F459848

General Info

Members Datasets Scaffolds Average Seq Length
529 281 1058 225

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0098401|Ga0495643_0098401_563_1351
Length 262
Sequence LKSNAHHCLATSKFISPNGSDDLQIARRAGTAKELIMTVKHVLFVLTNTAQIGPNHRPTGYFFSEVAHPFEVFDHAGVAVDFVSPLGGTPPSDAYDETDPAQRAFRESAAFRRLSRSRKLSEVDVLDYDAIFFPGGLGPMADIATDPDVKKAVIRAWNGGKIVSAVCHGPVAFAGAKLDDGTPFLKGRRVTAFSNAEEEGYAIADVPFLLESALVEEGATYEKADVWQPKVIVDGRLMTGQNPASGGPLAKEIVAALNKDAA

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
253 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
254 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
255 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
256 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
257 2738541297 Duganella sp. GV083 Isolate Unclassified
258 2738541357 Duganella sp. GV053 Isolate Unclassified
259 2738543003 Duganella sp. GV066 Isolate Unclassified
260 2738543013 Variovorax sp. BT01 Isolate Unclassified
261 2738543026 Duganella sp. GV089 Isolate Unclassified
262 2738543029 Duganella sp. GV039 Isolate Unclassified
263 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
264 2821131069 Duganella sp. 1224 Isolate Unclassified
265 2831864461 Roseateles noduli HZ7 Isolate Nodule
266 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
267 2842733646 Variovorax sp. R-72446 Isolate Unclassified
268 2857553236 Duganella sp. R-74557 Isolate Unclassified
269 2857558681 Duganella sp. R-74565 Isolate Unclassified
270 2857564685 Duganella sp. R-74599 Isolate Unclassified
271 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
272 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
273 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
274 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
275 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
276 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
277 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
278 2919404418 Luteibacter sp. 3190 Isolate Unclassified
279 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
280 2941471342 Luteibacter sp. 621 Isolate Unclassified
281 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 0
Isolates 5.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 1.51
Rhizoplane 4.73
Rhizosphere 66.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0098401 3300046522 Bacteria 1502
2 JGI24736J21556_1002945 3300001904 Bacteria 2982
3 JGI24747J21853_1007183 3300001978 Bacteria 1067
4 JGI24738J21930_10006547 3300002075 Bacteria 2727
5 JGI24744J21845_10000494 3300002077 Bacteria 7003
6 JGI24742J22300_10004056 3300002244 Bacteria 2385
7 rootH1_10141630 3300003316 Bacteria 1816
8 rootH2_10108600 3300003320 Bacteria 2420
9 rootL2_10090460 3300003322 Bacteria 2017
10 rootH1_10008264 3300003323 Bacteria 63477
11 rootH1_10074584 3300003323 Bacteria 1770
12 rootH1_10264052 3300003323 Bacteria 1793
13 Ga0055526_1000037 3300003771 Bacteria 134834
14 Ga0055526_1000393 3300003771 Bacteria 35323
15 Ga0055526_1003157 3300003771 Bacteria 10676
16 Ga0055537_1000318 3300003773 Bacteria 32892
17 Ga0055537_1008822 3300003773 Bacteria 2283
18 Ga0055524_1002369 3300003775 Bacteria 9796
19 Ga0055536_1022238 3300003781 Bacteria 1899
20 Ga0055534_1000205 3300003784 Bacteria 43564
21 Ga0055528_1000147 3300003790 Bacteria 57895
22 Ga0065165_1000647 3300005262 Bacteria 50322
23 Ga0065165_1001648 3300005262 Bacteria 22675
24 Ga0070690_100003241 3300005330 Bacteria 8881
25 Ga0070670_100120282 3300005331 Bacteria 2265
26 Ga0068869_100060697 3300005334 Bacteria 2772
27 Ga0070680_100459118 3300005336 Bacteria 1088
28 Ga0070682_100015137 3300005337 Bacteria 4466
29 Ga0070682_100107522 3300005337 Bacteria 1853
30 Ga0068868_100014071 3300005338 Bacteria 5889
31 Ga0070660_100089778 3300005339 Bacteria 2422
32 Ga0070689_100006530 3300005340 Bacteria 8086
33 Ga0070691_10015879 3300005341 Bacteria 3461
34 Ga0070668_100006101 3300005347 Bacteria 8937
35 Ga0070668_100033574 3300005347 Bacteria 3908
36 Ga0070669_100003040 3300005353 Bacteria 12068
37 Ga0070669_100058983 3300005353 Bacteria 2818
38 Ga0070675_100121766 3300005354 Bacteria 2217
39 Ga0070674_100002890 3300005356 Bacteria 9510
40 Ga0070688_100012171 3300005365 Bacteria 4812
41 Ga0070667_100000048 3300005367 Bacteria 160347
42 Ga0070667_100001462 3300005367 Bacteria 21169
43 Ga0070709_10023381 3300005434 Bacteria 3627
44 Ga0070710_10004968 3300005437 Bacteria 6293
45 Ga0070701_10000380 3300005438 Bacteria 14936
46 Ga0070711_100006956 3300005439 Bacteria 6860
47 Ga0070705_100005882 3300005440 Bacteria 5997
48 Ga0070700_100006692 3300005441 Bacteria 6173
49 Ga0070694_100031566 3300005444 Bacteria 3473
50 Ga0070663_100018399 3300005455 Bacteria 4581
51 Ga0070663_100296888 3300005455 Bacteria 1292
52 Ga0070678_100006572 3300005456 Bacteria 6833
53 Ga0070678_100133345 3300005456 Bacteria 1977
54 Ga0070662_100026725 3300005457 Bacteria 4000
55 Ga0068867_100008355 3300005459 Bacteria 7305
56 Ga0068853_100013033 3300005539 Bacteria 6780
57 Ga0068853_100308498 3300005539 Bacteria 1464
58 Ga0070672_100073241 3300005543 Bacteria 2730
