metagRoot

F459873

General Info

Members	Datasets	Scaffolds	Average Seq Length
529	274	1058	269

Family's Representative Sequence

Representative Sequence	3300050491\|nmdc:mga00v17_12465_c1\|nmdc:mga00v17_12465_c1_625_1566
Length	313
Sequence	MRHVYDAGAGAARPNRQTGARFLPNGGSVGQTPCVRDTMTREAGSLVPIDLYNNVYADFGSRAEAAVRQAAFGEDIGQSSWMTAAEWLQSADLAGVSAGSHVLEVGSGSGGPAVHLALERGCRVTGVDVNEHGVRNGAQLAAERPVGERVAFQAVDASQPLPFPPDTFDAILSNDAMCHIDNRLDVLRDWRRVLRPGGRMLFTDAMVVTGVVSQEELATRSSIGRYFFVPPGENERLIADAGFTLLSAEDRTGAAEAIARQWHDARERHRDALVAREGDANFSGLQRFLACVHRLSAERRLSRYLYLAAKPLA

Samples

	Sample ID	Description	Type	Environment
1	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
2	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
3	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
6	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
7	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
8	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
9	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
10	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
11	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
12	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
13	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
14	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
15	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
16	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
17	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
18	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
19	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
20	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
21	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
22	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
23	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
24	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
25	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
26	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
27	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
28	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
29	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
30	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
31	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
32	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
33	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
34	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
35	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
36	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
37	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
38	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
39	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
45	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
46	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
47	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
48	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
49	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
50	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
51	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
52	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
53	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
54	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
55	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
56	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
57	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
58	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
59	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
60	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
61	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
62	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
63	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
64	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
65	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
66	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
67	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
68	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
69	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
70	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
71	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
72	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
73	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
74	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
75	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
76	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
77	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
78	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
79	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
80	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
81	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
82	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
83	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
84	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
86	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
87	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
88	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
89	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
90	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
91	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
92	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
93	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
94	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
95	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
96	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
97	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
98	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
99	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
100	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
101	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
102	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
103	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
104	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
105	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
106	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
107	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
108	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
109	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
110	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
111	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
112	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
113	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
114	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
115	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
116	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
117	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
118	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
119	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
120	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
121	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
122	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
123	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
124	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
125	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
126	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
127	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
189	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
193	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
194	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
195	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
196	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
197	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
198	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
199	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
200	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
201	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
202	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
203	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
204	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
205	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
206	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
207	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
208	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
209	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
210	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
211	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
212	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
213	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
214	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
215	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
216	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
217	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
218	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
219	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
220	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
221	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
222	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
223	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
224	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
225	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
226	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
227	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
228	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
229	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
230	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
231	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
232	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
233	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
234	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
235	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
236	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
237	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
238	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
239	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
240	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
241	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
242	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
243	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
244	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
245	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
246	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
247	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
248	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
249	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
250	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
251	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
259	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
261	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
262	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
263	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
264	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
265	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
266	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
267	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
268	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
269	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
270	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
271	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
272	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
273	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
274	2884215851	Edaphobacter sp. 12200R-103	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.62
Metatranscriptomes	0.19
Isolates	0.19

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.78
Nodule	0
Rhizoplane	2.65
Rhizosphere	93.01
Stem	0
Stem Tuber	0
Unclassified	14.37

