939582691 2939585136 180
20 3300049569 Ga0501032_0012850 Ga0501032_0012850_4844_5389 181
21 3300049571 Ga0501034_0008577 Ga0501034_0008577_3629_4174 181
22 3300049572 Ga0501036_0001872 Ga0501036_0001872_14856_15401 181
23 3300049573 Ga0501037_0000401 Ga0501037_0000401_4563_5108 181
24 3300049574 Ga0501038_0007683 Ga0501038_0007683_4880_5425 181
25 3300049575 Ga0501039_0003187 Ga0501039_0003187_8112_8657 181
26 3300049579 Ga0501043_0001795 Ga0501043_0001795_9853_10398 181
27 3300049584 Ga0501068_0092201 Ga0501068_0092201_991_1536 181
28 3300049586 Ga0501070_0012220 Ga0501070_0012220_3966_4511 181
29 3300049588 Ga0501072_0209050 Ga0501072_0209050_143_700 181
30 3300049823 Ga0501044_0005938 Ga0501044_0005938_8342_8887 181
31 3300003792 Ga0055540_1000071 Ga0055540_100007181 183
32 3300005335 Ga0070666_10152356 Ga0070666_101523562 183
33 3300005615 Ga0070702_100591328 Ga0070702_1005913281 183
34 3300005843 Ga0068860_100297519 Ga0068860_1002975192 183
35 3300009545 Ga0105237_10059248 Ga0105237_100592482 183
36 3300013308 Ga0157375_10726657 Ga0157375_107266571 183
37 3300025303 Ga0209051_1000033 Ga0209051_1000033314 183
38 3300025903 Ga0207680_10086354 Ga0207680_100863542 183
39 3300025914 Ga0207671_10012463 Ga0207671_100124634 183
40 3300028381 Ga0268264_10112323 Ga0268264_101123232 183
41 3300031251 Ga0265327_10005208 Ga0265327_100052087 183
42 3300044683 Ga0466965_0022542 Ga0466965_0022542_2254_2808 183
43 3300044683 Ga0466965_0170010 Ga0466965_0170010_203_754 183
44 3300044735 Ga0466968_0269612 Ga0466968_0269612_18_572 183
45 3300044765 Ga0466970_0417401 Ga0466970_0417401_11_562 183
46 3300045976 Ga0466967_0024083 Ga0466967_0024083_132_683 183
47 3300048903 Ga0496100_0000029 Ga0496100_0000029_105214_105777 183
48 3300048904 Ga0496101_0000015 Ga0496101_0000015_28921_29484 183
49 3300048909 Ga0496106_0000396 Ga0496106_0000396_485_1048 183
50 3300048910 Ga0496107_0000330 Ga0496107_0000330_5461_6024 183
51 3300048911 Ga0496108_0003464 Ga0496108_0003464_2817_3380 183
52 3300048912 Ga0496109_0000134 Ga0496109_0000134_18375_18938 183
53 3300048913 Ga0496110_0049126 Ga0496110_0049126_2626_3189 183
54 3300048913 Ga0496110_0977451 Ga0496110_0977451_172_735 183
55 3300048914 Ga0496111_0057283 Ga0496111_0057283_1062_1625 183
56 3300048917 Ga0496114_0004867 Ga0496114_0004867_3220_3783 183
57 3300048920 Ga0496117_0063747 Ga0496117_0063747_49_612 183
58 3300048922 Ga0496119_0003439 Ga0496119_0003439_13602_14165 183
59 3300048924 Ga0496121_0000004 Ga0496121_0000004_564051_564614 183
60 3300048925 Ga0496122_0000138 Ga0496122_0000138_66034_66597 183
61 3300048926 Ga0496123_0007235 Ga0496123_0007235_5031_5594 183
62 3300048927 Ga0496124_0000012 Ga0496124_0000012_288844_289407 183
63 3300048928 Ga0496125_0000003 Ga0496125_0000003_625154_625717 183
64 3300048929 Ga0496126_0000001 Ga0496126_0000001_564051_564614 183
65 3300053080 Ga0500635_0012370 Ga0500635_0012370_842_1396 183
66 3300001990 JGI24737J22298_10016806 JGI24737J22298_100168062 184
67 3300002067 JGI24735J21928_10054162 JGI24735J21928_100541622 184
68 3300002076 JGI24749J21850_1007195 JGI24749J21850_10071951 184
69 3300002077 JGI24744J21845_10000674 JGI24744J21845_100006743 184
70 3300002239 JGI24034J26672_10016434 JGI24034J26672_100164342 184
71 3300002244 JGI24742J22300_10049594 JGI24742J22300_100495941 184
72 3300002459 JGI24751J29686_10010461 JGI24751J29686_100104613 184
73 3300005328 Ga0070676_10036315 Ga0070676_100363153 184
74 3300005330 Ga0070690_100024161 Ga0070690_1000241613 184
75 3300005333 Ga0070677_10184515 Ga0070677_101845151 184
76 3300005334 Ga0068869_100023810 Ga0068869_1000238105 184
77 3300005335 Ga0070666_10209351 Ga0070666_102093511 184
78 3300005336 Ga0070680_100544464 Ga0070680_1005444642 184
79 3300005338 Ga0068868_100000247 Ga0068868_10000024720 184
80 3300005340 Ga0070689_100227933 Ga0070689_1002279332 184
81 3300005341 Ga0070691_10013420 Ga0070691_100134203 184
82 3300005341 Ga0070691_10131087 Ga0070691_101310873 184
83 3300005345 Ga0070692_10047773 Ga0070692_100477732 184
84 3300005347 Ga0070668_100006741 Ga0070668_1000067413 184
85 3300005347 Ga0070668_100069955 Ga0070668_1000699551 184