59 Ga0070686_100066303 3300005544 Bacteria 2348
60 Ga0070695_100027842 3300005545 Bacteria 3504
61 Ga0070696_100005908 3300005546 Bacteria 8172
62 Ga0070693_100010229 3300005547 Bacteria 4693
63 Ga0070665_100006758 3300005548 Bacteria 11658
64 Ga0070704_100005031 3300005549 Bacteria 7685
65 Ga0068855_100119549 3300005563 Bacteria 3017
66 Ga0068857_100308412 3300005577 Bacteria 1460
67 Ga0068854_100001044 3300005578 Bacteria 16621
68 Ga0068856_100344791 3300005614 Bacteria 1508
69 Ga0070702_100056575 3300005615 Bacteria 2266
70 Ga0068859_100005079 3300005617 Bacteria 13368
71 Ga0068859_100005647 3300005617 Bacteria 12745
72 Ga0068861_100001065 3300005719 Bacteria 16895
73 Ga0068863_100001920 3300005841 Bacteria 20653
74 Ga0068858_100003845 3300005842 Bacteria 14843
75 Ga0068860_100000225 3300005843 Bacteria 87813
76 Ga0068862_100000018 3300005844 Bacteria 231245
77 Ga0068862_100052095 3300005844 Bacteria 3501
78 Ga0075365_10138535 3300006038 Bacteria 1688
79 Ga0075363_100049174 3300006048 Bacteria 2244
80 Ga0075364_10084175 3300006051 Bacteria 2106
81 Ga0075364_10300958 3300006051 Bacteria 1092
82 Ga0070715_10048520 3300006163 Bacteria 1816
83 Ga0070712_100006806 3300006175 Bacteria 7116
84 Ga0075362_10073298 3300006177 Bacteria 1567
85 Ga0097621_100018442 3300006237 Bacteria 5331
86 Ga0075370_10003740 3300006353 Bacteria 7279
87 Ga0068865_100019138 3300006881 Bacteria 4429
88 Ga0097620_100005079 3300006931 Bacteria 13368
89 Ga0097620_100005647 3300006931 Bacteria 12745
90 Ga0099824_1013930 3300006942 Bacteria 8172
91 Ga0099826_10000037 3300006948 Bacteria 104916
92 Ga0105251_10158028 3300009011 Bacteria 1022
93 Ga0105250_10030785 3300009092 Bacteria 2157
94 Ga0105240_10008507 3300009093 Bacteria 14678
95 Ga0105245_10006218 3300009098 Bacteria 10504
96 Ga0105247_10000011 3300009101 Bacteria 296480
97 Ga0105247_10041992 3300009101 Bacteria 2799
98 Ga0105248_10000057 3300009177 Bacteria 138279
99 Ga0105248_10044088 3300009177 Bacteria 5002
100 Ga0105248_10359143 3300009177 Bacteria 1640
101 Ga0105237_10004991 3300009545 Bacteria 15119
102 Ga0105237_10030417 3300009545 Bacteria 5484
103 Ga0105237_10250836 3300009545 Bacteria 1772
104 Ga0105238_10030755 3300009551 Bacteria 5466
105 Ga0105238_10036616 3300009551 Bacteria 4989
106 Ga0105238_10139611 3300009551 Bacteria 2400
107 Ga0105238_10155168 3300009551 Bacteria 2264
108 Ga0105249_10000088 3300009553 Bacteria 131228
109 Ga0105239_10014265 3300010375 Bacteria 8821
110 Ga0105239_10037695 3300010375 Bacteria 5297
111 Ga0105239_10114056 3300010375 Bacteria 2997
112 Ga0157373_10028776 3300013100 Bacteria 4007
113 Ga0157373_10060329 3300013100 Bacteria 2688
114 Ga0157370_10008332 3300013104 Bacteria 11181
115 Ga0157370_10334752 3300013104 Bacteria 1395
116 Ga0157370_10459999 3300013104 Bacteria 1170
117 Ga0157369_10000504 3300013105 Bacteria 51436
118 Ga0157374_10399266 3300013296 Bacteria 1371
119 Ga0157378_10013820 3300013297 Bacteria 7059
120 Ga0163162_10068943 3300013306 Bacteria 3589
121 Ga0157372_10014981 3300013307 Bacteria 8297
122 Ga0157375_10005994 3300013308 Bacteria 10600
123 Ga0157380_10005044 3300014326 Bacteria 9209
124 Ga0157379_10011519 3300014968 Bacteria 7718
125 Ga0157379_10087815 3300014968 Bacteria 2788
126 Ga0157376_10065773 3300014969 Bacteria 3063
127 Ga0182006_1000005 3300015261 Bacteria 621201
128 Ga0182007_10009355 3300015262 Bacteria 3957
129 Ga0182005_1003775 3300015265 Bacteria 5038
130 Ga0163161_10004568 3300017792 Bacteria 9637
131 Ga0163161_10078844 3300017792 Bacteria 2421
132 Ga0163161_10254460 3300017792 Bacteria 1370
133 Ga0213872_10000010 3300021361 Bacteria 194896
134 Ga0213872_10003141 3300021361 Bacteria 9279
135 Ga0213872_10017196 3300021361 Bacteria 3345
136 Ga0213872_10026819 3300021361 Bacteria 2646
137 Ga0213872_10040813 3300021361 Bacteria 2118
138 Ga0213872_10053702 3300021361 Bacteria 1827
139 Ga0209563_100014 3300025230 Bacteria 940582
140 Ga0209437_100261 3300025233 Bacteria 82127
141 Ga0209759_1008141 3300025256 Bacteria 3299
142 Ga0209565_1000003 3300025263 Bacteria 1099648
143 Ga0209565_1001886 3300025263 Bacteria 8312
144 Ga0209673_1000003 3300025273 Bacteria 980859
145 Ga0209673_1008317 3300025273 Bacteria 4628
146 Ga0209673_1022788 3300025273 Bacteria 2150
147 Ga0209673_1045860 3300025273 Bacteria 1197
148 Ga0209675_1000003 3300025291 Bacteria 1003982
149 Ga0209676_1003218 3300025292 Bacteria 10322
150 Ga0209025_1003122 3300025294 Bacteria 16206
151 Ga0209564_1000012 3300025295 Bacteria 792078
152 Ga0209564_1000021 3300025295 Bacteria 571316
153 Ga0209564_1000042 3300025295 Bacteria 392805
154 Ga0209256_1000407 3300025299 Bacteria 68090
155 Ga0209256_1000431 3300025299 Bacteria 65392
156 Ga0209256_1022521 3300025299 Bacteria 1905
157 Ga0209051_1004935 3300025303 Bacteria 7981
158 Ga0209051_1014281 3300025303 Bacteria 3715
159 Ga0209051_1017490 3300025303 Bacteria 3202
160 Ga0207696_1056654 3300025711 Bacteria 1109
161 Ga0207713_1103363 3300025735 Bacteria 979
162 Ga0207710_10000067 3300025900 Bacteria 153244
163 Ga0207710_10020967 3300025900 Bacteria 2798
164 Ga0207710_10080365 3300025900 Bacteria 1511