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	nmdc:mga00v17_12465_c1	3300050491	Bacteria	4693
2	MBSR1b_contig_3247426	2162886012	Bacteria	2762
3	JGI24752J21851_1002128	3300001976	Unclassified	2644
4	JGI24737J22298_10034505	3300001990	Unclassified	1568
5	JGI24743J22301_10001481	3300001991	Bacteria	3259
6	JGI24034J26672_10001803	3300002239	Bacteria	2884
7	JGI24751J29686_10031241	3300002459	Unclassified	1105
8	Ga0065704_10039033	3300005289	Bacteria	1140
9	Ga0065715_10004874	3300005293	Bacteria	3598
10	Ga0065707_10087931	3300005295	Bacteria	4832
11	Ga0065707_10134902	3300005295	Unclassified	1858
12	Ga0070658_10082795	3300005327	Bacteria	2637
13	Ga0070676_10002402	3300005328	Bacteria	9594
14	Ga0070676_10020135	3300005328	Bacteria	3719
15	Ga0070676_10208098	3300005328	Bacteria	1286
16	Ga0070683_100005098	3300005329	Bacteria	10922
17	Ga0070683_100070741	3300005329	Bacteria	3255
18	Ga0070683_100108030	3300005329	Bacteria	2624
19	Ga0070690_100021321	3300005330	Bacteria	3954
20	Ga0070690_100049281	3300005330	Bacteria	2684
21	Ga0070690_100091916	3300005330	Bacteria	2000
22	Ga0070670_100555712	3300005331	Bacteria	1024
23	Ga0068869_100038133	3300005334	Bacteria	3422
24	Ga0068869_100040482	3300005334	Unclassified	3332
25	Ga0068869_100070991	3300005334	Unclassified	2578
26	Ga0070666_10008378	3300005335	Bacteria	6416
27	Ga0070666_10228709	3300005335	Bacteria	1313
28	Ga0070666_10265792	3300005335	Bacteria	1217
29	Ga0070680_100080224	3300005336	Bacteria	2691
30	Ga0070680_100184883	3300005336	Bacteria	1755
31	Ga0070682_100019497	3300005337	Unclassified	3979
32	Ga0068868_100015225	3300005338	Bacteria	5685
33	Ga0068868_100055424	3300005338	Bacteria	3127
34	Ga0068868_100094273	3300005338	Bacteria	2415
35	Ga0068868_100103836	3300005338	Bacteria	2303
36	Ga0070660_100002803	3300005339	Bacteria	11982
37	Ga0070660_100007134	3300005339	Bacteria	7768
38	Ga0070689_100000875	3300005340	Bacteria	18757
39	Ga0070689_100055344	3300005340	Bacteria	3074
40	Ga0070691_10031379	3300005341	Bacteria	2492
41	Ga0070691_10073002	3300005341	Unclassified	1667
42	Ga0070687_100010390	3300005343	Bacteria	4025
43	Ga0070661_100020145	3300005344	Bacteria	4755
44	Ga0070661_100022261	3300005344	Bacteria	4537
45	Ga0070661_100053448	3300005344	Bacteria	2956
46	Ga0070661_100357762	3300005344	Bacteria	1147
47	Ga0070668_100012104	3300005347	Bacteria	6425
48	Ga0070675_100005332	3300005354	Bacteria	9829
49	Ga0070675_100008903	3300005354	Bacteria	7801
50	Ga0070675_100733293	3300005354	Unclassified	901
51	Ga0070671_100162278	3300005355	Bacteria	1889
52	Ga0070674_100002171	3300005356	Bacteria	10784
53	Ga0070673_100008692	3300005364	Bacteria	6772
54	Ga0070673_100274460	3300005364	Bacteria	1477
55	Ga0070688_100003079	3300005365	Bacteria	8520
56	Ga0070659_100001041	3300005366	Bacteria	20294
57	Ga0070667_100087245	3300005367	Bacteria	2678
58	Ga0070667_100579795	3300005367	Bacteria	1032
59	Ga0070703_10075375	3300005406	Bacteria	1136
60	Ga0070709_10001988	3300005434	Bacteria	11140
61	Ga0070713_100058417	3300005436	Unclassified	3217
62	Ga0070713_100183796	3300005436	Bacteria	1880