86 3300005347 Ga0070668_100210071 Ga0070668_1002100711 184
87 3300005353 Ga0070669_100021840 Ga0070669_1000218403 184
88 3300005353 Ga0070669_100058808 Ga0070669_1000588083 184
89 3300005354 Ga0070675_100240857 Ga0070675_1002408572 184
90 3300005355 Ga0070671_100000923 Ga0070671_1000009239 184
91 3300005355 Ga0070671_100196755 Ga0070671_1001967553 184
92 3300005355 Ga0070671_100399464 Ga0070671_1003994642 184
93 3300005356 Ga0070674_100001479 Ga0070674_1000014799 184
94 3300005356 Ga0070674_100165420 Ga0070674_1001654201 184
95 3300005356 Ga0070674_100277773 Ga0070674_1002777732 184
96 3300005364 Ga0070673_100157963 Ga0070673_1001579632 184
97 3300005364 Ga0070673_100313676 Ga0070673_1003136762 184
98 3300005366 Ga0070659_100030907 Ga0070659_1000309074 184
99 3300005366 Ga0070659_100043264 Ga0070659_1000432642 184
100 3300005367 Ga0070667_100008266 Ga0070667_1000082662 184
101 3300005367 Ga0070667_100034855 Ga0070667_1000348554 184
102 3300005367 Ga0070667_100117804 Ga0070667_1001178042 184
103 3300005367 Ga0070667_100850216 Ga0070667_1008502161 184
104 3300005367 Ga0070667_101159425 Ga0070667_1011594251 184
105 3300005434 Ga0070709_10148882 Ga0070709_101488821 184
106 3300005435 Ga0070714_100245103 Ga0070714_1002451033 184
107 3300005437 Ga0070710_10021801 Ga0070710_100218013 184
108 3300005438 Ga0070701_10000386 Ga0070701_100003862 184
109 3300005438 Ga0070701_10247538 Ga0070701_102475382 184
110 3300005439 Ga0070711_100051705 Ga0070711_1000517053 184
111 3300005439 Ga0070711_100065413 Ga0070711_1000654133 184
112 3300005440 Ga0070705_100005612 Ga0070705_1000056123 184
113 3300005440 Ga0070705_100171216 Ga0070705_1001712162 184
114 3300005441 Ga0070700_100420586 Ga0070700_1004205861 184
115 3300005444 Ga0070694_100598641 Ga0070694_1005986412 184
116 3300005455 Ga0070663_100088531 Ga0070663_1000885313 184
117 3300005455 Ga0070663_100174112 Ga0070663_1001741121 184
118 3300005455 Ga0070663_100277301 Ga0070663_1002773012 184
119 3300005456 Ga0070678_100016997 Ga0070678_1000169974 184
120 3300005456 Ga0070678_100023341 Ga0070678_1000233414 184
121 3300005457 Ga0070662_100019843 Ga0070662_1000198434 184
122 3300005457 Ga0070662_100374657 Ga0070662_1003746572 184
123 3300005457 Ga0070662_100875050 Ga0070662_1008750501 184
124 3300005459 Ga0068867_100018261 Ga0068867_1000182614 184
125 3300005459 Ga0068867_100215706 Ga0068867_1002157063 184
126 3300005459 Ga0068867_101071714 Ga0068867_1010717141 184
127 3300005468 Ga0070707_100524685 Ga0070707_1005246852 184
128 3300005536 Ga0070697_100298024 Ga0070697_1002980243 184
129 3300005539 Ga0068853_100001631 Ga0068853_10000163116 184
130 3300005543 Ga0070672_100099142 Ga0070672_1000991423 184
131 3300005544 Ga0070686_100425186 Ga0070686_1004251862 184
132 3300005545 Ga0070695_100013704 Ga0070695_1000137045 184
133 3300005546 Ga0070696_100009364 Ga0070696_1000093643 184
134 3300005546 Ga0070696_100062644 Ga0070696_1000626443 184
135 3300005547 Ga0070693_100098400 Ga0070693_1000984003 184
136 3300005548 Ga0070665_100021205 Ga0070665_1000212056 184
137 3300005548 Ga0070665_100107369 Ga0070665_1001073691 184
138 3300005548 Ga0070665_100269785 Ga0070665_1002697853 184
139 3300005549 Ga0070704_100003757 Ga0070704_1000037576 184
140 3300005563 Ga0068855_100677716 Ga0068855_1006777162 184
141 3300005578 Ga0068854_100047088 Ga0068854_1000470883 184
142 3300005578 Ga0068854_100263236 Ga0068854_1002632362 184
143 3300005615 Ga0070702_100002393 Ga0070702_1000023933 184
144 3300005615 Ga0070702_100195079 Ga0070702_1001950792 184
145 3300005616 Ga0068852_100130102 Ga0068852_1001301022 184
146 3300005617 Ga0068859_100002325 Ga0068859_1000023253 184
147 3300005617 Ga0068859_100229941 Ga0068859_1002299412 184
148 3300005618 Ga0068864_100093578 Ga0068864_1000935783 184
149 3300005618 Ga0068864_100414935 Ga0068864_1004149352 184
150 3300005618 Ga0068864_101341715 Ga0068864_1013417152 184
151 3300005718 Ga0068866_10000253 Ga0068866_100002539 184
152 3300005718 Ga0068866_10066913 Ga0068866_100669132 184
153 3300005719 Ga0068861_100016600 Ga0068861_1000166004 184
154 3300005719 Ga0068861_100372857 Ga0068861_1003728572 184