165 Ga0207688_10002438 3300025901 Bacteria 10023
166 Ga0207647_10000234 3300025904 Bacteria 45343
167 Ga0207699_10089820 3300025906 Bacteria 1926
168 Ga0207645_10012012 3300025907 Bacteria 5888
169 Ga0207695_10001990 3300025913 Bacteria 31545
170 Ga0207695_10007168 3300025913 Bacteria 14267
171 Ga0207671_10022278 3300025914 Bacteria 4791
172 Ga0207693_10009542 3300025915 Bacteria 7903
173 Ga0207663_10009577 3300025916 Bacteria 5125
174 Ga0207660_10267792 3300025917 Bacteria 1353
175 Ga0207681_10016503 3300025923 Bacteria 4621
176 Ga0207681_10072379 3300025923 Bacteria 2407
177 Ga0207694_10157508 3300025924 Bacteria 1833
178 Ga0207694_10162883 3300025924 Bacteria 1802
179 Ga0207694_10306538 3300025924 Bacteria 1308
180 Ga0207650_10091183 3300025925 Bacteria 2328
181 Ga0207687_10000859 3300025927 Bacteria 20565
182 Ga0207644_10312834 3300025931 Bacteria 1268
183 Ga0207706_10004732 3300025933 Bacteria 12741
184 Ga0207709_10006459 3300025935 Bacteria 6583
185 Ga0207670_10011349 3300025936 Bacteria 5168
186 Ga0207669_10001748 3300025937 Bacteria 9228
187 Ga0207711_10000308 3300025941 Bacteria 52465
188 Ga0207711_10787619 3300025941 Bacteria 886
189 Ga0207689_10080210 3300025942 Bacteria 2682
190 Ga0207667_10368163 3300025949 Bacteria 1465
191 Ga0207712_10000064 3300025961 Bacteria 132823
192 Ga0207712_10092029 3300025961 Bacteria 2235
193 Ga0207668_10008721 3300025972 Bacteria 6056
194 Ga0207668_10023510 3300025972 Bacteria 3963
195 Ga0207640_10008831 3300025981 Bacteria 5611
196 Ga0207658_10000861 3300025986 Bacteria 25380
197 Ga0207658_10014905 3300025986 Bacteria 5327
198 Ga0207677_10009187 3300026023 Bacteria 5552
199 Ga0207703_10025368 3300026035 Bacteria 4662
200 Ga0207703_10130160 3300026035 Bacteria 2172
201 Ga0207678_10022195 3300026067 Bacteria 5562
202 Ga0207678_10062612 3300026067 Bacteria 3197
203 Ga0207708_10008069 3300026075 Bacteria 7802
204 Ga0207702_10299855 3300026078 Bacteria 1525
205 Ga0207641_10000963 3300026088 Bacteria 29532
206 Ga0207648_10008860 3300026089 Bacteria 9685
207 Ga0207675_100000724 3300026118 Bacteria 32727
208 Ga0207683_10000586 3300026121 Bacteria 33521
209 Ga0207683_10080394 3300026121 Bacteria 2892
210 Ga0207698_10111404 3300026142 Bacteria 2294
211 Ga0207698_10143801 3300026142 Bacteria 2059
212 Ga0209489_116764 3300027361 Bacteria 3722
213 Ga0209282_1000010 3300027666 Bacteria 231627
214 Ga0209282_1000096 3300027666 Bacteria 59947
215 Ga0268266_10008866 3300028379 Bacteria 8904
216 Ga0268265_10000005 3300028380 Bacteria 535350
217 Ga0268264_10000148 3300028381 Bacteria 164719
218 Ga0268264_10010253 3300028381 Bacteria 7757
219 Ga0307511_10019427 3300030521 Bacteria 6466
220 Ga0265327_10000773 3300031251 Bacteria 49324
221 Ga0307514_10001002 3300031649 Bacteria 41404
222 Ga0307510_10147562 3300033180 Bacteria 1980
223 Ga0373962_0046753 3300035242 Bacteria 1236
224 Ga0373931_0013092 3300035691 Bacteria 4033
225 Ga0436361_0067060 3300039447 Bacteria 222217
226 Ga0436361_0081535 3300039447 Bacteria 7234
227 Ga0436361_0506702 3300039447 Bacteria 8246
228 Ga0436361_0747616 3300039447 Bacteria 10413
229 Ga0436361_1098331 3300039447 Bacteria 6418
230 Ga0439445_0005999 3300042004 Bacteria 2783
231 Ga0451576_0021968 3300045051 Bacteria 6928
232 Ga0495617_000006 3300046452 Bacteria 398279
233 Ga0495617_000601 3300046452 Bacteria 18252
234 Ga0495617_000687 3300046452 Bacteria 16955
235 Ga0495617_047942 3300046452 Bacteria 1422
236 Ga0495627_006541 3300046453 Bacteria 4558
237 Ga0495590_0019607 3300046457 Bacteria 2407
238 Ga0495590_0070771 3300046457 Bacteria 1224
239 Ga0495591_002219 3300046458 Bacteria 11080
240 Ga0495591_007523 3300046458 Bacteria 4616
241 Ga0495591_052095 3300046458 Bacteria 1114
242 Ga0495638_0001330 3300046460 Bacteria 22719
243 Ga0495638_0026394 3300046460 Bacteria 3763
244 Ga0495638_0106202 3300046460 Bacteria 1673
245 Ga0495638_0380899 3300046460 Bacteria 737
246 Ga0495653_0000089 3300046463 Bacteria 76043
247 Ga0495653_0190080 3300046463 Bacteria 1402
248 Ga0495650_0001062 3300046471 Bacteria 30453
249 Ga0495650_0007881 3300046471 Bacteria 6323
250 Ga0495650_0022518 3300046471 Bacteria 3019
251 Ga0495650_0045691 3300046471 Bacteria 1842
252 Ga0495605_0000017 3300046474 Bacteria 273775
253 Ga0495605_0000018 3300046474 Bacteria 270187
254 Ga0495605_0008912 3300046474 Bacteria 5655
255 Ga0495605_0050761 3300046474 Bacteria 2022
256 Ga0495639_0154485 3300046475 Bacteria 1108
257 Ga0495584_0041506 3300046491 Bacteria 2322
258 Ga0495584_0104755 3300046491 Bacteria 1430
259 Ga0495584_0177550 3300046491 Bacteria 1082
260 Ga0495585_0000120 3300046492 Bacteria 85123
261 Ga0495585_0000714 3300046492 Bacteria 29831
262 Ga0495585_0027641 3300046492 Bacteria 3237
263 Ga0495596_0000043 3300046500 Bacteria 90571
264 Ga0495596_0014141 3300046500 Bacteria 3366
265 Ga0495607_0000022 3300046501 Bacteria 162516
266 Ga0495607_0008745 3300046501 Bacteria 6898
267 Ga0495607_0017598 3300046501 Bacteria 4581
268 Ga0495607_0017773 3300046501 Bacteria 4553
269 Ga0495607_0041034 3300046501 Bacteria 2751
270 Ga0495607_0042031 3300046501 Bacteria 2712
271 Ga0495583_0000022 3300046506 Bacteria 282544