63	Ga0070711_100008362	3300005439	Bacteria	6338
64	Ga0070711_100029989	3300005439	Unclassified	3596
65	Ga0070711_100176235	3300005439	Bacteria	1633
66	Ga0070694_100327937	3300005444	Bacteria	1180
67	Ga0070708_100023402	3300005445	Bacteria	5253
68	Ga0070678_100106618	3300005456	Bacteria	2184
69	Ga0070662_100044085	3300005457	Bacteria	3194
70	Ga0070662_100149718	3300005457	Bacteria	1816
71	Ga0070662_100207552	3300005457	Bacteria	1557
72	Ga0070662_100378398	3300005457	Unclassified	1165
73	Ga0070662_100623614	3300005457	Bacteria	908
74	Ga0070681_10099734	3300005458	Bacteria	2850
75	Ga0070685_10003676	3300005466	Bacteria	7776
76	Ga0070706_100009908	3300005467	Bacteria	8847
77	Ga0070706_100013892	3300005467	Bacteria	7442
78	Ga0070706_100574753	3300005467	Unclassified	1048
79	Ga0070707_100000271	3300005468	Bacteria	51367
80	Ga0070707_100040962	3300005468	Unclassified	4432
81	Ga0070707_100060769	3300005468	Bacteria	3624
82	Ga0070707_100074591	3300005468	Bacteria	3271
83	Ga0070707_100250561	3300005468	Bacteria	1723
84	Ga0070698_100037308	3300005471	Bacteria	5011
85	Ga0070698_100365990	3300005471	Bacteria	1374
86	Ga0070679_100109987	3300005530	Bacteria	2742
87	Ga0070679_100175984	3300005530	Bacteria	2112
88	Ga0070679_100233051	3300005530	Bacteria	1800
89	Ga0070684_100015235	3300005535	Bacteria	6254
90	Ga0070684_100019344	3300005535	Bacteria	5631
91	Ga0070684_100034079	3300005535	Bacteria	4352
92	Ga0070684_100131826	3300005535	Bacteria	2255
93	Ga0070697_100112119	3300005536	Bacteria	2274
94	Ga0070697_100190305	3300005536	Bacteria	1741
95	Ga0070697_100352315	3300005536	Bacteria	1271
96	Ga0068853_100018453	3300005539	Bacteria	5774
97	Ga0068853_100345866	3300005539	Bacteria	1382
98	Ga0070672_100001909	3300005543	Bacteria	13066
99	Ga0070672_100011483	3300005543	Bacteria	6177
100	Ga0070686_100014266	3300005544	Bacteria	4577
101	Ga0070695_100018210	3300005545	Bacteria	4264
102	Ga0070696_100215576	3300005546	Bacteria	1438
103	Ga0070693_100030746	3300005547	Bacteria	2938
104	Ga0070665_100058802	3300005548	Unclassified	3853
105	Ga0070665_100326749	3300005548	Bacteria	1538
106	Ga0070704_100448075	3300005549	Unclassified	1111
107	Ga0068855_100001183	3300005563	Bacteria	32426
108	Ga0068855_100040756	3300005563	Bacteria	5509
109	Ga0068855_100049496	3300005563	Bacteria	4956
110	Ga0068855_100298370	3300005563	Bacteria	1785
111	Ga0070664_100084680	3300005564	Bacteria	2737
112	Ga0070664_100106109	3300005564	Bacteria	2447
113	Ga0070664_100132809	3300005564	Bacteria	2187
114	Ga0068857_100013448	3300005577	Bacteria	7129
115	Ga0068857_100057269	3300005577	Bacteria	3459
116	Ga0068857_100107286	3300005577	Bacteria	2508
117	Ga0068857_100499102	3300005577	Bacteria	1142
118	Ga0068854_100004678	3300005578	Bacteria	8625
119	Ga0068856_100004782	3300005614	Bacteria	13422
120	Ga0068856_100023007	3300005614	Bacteria	6059
121	Ga0068856_100053294	3300005614	Bacteria	3988
122	Ga0068856_100101985	3300005614	Bacteria	2863
123	Ga0068856_100103199	3300005614	Bacteria	2845
124	Ga0068856_100545767	3300005614	Unclassified	1180
125	Ga0070702_100014074	3300005615	Bacteria	4053