155 3300005719 Ga0068861_100770304 Ga0068861_1007703042 184
156 3300005841 Ga0068863_100046189 Ga0068863_1000461893 184
157 3300005841 Ga0068863_100611897 Ga0068863_1006118971 184
158 3300005842 Ga0068858_100015971 Ga0068858_1000159712 184
159 3300005842 Ga0068858_100208351 Ga0068858_1002083512 184
160 3300005842 Ga0068858_100278901 Ga0068858_1002789012 184
161 3300005843 Ga0068860_100003457 Ga0068860_1000034574 184
162 3300005844 Ga0068862_100002241 Ga0068862_10000224117 184
163 3300005844 Ga0068862_100296463 Ga0068862_1002964632 184
164 3300005937 Ga0081455_10091834 Ga0081455_100918343 184
165 3300006038 Ga0075365_10014960 Ga0075365_100149604 184
166 3300006038 Ga0075365_10021474 Ga0075365_100214742 184
167 3300006038 Ga0075365_10055957 Ga0075365_100559573 184
168 3300006038 Ga0075365_10121860 Ga0075365_101218602 184
169 3300006048 Ga0075363_100001910 Ga0075363_1000019109 184
170 3300006048 Ga0075363_100008777 Ga0075363_1000087774 184
171 3300006048 Ga0075363_100013277 Ga0075363_1000132772 184
172 3300006048 Ga0075363_100029764 Ga0075363_1000297643 184
173 3300006048 Ga0075363_100057782 Ga0075363_1000577821 184
174 3300006048 Ga0075363_100063201 Ga0075363_1000632012 184
175 3300006048 Ga0075363_100093085 Ga0075363_1000930851 184
176 3300006048 Ga0075363_100325677 Ga0075363_1003256772 184
177 3300006051 Ga0075364_10002940 Ga0075364_100029406 184
178 3300006051 Ga0075364_10003555 Ga0075364_100035554 184
179 3300006051 Ga0075364_10004886 Ga0075364_1000488610 184
180 3300006051 Ga0075364_10005466 Ga0075364_100054663 184
181 3300006051 Ga0075364_10027526 Ga0075364_100275262 184
182 3300006051 Ga0075364_10029027 Ga0075364_100290272 184
183 3300006051 Ga0075364_10041307 Ga0075364_100413073 184
184 3300006051 Ga0075364_10148247 Ga0075364_101482472 184
185 3300006163 Ga0070715_10033821 Ga0070715_100338213 184
186 3300006173 Ga0070716_100006495 Ga0070716_1000064953 184
187 3300006173 Ga0070716_100009985 Ga0070716_1000099854 184
188 3300006175 Ga0070712_100000630 Ga0070712_1000006305 184
189 3300006175 Ga0070712_100010036 Ga0070712_1000100364 184
190 3300006177 Ga0075362_10019583 Ga0075362_100195833 184
191 3300006177 Ga0075362_10034957 Ga0075362_100349572 184
192 3300006178 Ga0075367_10012728 Ga0075367_100127284 184
193 3300006178 Ga0075367_10044422 Ga0075367_100444222 184
194 3300006178 Ga0075367_10158220 Ga0075367_101582202 184
195 3300006178 Ga0075367_10412295 Ga0075367_104122952 184
196 3300006178 Ga0075367_10493423 Ga0075367_104934231 184
197 3300006186 Ga0075369_10000029 Ga0075369_1000002933 184
198 3300006186 Ga0075369_10003831 Ga0075369_100038313 184
199 3300006186 Ga0075369_10015259 Ga0075369_100152593 184
200 3300006186 Ga0075369_10036929 Ga0075369_100369292 184
201 3300006186 Ga0075369_10065658 Ga0075369_100656581 184
202 3300006186 Ga0075369_10186922 Ga0075369_101869222 184
203 3300006186 Ga0075369_10209419 Ga0075369_102094192 184
204 3300006237 Ga0097621_100021985 Ga0097621_1000219852 184
205 3300006353 Ga0075370_10008923 Ga0075370_100089232 184
206 3300006353 Ga0075370_10015782 Ga0075370_100157823 184
207 3300006353 Ga0075370_10054635 Ga0075370_100546353 184
208 3300006353 Ga0075370_10098182 Ga0075370_100981823 184
209 3300006358 Ga0068871_100030788 Ga0068871_1000307884 184
210 3300006358 Ga0068871_100398198 Ga0068871_1003981982 184
211 3300006844 Ga0075428_100015186 Ga0075428_1000151869 184
212 3300006846 Ga0075430_100066825 Ga0075430_1000668251 184
213 3300006846 Ga0075430_100089275 Ga0075430_1000892752 184
214 3300006847 Ga0075431_100531261 Ga0075431_1005312612 184
215 3300006881 Ga0068865_100007152 Ga0068865_1000071525 184
216 3300006881 Ga0068865_100469822 Ga0068865_1004698221 184
217 3300006881 Ga0068865_100947991 Ga0068865_1009479912 184
218 3300006931 Ga0097620_100002325 Ga0097620_1000023253 184
219 3300006931 Ga0097620_100229951 Ga0097620_1002299513 184
220 3300009092 Ga0105250_10033603 Ga0105250_100336033 184
221 3300009092 Ga0105250_10119224 Ga0105250_101192242 184
222 3300009094 Ga0111539_11205972 Ga0111539_112059722 184
223 3300009094 Ga0111539_11487474 Ga0111539_114874741 184
224 3300009098 Ga0105245_10066244 Ga0105245_100662443 184