272 Ga0495583_0000722 3300046506 Bacteria 42246
273 Ga0495583_0001780 3300046506 Bacteria 20527
274 Ga0495583_0004054 3300046506 Bacteria 10772
275 Ga0495606_0000063 3300046507 Bacteria 184610
276 Ga0495606_0000504 3300046507 Bacteria 63622
277 Ga0495606_0001154 3300046507 Bacteria 37452
278 Ga0495606_0001174 3300046507 Bacteria 36952
279 Ga0495606_0002047 3300046507 Bacteria 24702
280 Ga0495606_0008422 3300046507 Bacteria 8969
281 Ga0495606_0031570 3300046507 Bacteria 3681
282 Ga0495606_0054088 3300046507 Bacteria 2601
283 Ga0495606_0064570 3300046507 Bacteria 2329
284 Ga0495606_0235986 3300046507 Bacteria 1022
285 Ga0495610_0000004 3300046512 Bacteria 1006135
286 Ga0495610_0000142 3300046512 Bacteria 78819
287 Ga0495610_0000184 3300046512 Bacteria 69871
288 Ga0495610_0002309 3300046512 Bacteria 16110
289 Ga0495610_0008278 3300046512 Bacteria 6757
290 Ga0495610_0011016 3300046512 Bacteria 5564
291 Ga0495610_0075745 3300046512 Bacteria 1557
292 Ga0495610_0202956 3300046512 Bacteria 810
293 Ga0495616_0000315 3300046513 Bacteria 38639
294 Ga0495616_0014688 3300046513 Bacteria 4376
295 Ga0495616_0114297 3300046513 Bacteria 1251
296 Ga0495620_0000105 3300046515 Bacteria 67077
297 Ga0495620_0119855 3300046515 Bacteria 1037
298 Ga0495620_0198735 3300046515 Bacteria 771
299 Ga0495631_0001917 3300046518 Bacteria 12243
300 Ga0495631_0057847 3300046518 Bacteria 1686
301 Ga0495632_0002053 3300046519 Bacteria 15819
302 Ga0495632_0008305 3300046519 Bacteria 6393
303 Ga0495632_0018349 3300046519 Bacteria 3841
304 Ga0495632_0050028 3300046519 Bacteria 2063
305 Ga0495637_0000050 3300046520 Bacteria 101502
306 Ga0495637_0000133 3300046520 Bacteria 55485
307 Ga0495637_0000600 3300046520 Bacteria 25791
308 Ga0495637_0003053 3300046520 Bacteria 8951
309 Ga0495637_0006608 3300046520 Bacteria 5803
310 Ga0495637_0029315 3300046520 Bacteria 2450
311 Ga0495643_0010542 3300046522 Bacteria 5682
312 Ga0495643_0023479 3300046522 Bacteria 3506
313 Ga0495643_0205793 3300046522 Bacteria 942
314 Ga0495644_0002830 3300046523 Bacteria 6876
315 Ga0495644_0009380 3300046523 Bacteria 3774
316 Ga0495648_0000219 3300046524 Bacteria 65619
317 Ga0495648_0002400 3300046524 Bacteria 17389
318 Ga0495648_0012177 3300046524 Bacteria 6431
319 Ga0495648_0024780 3300046524 Bacteria 4075
320 Ga0495648_0050211 3300046524 Bacteria 2551
321 Ga0495654_0000014 3300046530 Bacteria 312126
322 Ga0495654_0002676 3300046530 Bacteria 11281
323 Ga0495654_0169045 3300046530 Bacteria 954
324 Ga0495609_0000104 3300046538 Bacteria 98657
325 Ga0495609_0000354 3300046538 Bacteria 40082
326 Ga0495609_0022764 3300046538 Bacteria 2887
327 Ga0495621_0085659 3300046539 Bacteria 1181
328 Ga0495622_0003225 3300046557 Bacteria 7727
329 Ga0495622_0011921 3300046557 Bacteria 4021
330 Ga0495622_0038354 3300046557 Bacteria 2231
331 Ga0495633_0004977 3300046558 Bacteria 8290
332 Ga0495633_0014262 3300046558 Bacteria 4161
333 Ga0495668_0000035 3300046616 Bacteria 240241
334 Ga0495668_0000734 3300046616 Bacteria 39253
335 Ga0495668_0000892 3300046616 Bacteria 33554
336 Ga0495668_0012005 3300046616 Bacteria 5156
337 Ga0495668_0033800 3300046616 Bacteria 2871
338 Ga0495668_0158839 3300046616 Bacteria 1238
339 Ga0495611_0000863 3300046648 Bacteria 16615
340 Ga0495611_0003655 3300046648 Bacteria 6747
341 Ga0495611_0003960 3300046648 Bacteria 6442
342 Ga0495611_0086539 3300046648 Bacteria 1446
343 Ga0495625_0001167 3300046660 Bacteria 33819
344 Ga0495625_0001475 3300046660 Bacteria 28433
345 Ga0495625_0015143 3300046660 Bacteria 6120
346 Ga0495625_0017970 3300046660 Bacteria 5527
347 Ga0495661_0000156 3300046665 Bacteria 80747
348 Ga0495661_0004179 3300046665 Bacteria 10497
349 Ga0495661_0008412 3300046665 Bacteria 7134
350 Ga0495661_0016051 3300046665 Bacteria 4975
351 Ga0495661_0022282 3300046665 Bacteria 4121
352 Ga0495661_0083174 3300046665 Bacteria 1841
353 Ga0495669_0070622 3300046684 Bacteria 1591
354 Ga0495669_0242863 3300046684 Bacteria 864
355 Ga0495670_0000453 3300046691 Bacteria 19559
356 Ga0495670_0010796 3300046691 Bacteria 4488
357 Ga0495670_0213787 3300046691 Bacteria 1023
358 Ga0495671_0000005 3300046692 Bacteria 509397
359 Ga0495671_0000726 3300046692 Bacteria 23810
360 Ga0495671_0008780 3300046692 Bacteria 5675
361 Ga0495671_0071070 3300046692 Bacteria 1709
362 Ga0495671_0283744 3300046692 Bacteria 797
363 Ga0495649_0012759 3300046694 Bacteria 4873
364 Ga0495649_0024941 3300046694 Bacteria 3331
365 Ga0495649_0024984 3300046694 Bacteria 3329
366 Ga0495649_0029557 3300046694 Bacteria 3030
367 Ga0495589_0024371 3300046794 Bacteria 3075
368 Ga0495589_0040764 3300046794 Bacteria 2318
369 Ga0495660_0000025 3300046810 Bacteria 260275
370 Ga0495660_0002356 3300046810 Bacteria 12077
371 Ga0495660_0003496 3300046810 Bacteria 9690
372 Ga0495660_0006291 3300046810 Bacteria 7042
373 Ga0495660_0057779 3300046810 Bacteria 2092
374 Ga0495672_0006653 3300047320 Bacteria 8879
375 Ga0495672_0007216 3300047320 Bacteria 8391
376 Ga0495672_0027577 3300047320 Bacteria 3606
377 Ga0495676_0000043 3300047321 Bacteria 103066
378 Ga0495683_0006310 3300047323 Bacteria 6483