126	Ga0070702_100026423	3300005615	Bacteria	3119
127	Ga0070702_100101998	3300005615	Bacteria	1762
128	Ga0068852_100010336	3300005616	Bacteria	6969
129	Ga0068859_100102991	3300005617	Bacteria	2912
130	Ga0068859_100141102	3300005617	Bacteria	2483
131	Ga0068859_100142152	3300005617	Bacteria	2473
132	Ga0068859_100306768	3300005617	Bacteria	1681
133	Ga0068864_100011549	3300005618	Bacteria	7297
134	Ga0068864_100044150	3300005618	Bacteria	3819
135	Ga0068864_100111839	3300005618	Bacteria	2434
136	Ga0068864_100169761	3300005618	Bacteria	1988
137	Ga0068866_10000995	3300005718	Bacteria	12438
138	Ga0068866_10155920	3300005718	Bacteria	1327
139	Ga0068861_100030616	3300005719	Bacteria	3946
140	Ga0068851_10008126	3300005834	Unclassified	4843
141	Ga0068851_10021035	3300005834	Bacteria	3165
142	Ga0068870_10000744	3300005840	Bacteria	12541
143	Ga0068870_10214364	3300005840	Bacteria	1175
144	Ga0068863_100013713	3300005841	Bacteria	7813
145	Ga0068863_100433661	3300005841	Bacteria	1288
146	Ga0068858_100110687	3300005842	Bacteria	2564
147	Ga0068860_100065324	3300005843	Bacteria	3456
148	Ga0068860_100069695	3300005843	Bacteria	3343
149	Ga0081455_10006738	3300005937	Bacteria	12263
150	Ga0070717_10000863	3300006028	Bacteria	20058
151	Ga0070717_10315827	3300006028	Bacteria	1391
152	Ga0075365_10000517	3300006038	Bacteria	14757
153	Ga0075365_10020776	3300006038	Bacteria	4079
154	Ga0075363_100064101	3300006048	Unclassified	1985
155	Ga0075364_10001498	3300006051	Bacteria	12712
156	Ga0075364_10006634	3300006051	Bacteria	6819
157	Ga0070716_100001583	3300006173	Bacteria	10231
158	Ga0070716_100086727	3300006173	Unclassified	1884
159	Ga0070712_100029823	3300006175	Bacteria	3660
160	Ga0070712_100033445	3300006175	Unclassified	3479
161	Ga0070712_100160410	3300006175	Bacteria	1736
162	Ga0070712_100166234	3300006175	Unclassified	1708
163	Ga0075362_10008142	3300006177	Bacteria	4000
164	Ga0075367_10005825	3300006178	Bacteria	6172
165	Ga0075366_10008829	3300006195	Bacteria	5614
166	Ga0075366_10030016	3300006195	Bacteria	3195
167	Ga0097621_100000234	3300006237	Bacteria	37180
168	Ga0097621_100029876	3300006237	Bacteria	4308
169	Ga0075370_10005588	3300006353	Bacteria	6270
170	Ga0068871_100000528	3300006358	Bacteria	26133
171	Ga0068871_100003295	3300006358	Bacteria	11080
172	Ga0068871_100093903	3300006358	Bacteria	2503
173	Ga0075428_100032195	3300006844	Bacteria	5792
174	Ga0075430_100064992	3300006846	Bacteria	3066
175	Ga0075430_100113642	3300006846	Unclassified	2257
176	Ga0075431_100077895	3300006847	Unclassified	3421
177	Ga0075434_100015065	3300006871	Bacteria	7403
178	Ga0075429_100044002	3300006880	Unclassified	3884
179	Ga0075429_100117742	3300006880	Unclassified	2322
180	Ga0075436_100098580	3300006914	Bacteria	2034
181	Ga0097620_100102990	3300006931	Bacteria	2912
182	Ga0097620_100141112	3300006931	Bacteria	2483
183	Ga0097620_100142172	3300006931	Bacteria	2473
184	Ga0097620_100306766	3300006931	Bacteria	1681
185	Ga0075435_100171357	3300007076	Bacteria	1831
186	Ga0075435_100222367	3300007076	Bacteria	1603
187	Ga0105250_10022379	3300009092	Unclassified	2549