225 3300009098 Ga0105245_10216136 Ga0105245_102161363 184
226 3300009101 Ga0105247_10001591 Ga0105247_1000159116 184
227 3300009101 Ga0105247_10005195 Ga0105247_100051958 184
228 3300009101 Ga0105247_10456329 Ga0105247_104563292 184
229 3300009101 Ga0105247_10665857 Ga0105247_106658571 184
230 3300009147 Ga0114129_10034110 Ga0114129_100341107 184
231 3300009148 Ga0105243_10006202 Ga0105243_100062024 184
232 3300009148 Ga0105243_11766178 Ga0105243_117661781 184
233 3300009174 Ga0105241_10029929 Ga0105241_100299292 184
234 3300009174 Ga0105241_10170691 Ga0105241_101706911 184
235 3300009176 Ga0105242_10021147 Ga0105242_100211476 184
236 3300009176 Ga0105242_10236828 Ga0105242_102368283 184
237 3300009177 Ga0105248_10068663 Ga0105248_100686633 184
238 3300009545 Ga0105237_10004429 Ga0105237_100044298 184
239 3300009551 Ga0105238_11507965 Ga0105238_115079651 184
240 3300009553 Ga0105249_10009395 Ga0105249_100093954 184
241 3300009553 Ga0105249_10417794 Ga0105249_104177942 184
242 3300009553 Ga0105249_10492954 Ga0105249_104929542 184
243 3300010159 Ga0099796_10026567 Ga0099796_100265672 184
244 3300010375 Ga0105239_10007880 Ga0105239_100078805 184
245 3300010375 Ga0105239_10532214 Ga0105239_105322142 184
246 3300011119 Ga0105246_10139703 Ga0105246_101397031 184
247 3300013100 Ga0157373_10345128 Ga0157373_103451282 184
248 3300013102 Ga0157371_10408788 Ga0157371_104087882 184
249 3300013105 Ga0157369_10632832 Ga0157369_106328322 184
250 3300013296 Ga0157374_10007942 Ga0157374_100079425 184
251 3300013296 Ga0157374_10411134 Ga0157374_104111342 184
252 3300013297 Ga0157378_10002404 Ga0157378_100024043 184
253 3300013297 Ga0157378_10021567 Ga0157378_100215673 184
254 3300013306 Ga0163162_10275826 Ga0163162_102758263 184
255 3300013306 Ga0163162_10354110 Ga0163162_103541101 184
256 3300013306 Ga0163162_10640044 Ga0163162_106400441 184
257 3300013306 Ga0163162_11276480 Ga0163162_112764801 184
258 3300013307 Ga0157372_10000917 Ga0157372_1000091716 184
259 3300013307 Ga0157372_10316922 Ga0157372_103169222 184
260 3300013308 Ga0157375_10000573 Ga0157375_1000057319 184
261 3300013308 Ga0157375_10213928 Ga0157375_102139282 184
262 3300014325 Ga0163163_10146429 Ga0163163_101464293 184
263 3300014326 Ga0157380_10001337 Ga0157380_1000133710 184
264 3300014326 Ga0157380_10813494 Ga0157380_108134942 184
265 3300014745 Ga0157377_10020243 Ga0157377_100202432 184
266 3300014745 Ga0157377_10824267 Ga0157377_108242671 184
267 3300014968 Ga0157379_10070948 Ga0157379_100709484 184
268 3300014968 Ga0157379_11277098 Ga0157379_112770981 184
269 3300014969 Ga0157376_10439966 Ga0157376_104399662 184
270 3300014969 Ga0157376_10713664 Ga0157376_107136642 184
271 3300017792 Ga0163161_10009207 Ga0163161_100092077 184
272 3300017792 Ga0163161_10222222 Ga0163161_102222222 184
273 3300025898 Ga0207692_10005720 Ga0207692_100057205 184
274 3300025899 Ga0207642_10000191 Ga0207642_1000019112 184
275 3300025900 Ga0207710_10000350 Ga0207710_1000035020 184
276 3300025900 Ga0207710_10394020 Ga0207710_103940201 184
277 3300025901 Ga0207688_10003159 Ga0207688_100031594 184
278 3300025904 Ga0207647_10018984 Ga0207647_100189843 184
279 3300025904 Ga0207647_10169355 Ga0207647_101693552 184
280 3300025905 Ga0207685_10118305 Ga0207685_101183052 184
281 3300025907 Ga0207645_10027579 Ga0207645_100275793 184
282 3300025908 Ga0207643_10033643 Ga0207643_100336432 184
283 3300025911 Ga0207654_10109669 Ga0207654_101096691 184
284 3300025914 Ga0207671_10009509 Ga0207671_100095097 184
285 3300025914 Ga0207671_10191419 Ga0207671_101914192 184
286 3300025915 Ga0207693_10000197 Ga0207693_1000019745 184
287 3300025915 Ga0207693_10000771 Ga0207693_1000077121 184
288 3300025916 Ga0207663_10001796 Ga0207663_100017968 184
289 3300025919 Ga0207657_10483760 Ga0207657_104837602 184
290 3300025922 Ga0207646_10646109 Ga0207646_106461091 184
291 3300025926 Ga0207659_10193259 Ga0207659_101932592 184
292 3300025928 Ga0207700_10060412 Ga0207700_100604122 184
293 3300025929 Ga0207664_10274519 Ga0207664_102745192 184
294 3300025931 Ga0207644_10043133 Ga0207644_100431333 184
295 3300025931 Ga0207644_10477585 Ga0207644_104775852 184