379 Ga0495683_0010096 3300047323 Bacteria 5004
380 Ga0495683_0042759 3300047323 Bacteria 2284
381 Ga0495679_000049 3300047446 Bacteria 127408
382 Ga0495685_006823 3300047447 Bacteria 3755
383 Ga0495673_0000001 3300047469 Bacteria 1630730
384 Ga0495673_0000012 3300047469 Bacteria 656908
385 Ga0495673_0000335 3300047469 Bacteria 60281
386 Ga0495673_0002256 3300047469 Bacteria 13842
387 Ga0495673_0010594 3300047469 Bacteria 5003
388 Ga0495673_0015373 3300047469 Bacteria 3946
389 Ga0495673_0111730 3300047469 Bacteria 1091
390 Ga0495673_0133839 3300047469 Bacteria 972
391 Ga0495681_0010790 3300047470 Bacteria 5502
392 Ga0495681_0016629 3300047470 Bacteria 4112
393 Ga0495686_0000192 3300047472 Bacteria 114355
394 Ga0495686_0000879 3300047472 Bacteria 38312
395 Ga0495686_0003674 3300047472 Bacteria 13126
396 Ga0495686_0007453 3300047472 Bacteria 8202
397 Ga0495686_0010404 3300047472 Bacteria 6622
398 Ga0495626_0000093 3300048091 Bacteria 116329
399 Ga0496100_0007598 3300048903 Bacteria 5993
400 Ga0496100_0010526 3300048903 Bacteria 5238
401 Ga0496101_0002113 3300048904 Bacteria 12116
402 Ga0496101_0025237 3300048904 Bacteria 4122
403 Ga0496101_0084601 3300048904 Bacteria 2349
404 Ga0496101_0263076 3300048904 Bacteria 1346
405 Ga0496102_0010465 3300048905 Bacteria 7983
406 Ga0496102_0329894 3300048905 Bacteria 1437
407 Ga0496103_0000424 3300048906 Bacteria 36930
408 Ga0496103_0062678 3300048906 Bacteria 2314
409 Ga0496106_0000195 3300048909 Bacteria 42735
410 Ga0496106_0010620 3300048909 Bacteria 6804
411 Ga0496107_0016650 3300048910 Bacteria 5165
412 Ga0496107_0076400 3300048910 Bacteria 2439
413 Ga0496108_0008440 3300048911 Bacteria 8358
414 Ga0496109_0068334 3300048912 Bacteria 3258
415 Ga0496109_0873831 3300048912 Bacteria 837
416 Ga0496110_0038153 3300048913 Bacteria 4179
417 Ga0496110_0501969 3300048913 Bacteria 1104
418 Ga0496111_0245590 3300048914 Bacteria 1329
419 Ga0496112_0002793 3300048915 Bacteria 14163
420 Ga0496113_0584364 3300048916 Bacteria 895
421 Ga0496114_0186093 3300048917 Bacteria 1815
422 Ga0496114_0671508 3300048917 Bacteria 910
423 Ga0496115_0042476 3300048918 Bacteria 3621
424 Ga0496116_0002637 3300048919 Bacteria 18610
425 Ga0496116_0005651 3300048919 Bacteria 11512
426 Ga0496116_0016627 3300048919 Bacteria 5746
427 Ga0496116_0039331 3300048919 Bacteria 3272
428 Ga0496116_0096536 3300048919 Bacteria 1780
429 Ga0496117_0001365 3300048920 Bacteria 35588
430 Ga0496117_0006712 3300048920 Bacteria 11498
431 Ga0496117_0075410 3300048920 Bacteria 2241
432 Ga0496118_0000469 3300048921 Bacteria 67113
433 Ga0496118_0002456 3300048921 Bacteria 24957
434 Ga0496118_0003456 3300048921 Bacteria 19871
435 Ga0496118_0025845 3300048921 Bacteria 5022
436 Ga0496118_0078850 3300048921 Bacteria 2328
437 Ga0496119_0028525 3300048922 Bacteria 3806
438 Ga0496119_0082826 3300048922 Bacteria 1844
439 Ga0496120_0022825 3300048923 Bacteria 3931
440 Ga0496121_0000161 3300048924 Bacteria 145828
441 Ga0496121_0001875 3300048924 Bacteria 33755
442 Ga0496121_0005009 3300048924 Bacteria 17338
443 Ga0496121_0014387 3300048924 Bacteria 8401
444 Ga0496121_0016196 3300048924 Bacteria 7717
445 Ga0496121_0039858 3300048924 Bacteria 4131
446 Ga0496121_0078072 3300048924 Bacteria 2634
447 Ga0496121_0089245 3300048924 Bacteria 2414
448 Ga0496121_0089930 3300048924 Bacteria 2402
449 Ga0496121_0093686 3300048924 Bacteria 2338
450 Ga0496121_0140483 3300048924 Bacteria 1793
451 Ga0496122_0000225 3300048925 Bacteria 126304
452 Ga0496122_0025789 3300048925 Bacteria 5091
453 Ga0496122_0026073 3300048925 Bacteria 5055
454 Ga0496123_0000192 3300048926 Bacteria 124096
455 Ga0496123_0000865 3300048926 Bacteria 48170
456 Ga0496123_0008853 3300048926 Bacteria 9169
457 Ga0496123_0012552 3300048926 Bacteria 7213
458 Ga0496123_0032478 3300048926 Bacteria 3778
459 Ga0496123_0073283 3300048926 Bacteria 2125
460 Ga0496123_0242155 3300048926 Bacteria 895
461 Ga0496124_0000714 3300048927 Bacteria 54365
462 Ga0496124_0055187 3300048927 Bacteria 3359
463 Ga0496124_0140945 3300048927 Bacteria 1902
464 Ga0496124_0169323 3300048927 Bacteria 1694
465 Ga0496124_0382977 3300048927 Bacteria 983
466 Ga0496125_0000947 3300048928 Bacteria 45544
467 Ga0496125_0010284 3300048928 Bacteria 9474
468 Ga0496125_0052783 3300048928 Bacteria 3340
469 Ga0496125_0059503 3300048928 Bacteria 3078
470 Ga0496126_0009869 3300048929 Bacteria 10101
471 Ga0496126_0070665 3300048929 Bacteria 3109
472 Ga0496126_0103574 3300048929 Bacteria 2487
473 Ga0496126_0159507 3300048929 Bacteria 1928
474 Ga0495678_000043 3300049459 Bacteria 172593
475 Ga0495678_006360 3300049459 Bacteria 6298
476 Ga0495678_025388 3300049459 Bacteria 2545
477 Ga0495682_0000355 3300049460 Bacteria 33636
478 nmdc:mga03n38_16231_c1 3300050490 Bacteria 2894
479 nmdc:mga03n38_7022_c1 3300050490 Bacteria 3958
480 nmdc:mga00v17_338690_c1 3300050491 Bacteria 978
481 nmdc:mga0yw44_687686_c1 3300050492 Bacteria 695
482 nmdc:mga0yw44_88709_c1 3300050492 Bacteria 1950
483 nmdc:mga07m45_1639_c1 3300050496 Bacteria 7694
484 nmdc:mga07m45_38800_c1 3300050496 Bacteria 2660
485 Ga0500643_004976 3300053087 Bacteria 5839