296 3300025932 Ga0207690_10052314 Ga0207690_100523143 184
297 3300025932 Ga0207690_10060667 Ga0207690_100606672 184
298 3300025933 Ga0207706_10013062 Ga0207706_100130628 184
299 3300025933 Ga0207706_10054084 Ga0207706_100540844 184
300 3300025933 Ga0207706_10257455 Ga0207706_102574552 184
301 3300025933 Ga0207706_10861460 Ga0207706_108614601 184
302 3300025934 Ga0207686_10015647 Ga0207686_100156474 184
303 3300025935 Ga0207709_10087674 Ga0207709_100876743 184
304 3300025937 Ga0207669_10004626 Ga0207669_100046267 184
305 3300025937 Ga0207669_10072386 Ga0207669_100723863 184
306 3300025938 Ga0207704_10000448 Ga0207704_100004483 184
307 3300025938 Ga0207704_10942308 Ga0207704_109423081 184
308 3300025939 Ga0207665_10002506 Ga0207665_100025063 184
309 3300025939 Ga0207665_10008287 Ga0207665_100082873 184
310 3300025940 Ga0207691_10127428 Ga0207691_101274284 184
311 3300025940 Ga0207691_10985942 Ga0207691_109859421 184
312 3300025941 Ga0207711_10048064 Ga0207711_100480643 184
313 3300025941 Ga0207711_10336748 Ga0207711_103367482 184
314 3300025942 Ga0207689_10009089 Ga0207689_100090895 184
315 3300025942 Ga0207689_10069905 Ga0207689_100699052 184
316 3300025949 Ga0207667_10021416 Ga0207667_100214162 184
317 3300025949 Ga0207667_10504168 Ga0207667_105041682 184
318 3300025960 Ga0207651_10236280 Ga0207651_102362803 184
319 3300025961 Ga0207712_10010767 Ga0207712_100107676 184
320 3300025961 Ga0207712_10309859 Ga0207712_103098592 184
321 3300025961 Ga0207712_10635438 Ga0207712_106354382 184
322 3300025972 Ga0207668_10000838 Ga0207668_100008384 184
323 3300025972 Ga0207668_10001862 Ga0207668_1000186212 184
324 3300025972 Ga0207668_10172380 Ga0207668_101723802 184
325 3300025981 Ga0207640_10098742 Ga0207640_100987422 184
326 3300025981 Ga0207640_10100082 Ga0207640_101000822 184
327 3300025986 Ga0207658_10001213 Ga0207658_1000121318 184
328 3300025986 Ga0207658_10071799 Ga0207658_100717993 184
329 3300025986 Ga0207658_10577108 Ga0207658_105771082 184
330 3300026023 Ga0207677_10019286 Ga0207677_100192862 184
331 3300026023 Ga0207677_10473708 Ga0207677_104737082 184
332 3300026035 Ga0207703_10089322 Ga0207703_100893223 184
333 3300026035 Ga0207703_10180753 Ga0207703_101807533 184
334 3300026041 Ga0207639_10058617 Ga0207639_100586173 184
335 3300026041 Ga0207639_10074378 Ga0207639_100743782 184
336 3300026067 Ga0207678_10092312 Ga0207678_100923124 184
337 3300026067 Ga0207678_10352041 Ga0207678_103520412 184
338 3300026075 Ga0207708_10061648 Ga0207708_100616484 184
339 3300026088 Ga0207641_10192423 Ga0207641_101924233 184
340 3300026088 Ga0207641_10770994 Ga0207641_107709942 184
341 3300026089 Ga0207648_10001458 Ga0207648_100014589 184
342 3300026089 Ga0207648_10037813 Ga0207648_100378132 184
343 3300026095 Ga0207676_10084097 Ga0207676_100840973 184
344 3300026118 Ga0207675_100213826 Ga0207675_1002138263 184
345 3300026118 Ga0207675_100260165 Ga0207675_1002601652 184
346 3300026118 Ga0207675_100376170 Ga0207675_1003761703 184
347 3300026121 Ga0207683_10000996 Ga0207683_1000099629 184
348 3300026121 Ga0207683_10203526 Ga0207683_102035263 184
349 3300026121 Ga0207683_11031634 Ga0207683_110316341 184
350 3300026142 Ga0207698_10026087 Ga0207698_100260874 184
351 3300028379 Ga0268266_10022186 Ga0268266_100221864 184
352 3300028379 Ga0268266_10259443 Ga0268266_102594432 184
353 3300028380 Ga0268265_10008991 Ga0268265_100089915 184
354 3300028381 Ga0268264_10068754 Ga0268264_100687543 184
355 3300031824 Ga0307413_10545004 Ga0307413_105450042 184
356 3300031852 Ga0307410_10408446 Ga0307410_104084462 184
357 3300031901 Ga0307406_10227077 Ga0307406_102270772 184
358 3300031903 Ga0307407_10150927 Ga0307407_101509272 184
359 3300031903 Ga0307407_10320971 Ga0307407_103209713 184
360 3300031995 Ga0307409_100048149 Ga0307409_1000481493 184
361 3300031995 Ga0307409_100198582 Ga0307409_1001985822 184
362 3300032002 Ga0307416_100024922 Ga0307416_1000249222 184
363 3300032002 Ga0307416_100026378 Ga0307416_1000263785 184
364 3300032004 Ga0307414_10099403 Ga0307414_100994032 184
365 3300032126 Ga0307415_100033433 Ga0307415_1000334332 184
366 3300035088 Ga0373940_0157197 Ga0373940_0157197_93_647 184