486 Ga0500594_0087855 3300053118 Bacteria 939
487 Ga0500594_0117310 3300053118 Bacteria 833
488 Ga0500608_023897 3300053122 Bacteria 2849
489 Ga0500608_105212 3300053122 Bacteria 1302
490 Ga0500618_001982 3300053125 Bacteria 8376
491 Ga0500652_043474 3300053131 Bacteria 1816
492 Ga0500559_0002004 3300053136 Bacteria 10954
493 Ga0500559_0019540 3300053136 Bacteria 2862
494 Ga0500559_0042086 3300053136 Bacteria 1992
495 Ga0500568_0043541 3300053139 Bacteria 1794
496 Ga0500573_0085229 3300053140 Bacteria 1792
497 Ga0500627_0123503 3300053158 Bacteria 1168
498 Ga0500636_0002776 3300053177 Bacteria 9766
499 Ga0500661_008472 3300055283 Bacteria 1892
500 2587729689 2585428057 Bacteria 6737412
501 2588295827 2588253510 Bacteria 6901809
502 2595452429 2593339239 Bacteria 4124669
503 2643914232 2643221581 Bacteria 3893603
504 2738824882 2738541297 Bacteria 6549566
505 2739148679 2738541357 Bacteria 6549408
506 2739190598 2738543003 Bacteria 6549560
507 2739250052 2738543013 Bacteria 5618633
508 2739317075 2738543026 Bacteria 6549408
509 2739335316 2738543029 Bacteria 6549249
510 2765570691 2765235838 Bacteria 5445269
511 2821135083 2821131069 Bacteria 6108407
512 2831868047 2831864461 Bacteria 6502356
513 2839098243 2839094727 Bacteria 5534556
514 2842734614 2842733646 Bacteria 5716726
515 2857557979 2857553236 Bacteria 6166726
516 2857558901 2857558681 Bacteria 6617694
517 2857569559 2857564685 Bacteria 6290584
518 2857577637 2857576091 Bacteria 5465855
519 2884340533 2884338543 Bacteria 4610696
520 2884813473 2884811622 Bacteria 5552861
521 2884813510 2884811622 Bacteria 5552861
522 2884838319 2884836552 Bacteria 5219991
523 2884854611 2884852848 Bacteria 5221161
524 2896156721 2896154374 Bacteria 5221518
525 2919049770 2919046199 Bacteria 5567169
526 2919405484 2919404418 Bacteria 4232372
527 2929218733 2929212328 Bacteria 7708288
528 2941475023 2941471342 Bacteria 5018624
529 8056182458 8056177738 Bacteria 6748268
530 Ga0495643_0098401
531 JGI24736J21556_1002945
532 JGI24747J21853_1007183
533 JGI24738J21930_10006547
534 JGI24744J21845_10000494
535 JGI24742J22300_10004056
536 rootH1_10141630
537 rootH2_10108600
538 rootL2_10090460
539 rootH1_10008264
540 rootH1_10074584
541 rootH1_10264052
542 Ga0055526_1000037
543 Ga0055526_1000393
544 Ga0055526_1003157
545 Ga0055537_1000318
546 Ga0055537_1008822
547 Ga0055524_1002369
548 Ga0055536_1022238
549 Ga0055534_1000205
550 Ga0055528_1000147
551 Ga0065165_1000647
552 Ga0065165_1001648
553 Ga0070690_100003241
554 Ga0070670_100120282
555 Ga0068869_100060697
556 Ga0070680_100459118
557 Ga0070682_100015137
558 Ga0070682_100107522
559 Ga0068868_100014071
560 Ga0070660_100089778
561 Ga0070689_100006530
562 Ga0070691_10015879
563 Ga0070668_100006101
564 Ga0070668_100033574
565 Ga0070669_100003040
566 Ga0070669_100058983
567 Ga0070675_100121766
568 Ga0070674_100002890
569 Ga0070688_100012171
570 Ga0070667_100000048
571 Ga0070667_100001462
572 Ga0070709_10023381
573 Ga0070710_10004968
574 Ga0070701_10000380
575 Ga0070711_100006956
576 Ga0070705_100005882
577 Ga0070700_100006692
578 Ga0070694_100031566
579 Ga0070663_100018399
580 Ga0070663_100296888
581 Ga0070678_100006572
582 Ga0070678_100133345
583 Ga0070662_100026725
584 Ga0068867_100008355
585 Ga0068853_100013033
586 Ga0068853_100308498
587 Ga0070672_100073241
588 Ga0070686_100066303
589 Ga0070695_100027842
590 Ga0070696_100005908
591 Ga0070693_100010229
592 Ga0070665_100006758
593 Ga0070704_100005031
594 Ga0068855_100119549
595 Ga0068857_100308412
596 Ga0068854_100001044
597 Ga0068856_100344791
598 Ga0070702_100056575
599 Ga0068859_100005079
600 Ga0068859_100005647
601 Ga0068861_100001065
602 Ga0068863_100001920
603 Ga0068858_100003845
604 Ga0068860_100000225
605 Ga0068862_100000018
606 Ga0068862_100052095
607 Ga0075365_10138535
608 Ga0075363_100049174
609 Ga0075364_10084175
610 Ga0075364_10300958
611 Ga0070715_10048520
612 Ga0070712_100006806
613 Ga0075362_10073298
614 Ga0097621_100018442
615 Ga0075370_10003740
616 Ga0068865_100019138
617 Ga0097620_100005079
618 Ga0097620_100005647
619 Ga0099824_1013930
620 Ga0099826_10000037
621 Ga0105251_10158028
622 Ga0105250_10030785
623 Ga0105240_10008507
624 Ga0105245_10006218
625 Ga0105247_10000011
626 Ga0105247_10041992
627 Ga0105248_10000057
628 Ga0105248_10044088
629 Ga0105248_10359143
630 Ga0105237_10004991
631 Ga0105237_10030417
632 Ga0105237_10250836
633 Ga0105238_10030755
634 Ga0105238_10036616
635 Ga0105238_10139611
636 Ga0105238_10155168
637 Ga0105249_10000088
638 Ga0105239_10014265
639 Ga0105239_10037695
640 Ga0105239_10114056
641 Ga0157373_10028776
642 Ga0157373_10060329
643 Ga0157370_10008332
644 Ga0157370_10334752
645 Ga0157370_10459999
646 Ga0157369_10000504
647 Ga0157374_10399266
648 Ga0157378_10013820
649 Ga0163162_10068943
650 Ga0157372_10014981
651 Ga0157375_10005994
652 Ga0157380_10005044
653 Ga0157379_10011519
654 Ga0157379_10087815
655 Ga0157376_10065773
656 Ga0182006_1000005
657 Ga0182007_10009355
658 Ga0182005_1003775
659 Ga0163161_10004568
660 Ga0163161_10078844
661 Ga0163161_10254460
662 Ga0213872_10000010
663 Ga0213872_10003141