367 3300035121 Ga0373960_0029783 Ga0373960_0029783_457_1011 184
368 3300035121 Ga0373960_0046488 Ga0373960_0046488_325_879 184
369 3300035207 Ga0373942_0110630 Ga0373942_0110630_196_750 184
370 3300035691 Ga0373931_0013996 Ga0373931_0013996_1143_1697 184
371 3300039437 Ga0436365_1781365 Ga0436365_1781365_15933_16496 184
372 3300039450 Ga0436363_0132291 Ga0436363_0132291_886_1458 184
373 3300039450 Ga0436363_1541626 Ga0436363_1541626_26_589 184
374 3300041410 Ga0439461_0006924 Ga0439461_0006924_1013_1570 184
375 3300041411 Ga0439466_0019022 Ga0439466_0019022_1315_1881 184
376 3300041413 Ga0439465_0001890 Ga0439465_0001890_2597_3151 184
377 3300042002 Ga0439442_005512 Ga0439442_005512_704_1270 184
378 3300042004 Ga0439445_0055087 Ga0439445_0055087_415_981 184
379 3300042435 Ga0439434_0034004 Ga0439434_0034004_969_1535 184
380 3300044658 Ga0466972_0029543 Ga0466972_0029543_1517_2071 184
381 3300044658 Ga0466972_0032861 Ga0466972_0032861_825_1379 184
382 3300044658 Ga0466972_0108762 Ga0466972_0108762_708_1280 184
383 3300044658 Ga0466972_0218331 Ga0466972_0218331_50_604 184
384 3300044683 Ga0466965_0008336 Ga0466965_0008336_958_1512 184
385 3300044683 Ga0466965_0193128 Ga0466965_0193128_474_1028 184
386 3300044684 Ga0466966_0182702 Ga0466966_0182702_242_796 184
387 3300044694 Ga0466963_0404870 Ga0466963_0404870_268_843 184
388 3300044706 Ga0466964_0214081 Ga0466964_0214081_21_575 184
389 3300044719 Ga0466971_0041015 Ga0466971_0041015_606_1160 184
390 3300044735 Ga0466968_0003285 Ga0466968_0003285_1690_2253 184
391 3300044735 Ga0466968_0015206 Ga0466968_0015206_2403_2978 184
392 3300044735 Ga0466968_0026654 Ga0466968_0026654_1051_1617 184
393 3300044735 Ga0466968_0089099 Ga0466968_0089099_608_1162 184
394 3300044765 Ga0466970_0010485 Ga0466970_0010485_920_1474 184
395 3300044765 Ga0466970_0032671 Ga0466970_0032671_1554_2117 184
396 3300044765 Ga0466970_0136593 Ga0466970_0136593_628_1200 184
397 3300044765 Ga0466970_0312981 Ga0466970_0312981_44_619 184
398 3300044842 Ga0466957_0006105 Ga0466957_0006105_5699_6274 184
399 3300044842 Ga0466957_0199021 Ga0466957_0199021_77_631 184
400 3300044901 Ga0466960_0000170 Ga0466960_0000170_9494_10048 184
401 3300044901 Ga0466960_0289730 Ga0466960_0289730_177_752 184
402 3300045049 Ga0466959_0029803 Ga0466959_0029803_1801_2355 184
403 3300045049 Ga0466959_0049160 Ga0466959_0049160_1370_1933 184
404 3300045836 Ga0466958_0040633 Ga0466958_0040633_613_1167 184
405 3300045836 Ga0466958_0053725 Ga0466958_0053725_675_1238 184
406 3300045976 Ga0466967_0008716 Ga0466967_0008716_5722_6279 184
407 3300045976 Ga0466967_0097833 Ga0466967_0097833_1836_2399 184
408 3300045976 Ga0466967_0488815 Ga0466967_0488815_574_1140 184
409 3300046459 Ga0495629_0040272 Ga0495629_0040272_1187_1744 184
410 3300046461 Ga0495641_0027228 Ga0495641_0027228_2183_2740 184
411 3300046473 Ga0495582_0120795 Ga0495582_0120795_714_1271 184
412 3300046476 Ga0495662_0075464 Ga0495662_0075464_1068_1625 184
413 3300046507 Ga0495606_0026353 Ga0495606_0026353_914_1468 184
414 3300046511 Ga0495608_0283452 Ga0495608_0283452_88_645 184
415 3300046517 Ga0495630_0273459 Ga0495630_0273459_710_1267 184
416 3300046524 Ga0495648_0018539 Ga0495648_0018539_394_948 184
417 3300046530 Ga0495654_0269469 Ga0495654_0269469_33_587 184
418 3300046531 Ga0495665_0071847 Ga0495665_0071847_545_1102 184
419 3300046533 Ga0495640_0021572 Ga0495640_0021572_2878_3435 184
420 3300046683 Ga0495658_0050303 Ga0495658_0050303_384_941 184
421 3300047315 Ga0495581_0039376 Ga0495581_0039376_1100_1657 184
422 3300047317 Ga0495604_0250973 Ga0495604_0250973_135_692 184
423 3300047319 Ga0495674_0143225 Ga0495674_0143225_297_854 184
424 3300047320 Ga0495672_0002524 Ga0495672_0002524_8174_8728 184
425 3300047320 Ga0495672_0296171 Ga0495672_0296171_171_728 184
426 3300047469 Ga0495673_0001014 Ga0495673_0001014_14407_14961 184
427 3300047471 Ga0495684_0741904 Ga0495684_0741904_78_635 184
428 3300047673 Ga0495593_0006211 Ga0495593_0006211_4021_4578 184
429 3300048903 Ga0496100_0000780 Ga0496100_0000780_4806_5360 184
430 3300048903 Ga0496100_0001560 Ga0496100_0001560_10673_11227 184