664 Ga0213872_10017196
665 Ga0213872_10026819
666 Ga0213872_10040813
667 Ga0213872_10053702
668 Ga0209563_100014
669 Ga0209437_100261
670 Ga0209759_1008141
671 Ga0209565_1000003
672 Ga0209565_1001886
673 Ga0209673_1000003
674 Ga0209673_1008317
675 Ga0209673_1022788
676 Ga0209673_1045860
677 Ga0209675_1000003
678 Ga0209676_1003218
679 Ga0209025_1003122
680 Ga0209564_1000012
681 Ga0209564_1000021
682 Ga0209564_1000042
683 Ga0209256_1000407
684 Ga0209256_1000431
685 Ga0209256_1022521
686 Ga0209051_1004935
687 Ga0209051_1014281
688 Ga0209051_1017490
689 Ga0207696_1056654
690 Ga0207713_1103363
691 Ga0207710_10000067
692 Ga0207710_10020967
693 Ga0207710_10080365
694 Ga0207688_10002438
695 Ga0207647_10000234
696 Ga0207699_10089820
697 Ga0207645_10012012
698 Ga0207695_10001990
699 Ga0207695_10007168
700 Ga0207671_10022278
701 Ga0207693_10009542
702 Ga0207663_10009577
703 Ga0207660_10267792
704 Ga0207681_10016503
705 Ga0207681_10072379
706 Ga0207694_10157508
707 Ga0207694_10162883
708 Ga0207694_10306538
709 Ga0207650_10091183
710 Ga0207687_10000859
711 Ga0207644_10312834
712 Ga0207706_10004732
713 Ga0207709_10006459
714 Ga0207670_10011349
715 Ga0207669_10001748
716 Ga0207711_10000308
717 Ga0207711_10787619
718 Ga0207689_10080210
719 Ga0207667_10368163
720 Ga0207712_10000064
721 Ga0207712_10092029
722 Ga0207668_10008721
723 Ga0207668_10023510
724 Ga0207640_10008831
725 Ga0207658_10000861
726 Ga0207658_10014905
727 Ga0207677_10009187
728 Ga0207703_10025368
729 Ga0207703_10130160
730 Ga0207678_10022195
731 Ga0207678_10062612
732 Ga0207708_10008069
733 Ga0207702_10299855
734 Ga0207641_10000963
735 Ga0207648_10008860
736 Ga0207675_100000724
737 Ga0207683_10000586
738 Ga0207683_10080394
739 Ga0207698_10111404
740 Ga0207698_10143801
741 Ga0209489_116764
742 Ga0209282_1000010
743 Ga0209282_1000096
744 Ga0268266_10008866
745 Ga0268265_10000005
746 Ga0268264_10000148
747 Ga0268264_10010253
748 Ga0307511_10019427
749 Ga0265327_10000773
750 Ga0307514_10001002
751 Ga0307510_10147562
752 Ga0373962_0046753
753 Ga0373931_0013092
754 Ga0436361_0067060
755 Ga0436361_0081535
756 Ga0436361_0506702
757 Ga0436361_0747616
758 Ga0436361_1098331
759 Ga0439445_0005999
760 Ga0451576_0021968
761 Ga0495617_000006
762 Ga0495617_000601
763 Ga0495617_000687
764 Ga0495617_047942
765 Ga0495627_006541
766 Ga0495590_0019607
767 Ga0495590_0070771
768 Ga0495591_002219
769 Ga0495591_007523
770 Ga0495591_052095
771 Ga0495638_0001330
772 Ga0495638_0026394
773 Ga0495638_0106202
774 Ga0495638_0380899
775 Ga0495653_0000089
776 Ga0495653_0190080
777 Ga0495650_0001062
778 Ga0495650_0007881
779 Ga0495650_0022518
780 Ga0495650_0045691
781 Ga0495605_0000017
782 Ga0495605_0000018
783 Ga0495605_0008912
784 Ga0495605_0050761
785 Ga0495639_0154485
786 Ga0495584_0041506
787 Ga0495584_0104755
788 Ga0495584_0177550
789 Ga0495585_0000120
790 Ga0495585_0000714
791 Ga0495585_0027641
792 Ga0495596_0000043
793 Ga0495596_0014141
794 Ga0495607_0000022
795 Ga0495607_0008745
796 Ga0495607_0017598
797 Ga0495607_0017773
798 Ga0495607_0041034
799 Ga0495607_0042031
800 Ga0495583_0000022
801 Ga0495583_0000722
802 Ga0495583_0001780
803 Ga0495583_0004054
804 Ga0495606_0000063
805 Ga0495606_0000504
806 Ga0495606_0001154
807 Ga0495606_0001174
808 Ga0495606_0002047
809 Ga0495606_0008422
810 Ga0495606_0031570
811 Ga0495606_0054088
812 Ga0495606_0064570
813 Ga0495606_0235986
814 Ga0495610_0000004
815 Ga0495610_0000142
816 Ga0495610_0000184
817 Ga0495610_0002309
818 Ga0495610_0008278
819 Ga0495610_0011016
820 Ga0495610_0075745
821 Ga0495610_0202956
822 Ga0495616_0000315
823 Ga0495616_0014688
824 Ga0495616_0114297
825 Ga0495620_0000105
826 Ga0495620_0119855
827 Ga0495620_0198735
828 Ga0495631_0001917
829 Ga0495631_0057847
830 Ga0495632_0002053
831 Ga0495632_0008305
832 Ga0495632_0018349
833 Ga0495632_0050028
834 Ga0495637_0000050
835 Ga0495637_0000133
836 Ga0495637_0000600
837 Ga0495637_0003053
838 Ga0495637_0006608
839 Ga0495637_0029315
840 Ga0495643_0010542
841 Ga0495643_0023479
842 Ga0495643_0205793
843 Ga0495644_0002830
844 Ga0495644_0009380
845 Ga0495648_0000219
846 Ga0495648_0002400
847 Ga0495648_0012177
848 Ga0495648_0024780
849 Ga0495648_0050211
850 Ga0495654_0000014
851 Ga0495654_0002676
852 Ga0495654_0169045
853 Ga0495609_0000104
854 Ga0495609_0000354
855 Ga0495609_0022764
856 Ga0495621_0085659
857 Ga0495622_0003225
858 Ga0495622_0011921
859 Ga0495622_0038354
860 Ga0495633_0004977
861 Ga0495633_0014262
862 Ga0495668_0000035
863 Ga0495668_0000734
864 Ga0495668_0000892
865 Ga0495668_0012005
866 Ga0495668_0033800
867 Ga0495668_0158839
868 Ga0495611_0000863
869 Ga0495611_0003655
870 Ga0495611_0003960
871 Ga0495611_0086539
872 Ga0495625_0001167
873 Ga0495625_0001475
874 Ga0495625_0015143
875 Ga0495625_0017970
876 Ga0495661_0000156
877 Ga0495661_0004179
878 Ga0495661_0008412
879 Ga0495661_0016051
880 Ga0495661_0022282
881 Ga0495661_0083174
882 Ga0495669_0070622
883 Ga0495669_0242863
884 Ga0495670_0000453
885 Ga0495670_0010796
886 Ga0495670_0213787
887 Ga0495671_0000005
888 Ga0495671_0000726
889 Ga0495671_0008780
890 Ga0495671_0071070
891 Ga0495671_0283744
892 Ga0495649_0012759