431 3300048903 Ga0496100_0002719 Ga0496100_0002719_1253_1807 184
432 3300048903 Ga0496100_0217054 Ga0496100_0217054_774_1343 184
433 3300048904 Ga0496101_0000031 Ga0496101_0000031_39700_40254 184
434 3300048904 Ga0496101_0015234 Ga0496101_0015234_4420_5037 184
435 3300048904 Ga0496101_0051263 Ga0496101_0051263_84_638 184
436 3300048905 Ga0496102_0000065 Ga0496102_0000065_86263_86817 184
437 3300048905 Ga0496102_0002030 Ga0496102_0002030_15085_15654 184
438 3300048905 Ga0496102_0005978 Ga0496102_0005978_6440_6994 184
439 3300048905 Ga0496102_0028265 Ga0496102_0028265_78_632 184
440 3300048905 Ga0496102_0055426 Ga0496102_0055426_1826_2380 184
441 3300048905 Ga0496102_0126813 Ga0496102_0126813_1017_1571 184
442 3300048905 Ga0496102_0206799 Ga0496102_0206799_945_1499 184
443 3300048905 Ga0496102_0723573 Ga0496102_0723573_34_588 184
444 3300048906 Ga0496103_0000048 Ga0496103_0000048_85804_86358 184
445 3300048906 Ga0496103_0003067 Ga0496103_0003067_6011_6565 184
446 3300048906 Ga0496103_0128564 Ga0496103_0128564_38_592 184
447 3300048906 Ga0496103_0163170 Ga0496103_0163170_691_1260 184
448 3300048906 Ga0496103_0215673 Ga0496103_0215673_625_1179 184
449 3300048907 Ga0496104_0001343 Ga0496104_0001343_9352_9906 184
450 3300048907 Ga0496104_0015016 Ga0496104_0015016_1774_2343 184
451 3300048908 Ga0496105_0006560 Ga0496105_0006560_2820_3374 184
452 3300048908 Ga0496105_0068811 Ga0496105_0068811_774_1343 184
453 3300048908 Ga0496105_0456931 Ga0496105_0456931_156_710 184
454 3300048909 Ga0496106_0001046 Ga0496106_0001046_5219_5773 184
455 3300048909 Ga0496106_0018223 Ga0496106_0018223_3445_3999 184
456 3300048909 Ga0496106_0029597 Ga0496106_0029597_949_1503 184
457 3300048909 Ga0496106_0131472 Ga0496106_0131472_1167_1721 184
458 3300048910 Ga0496107_0005364 Ga0496107_0005364_8056_8610 184
459 3300048910 Ga0496107_0015942 Ga0496107_0015942_465_1019 184
460 3300048910 Ga0496107_0725976 Ga0496107_0725976_144_701 184
461 3300048911 Ga0496108_0001084 Ga0496108_0001084_20186_20740 184
462 3300048912 Ga0496109_0004328 Ga0496109_0004328_4390_4944 184
463 3300048912 Ga0496109_0098560 Ga0496109_0098560_1879_2448 184
464 3300048912 Ga0496109_0929347 Ga0496109_0929347_125_679 184
465 3300048913 Ga0496110_0136439 Ga0496110_0136439_1611_2180 184
466 3300048913 Ga0496110_0385935 Ga0496110_0385935_668_1222 184
467 3300048914 Ga0496111_0118958 Ga0496111_0118958_295_864 184
468 3300048914 Ga0496111_0330088 Ga0496111_0330088_98_652 184
469 3300048915 Ga0496112_0027671 Ga0496112_0027671_2655_3212 184
470 3300048915 Ga0496112_0034944 Ga0496112_0034944_671_1225 184
471 3300048915 Ga0496112_0536910 Ga0496112_0536910_318_872 184
472 3300048915 Ga0496112_0914165 Ga0496112_0914165_62_634 184
473 3300048917 Ga0496114_0001231 Ga0496114_0001231_12722_13276 184
474 3300048917 Ga0496114_0006256 Ga0496114_0006256_2067_2621 184
475 3300048917 Ga0496114_0151301 Ga0496114_0151301_550_1104 184
476 3300048917 Ga0496114_0627723 Ga0496114_0627723_373_927 184
477 3300048918 Ga0496115_0002005 Ga0496115_0002005_13539_14093 184
478 3300048918 Ga0496115_0003450 Ga0496115_0003450_3519_4073 184
479 3300048919 Ga0496116_0000125 Ga0496116_0000125_74554_75108 184
480 3300048920 Ga0496117_0000111 Ga0496117_0000111_74554_75108 184
481 3300048921 Ga0496118_0000083 Ga0496118_0000083_74554_75108 184
482 3300048922 Ga0496119_0044961 Ga0496119_0044961_80_634 184
483 3300048922 Ga0496119_0191432 Ga0496119_0191432_109_663 184
484 3300048924 Ga0496121_0000728 Ga0496121_0000728_16861_17415 184
485 3300048929 Ga0496126_0000220 Ga0496126_0000220_43736_44290 184
486 3300048929 Ga0496126_0348993 Ga0496126_0348993_148_702 184
487 3300049586 Ga0501070_0348707 Ga0501070_0348707_370_933 184
488 3300050489 nmdc:mga03683_1900_c1 nmdc:mga03683_1900_c1_4433_5008 184
489 3300050489 nmdc:mga03683_70853_c1 nmdc:mga03683_70853_c1_474_1040 184
490 3300050490 nmdc:mga03n38_1094_c1 nmdc:mga03n38_1094_c1_4524_5081 184
491 3300050490 nmdc:mga03n38_283494_c1 nmdc:mga03n38_283494_c1_289_867 184
492 3300050490 nmdc:mga03n38_586191_c1 nmdc:mga03n38_586191_c1_40_594 184
493 3300050490 nmdc:mga03n38_6617_c1 nmdc:mga03n38_6617_c1_2862_3428 184
494 3300050490 nmdc:mga03n38_78638_c1 nmdc:mga03n38_78638_c1_667_1242 184
495 3300050491 nmdc:mga00v17_11258_c1 nmdc:mga00v17_11258_c1_2394_2960 184
496 3300050491 nmdc:mga00v17_2735_c1 nmdc:mga00v17_2735_c1_8295_8867 184
497 3300050491 nmdc:mga00v17_342650_c1 nmdc:mga00v17_342650_c1_197_763 184
498 3300050491 nmdc:mga00v17_709_c1 nmdc:mga00v17_709_c1_12194_12769 184
499 3300050491 nmdc:mga00v17_7262_c1 nmdc:mga00v17_7262_c1_1231_1785 184
500 3300050491 nmdc:mga00v17_7945_c1 nmdc:mga00v17_7945_c1_2785_3342 184
501 3300050492 nmdc:mga0yw44_115335_c1 nmdc:mga0yw44_115335_c1_438_1013 184
502 3300050492 nmdc:mga0yw44_143613_c1 nmdc:mga0yw44_143613_c1_46_603 184
503 3300050492 nmdc:mga0yw44_39955_c1 nmdc:mga0yw44_39955_c1_728_1294 184
504 3300050492 nmdc:mga0yw44_52220_c1 nmdc:mga0yw44_52220_c1_59_631 184
505 3300050492 nmdc:mga0yw44_97306_c1 nmdc:mga0yw44_97306_c1_471_1028 184
506 3300050494 nmdc:mga06z11_114332_c1 nmdc:mga06z11_114332_c1_83_649 184
507 3300050494 nmdc:mga06z11_4510_c1 nmdc:mga06z11_4510_c1_2096_2662 184
508 3300050494 nmdc:mga06z11_670627_c1 nmdc:mga06z11_670627_c1_55_621 184
509 3300050495 nmdc:mga04h51_299473_c1 nmdc:mga04h51_299473_c1_61_627 184
510 3300050496 nmdc:mga07m45_138702_c1 nmdc:mga07m45_138702_c1_376_933 184
511 3300050496 nmdc:mga07m45_29176_c1 nmdc:mga07m45_29176_c1_878_1450 184
512 3300050496 nmdc:mga07m45_298627_c1 nmdc:mga07m45_298627_c1_26_637 184
513 3300050507 nmdc:mga05p37_48789_c1 nmdc:mga05p37_48789_c1_4258_4815 184
514 3300050509 nmdc:mga0qj67_102738_c1 nmdc:mga0qj67_102738_c1_1089_1646 184
515 3300050509 nmdc:mga0qj67_72636_c1 nmdc:mga0qj67_72636_c1_284_841 184
516 3300050510 nmdc:mga06r32_595434_c1 nmdc:mga06r32_595434_c1_436_993 184
517 3300050511 nmdc:mga08y16_1016769_c1 nmdc:mga08y16_1016769_c1_149_706 184
518 3300050516 nmdc:mga0sz30_102937_c1 nmdc:mga0sz30_102937_c1_481_1053 184
519 3300050516 nmdc:mga0sz30_1098_c1 nmdc:mga0sz30_1098_c1_8301_8855 184
520 3300050516 nmdc:mga0sz30_29439_c1 nmdc:mga0sz30_29439_c1_1402_1956 184
521 3300050516 nmdc:mga0sz30_338_c1 nmdc:mga0sz30_338_c1_4507_5082 184
522 3300053077 Ga0495601_0413501 Ga0495601_0413501_52_666 184
523 3300053085 Ga0495619_0283714 Ga0495619_0283714_95_652 184
524 3300053087 Ga0500643_003652 Ga0500643_003652_2306_2860 184
525 3300053155 Ga0500620_161830 Ga0500620_161830_203_760 184
526 3300053160 Ga0500633_0093077 Ga0500633_0093077_348_902 184
527 3300061719 Ga0466962_0099865 Ga0466962_0099865_530_1093 184
528 3300061719 Ga0466962_0139135 Ga0466962_0139135_579_1142 184
529 3300061719 Ga0466962_0212083 Ga0466962_0212083_59_613 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

19

65

0.97

PF13305

TetR_C_33

Tetracyclin repressor-like, C-terminal domain

84

183

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.8005 12 180
8hjb-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa pvra with coenzyme a 0.7643 12 182
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.76 12 180
2oi8-assembly1.cif.gz_A-2 crystal structure of putative regulatory protein sco4313 0.7594 7 180
3vpr-assembly2.cif.gz_C crystal structure of a tetr family transcriptional regulator pfmr from thermus thermophilus hb8 0.7579 15 184
ID Description Score Start End Superfamily
3mvpB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9443 11 51 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.94 11 57 1.10.10.60
5mwrB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9339 13 57 1.10.10.60
2dtzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9293 11 57 1.10.10.60
6el2B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9293 11 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1E3SDG5-F1-model_v4 TetR family transcriptional regulator 0.9703 1 182 GO:0000976
GO:0003700
AF-A0PLI3-F1-model_v4 Transcriptional regulator 0.9639 1 184 GO:0000976
GO:0003700
AF-A0A8B4EAD2-F1-model_v4 deleted 0.9604 23 184
AF-A0PLI3-F1-model_v4 Transcriptional regulator 0.9588 1 184 GO:0000976
GO:0003700
AF-A0A1E3SDG5-F1-model_v4 TetR family transcriptional regulator 0.9548 1 182 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
92.07 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map