893 Ga0495649_0024941
894 Ga0495649_0024984
895 Ga0495649_0029557
896 Ga0495589_0024371
897 Ga0495589_0040764
898 Ga0495660_0000025
899 Ga0495660_0002356
900 Ga0495660_0003496
901 Ga0495660_0006291
902 Ga0495660_0057779
903 Ga0495672_0006653
904 Ga0495672_0007216
905 Ga0495672_0027577
906 Ga0495676_0000043
907 Ga0495683_0006310
908 Ga0495683_0010096
909 Ga0495683_0042759
910 Ga0495679_000049
911 Ga0495685_006823
912 Ga0495673_0000001
913 Ga0495673_0000012
914 Ga0495673_0000335
915 Ga0495673_0002256
916 Ga0495673_0010594
917 Ga0495673_0015373
918 Ga0495673_0111730
919 Ga0495673_0133839
920 Ga0495681_0010790
921 Ga0495681_0016629
922 Ga0495686_0000192
923 Ga0495686_0000879
924 Ga0495686_0003674
925 Ga0495686_0007453
926 Ga0495686_0010404
927 Ga0495626_0000093
928 Ga0496100_0007598
929 Ga0496100_0010526
930 Ga0496101_0002113
931 Ga0496101_0025237
932 Ga0496101_0084601
933 Ga0496101_0263076
934 Ga0496102_0010465
935 Ga0496102_0329894
936 Ga0496103_0000424
937 Ga0496103_0062678
938 Ga0496106_0000195
939 Ga0496106_0010620
940 Ga0496107_0016650
941 Ga0496107_0076400
942 Ga0496108_0008440
943 Ga0496109_0068334
944 Ga0496109_0873831
945 Ga0496110_0038153
946 Ga0496110_0501969
947 Ga0496111_0245590
948 Ga0496112_0002793
949 Ga0496113_0584364
950 Ga0496114_0186093
951 Ga0496114_0671508
952 Ga0496115_0042476
953 Ga0496116_0002637
954 Ga0496116_0005651
955 Ga0496116_0016627
956 Ga0496116_0039331
957 Ga0496116_0096536
958 Ga0496117_0001365
959 Ga0496117_0006712
960 Ga0496117_0075410
961 Ga0496118_0000469
962 Ga0496118_0002456
963 Ga0496118_0003456
964 Ga0496118_0025845
965 Ga0496118_0078850
966 Ga0496119_0028525
967 Ga0496119_0082826
968 Ga0496120_0022825
969 Ga0496121_0000161
970 Ga0496121_0001875
971 Ga0496121_0005009
972 Ga0496121_0014387
973 Ga0496121_0016196
974 Ga0496121_0039858
975 Ga0496121_0078072
976 Ga0496121_0089245
977 Ga0496121_0089930
978 Ga0496121_0093686
979 Ga0496121_0140483
980 Ga0496122_0000225
981 Ga0496122_0025789
982 Ga0496122_0026073
983 Ga0496123_0000192
984 Ga0496123_0000865
985 Ga0496123_0008853
986 Ga0496123_0012552
987 Ga0496123_0032478
988 Ga0496123_0073283
989 Ga0496123_0242155
990 Ga0496124_0000714
991 Ga0496124_0055187
992 Ga0496124_0140945
993 Ga0496124_0169323
994 Ga0496124_0382977
995 Ga0496125_0000947
996 Ga0496125_0010284
997 Ga0496125_0052783
998 Ga0496125_0059503
999 Ga0496126_0009869
1000 Ga0496126_0070665
1001 Ga0496126_0103574
1002 Ga0496126_0159507
1003 Ga0495678_000043
1004 Ga0495678_006360
1005 Ga0495678_025388
1006 Ga0495682_0000355
1007 nmdc:mga03n38_16231_c1
1008 nmdc:mga03n38_7022_c1
1009 nmdc:mga00v17_338690_c1
1010 nmdc:mga0yw44_687686_c1
1011 nmdc:mga0yw44_88709_c1
1012 nmdc:mga07m45_1639_c1
1013 nmdc:mga07m45_38800_c1
1014 Ga0500643_004976
1015 Ga0500594_0087855
1016 Ga0500594_0117310
1017 Ga0500608_023897
1018 Ga0500608_105212
1019 Ga0500618_001982
1020 Ga0500652_043474
1021 Ga0500559_0002004
1022 Ga0500559_0019540
1023 Ga0500559_0042086
1024 Ga0500568_0043541
1025 Ga0500573_0085229
1026 Ga0500627_0123503
1027 Ga0500636_0002776
1028 Ga0500661_008472
1029 2587729689
1030 2588295827
1031 2595452429
1032 2643914232
1033 2738824882
1034 2739148679
1035 2739190598
1036 2739250052
1037 2739317075
1038 2739335316
1039 2765570691
1040 2821135083
1041 2831868047
1042 2839098243
1043 2842734614
1044 2857557979
1045 2857558901
1046 2857569559
1047 2857577637
1048 2884340533
1049 2884813473
1050 2884813510
1051 2884838319
1052 2884854611
1053 2896156721
1054 2919049770
1055 2919405484
1056 2929218733
1057 2941475023
1058 8056182458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

60

256

0.87

PF17124

ThiJ_like

ThiJ/PfpI family-like

57

182

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9533 3 221
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9361 2 225
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.932 2 225
4hcj-assembly1.cif.gz_A crystal structure of thij/pfpi domain protein from brachyspira murdochii 0.9069 1 225
4hcj-assembly1.cif.gz_A crystal structure of thij/pfpi domain protein from brachyspira murdochii 0.9019 1 225
ID Description Score Start End Superfamily
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9681 5 219 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9487 3 221 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9382 5 219 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9345 2 225 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9304 2 225 3.40.50.880
ID Description Score Start End GO Terms
AF-B9TH23-F1-model_v4 Protein SNO4, putative 0.9985 1 192 GO:0005737
GO:0019172
GO:0019243
AF-A0A0S6UUT5-F1-model_v4 Hypothetical 26.0 kDa protein in FET4-ERR1 intergenic region 0.9971 3 222 GO:0005737
GO:0019172
GO:0019243
AF-A0A7W5L2B6-F1-model_v4 Putative intracellular protease/amidase 0.9965 3 225 GO:0005737
GO:0006508
GO:0008233
GO:0019172
GO:0019243
AF-A0A2V3U629-F1-model_v4 Putative intracellular protease/amidase 0.9963 2 224 GO:0005737
GO:0006508
GO:0008233
GO:0019172
GO:0019243
AF-A0A5P2HAV3-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9958 1 221 GO:0005737
GO:0016740
GO:0019172
GO:0019243

Map