188	Ga0105240_10024355	3300009093	Bacteria	7980
189	Ga0105240_10086424	3300009093	Bacteria	3841
190	Ga0105240_10139145	3300009093	Bacteria	2904
191	Ga0111539_10074702	3300009094	Bacteria	3994
192	Ga0111539_10456132	3300009094	Bacteria	1489
193	Ga0105245_10002780	3300009098	Bacteria	15730
194	Ga0105245_10010677	3300009098	Bacteria	7989
195	Ga0105245_10069558	3300009098	Bacteria	3192
196	Ga0105247_10004864	3300009101	Bacteria	8546
197	Ga0105247_10024150	3300009101	Bacteria	3662
198	Ga0114129_10000069	3300009147	Bacteria	93426
199	Ga0114129_10082158	3300009147	Unclassified	4477
200	Ga0114129_10255328	3300009147	Unclassified	2352
201	Ga0105243_10055388	3300009148	Bacteria	3151
202	Ga0105241_10003569	3300009174	Bacteria	11568
203	Ga0105241_10007983	3300009174	Bacteria	7784
204	Ga0105241_10319546	3300009174	Bacteria	1338
205	Ga0105241_10337243	3300009174	Bacteria	1305
206	Ga0105242_10000971	3300009176	Bacteria	22389
207	Ga0105242_10043590	3300009176	Bacteria	3629
208	Ga0105242_10424741	3300009176	Bacteria	1246
209	Ga0105248_10002091	3300009177	Bacteria	22097
210	Ga0105248_10039887	3300009177	Bacteria	5263
211	Ga0105248_10346877	3300009177	Unclassified	1671
212	Ga0105237_10015858	3300009545	Bacteria	7835
213	Ga0105237_10211277	3300009545	Bacteria	1940
214	Ga0105237_10870544	3300009545	Bacteria	908
215	Ga0105238_10045980	3300009551	Bacteria	4408
216	Ga0105238_10047826	3300009551	Bacteria	4312
217	Ga0105238_10052342	3300009551	Bacteria	4104
218	Ga0105238_10073886	3300009551	Unclassified	3403
219	Ga0105249_10017451	3300009553	Bacteria	6371
220	Ga0105249_10035428	3300009553	Bacteria	4527
221	Ga0099796_10063481	3300010159	Bacteria	1315
222	Ga0105239_10037257	3300010375	Bacteria	5333
223	Ga0105239_10058363	3300010375	Bacteria	4235
224	Ga0105239_10135963	3300010375	Unclassified	2736
225	Ga0105246_10000310	3300011119	Bacteria	25833
226	Ga0105246_10017050	3300011119	Bacteria	4613
227	Ga0105246_10134898	3300011119	Bacteria	1849
228	Ga0105246_10183894	3300011119	Bacteria	1612
229	Ga0157373_10004802	3300013100	Bacteria	10172
230	Ga0157373_10081829	3300013100	Bacteria	2276
231	Ga0157371_10012033	3300013102	Bacteria	6633
232	Ga0157371_10019895	3300013102	Bacteria	4946
233	Ga0157371_10035843	3300013102	Bacteria	3554
234	Ga0157370_10003991	3300013104	Bacteria	17154
235	Ga0157369_10017549	3300013105	Bacteria	8043
236	Ga0157369_10027646	3300013105	Bacteria	6285
237	Ga0157369_10079754	3300013105	Bacteria	3505
238	Ga0157369_10110316	3300013105	Bacteria	2925
239	Ga0157369_10173888	3300013105	Bacteria	2268
240	Ga0157374_10007382	3300013296	Bacteria	9375
241	Ga0157374_10093645	3300013296	Bacteria	2869
242	Ga0157374_10182716	3300013296	Bacteria	2049
243	Ga0157374_10238335	3300013296	Bacteria	1788
244	Ga0157374_10711475	3300013296	Bacteria	1018
245	Ga0157378_10000169	3300013297	Bacteria	62092
246	Ga0157378_10109875	3300013297	Bacteria	2526
247	Ga0163162_10026727	3300013306	Bacteria	5707
248	Ga0163162_10206901	3300013306	Unclassified	2091
249	Ga0157372_10002925	3300013307	Bacteria	18438
250	Ga0157372_10005951	3300013307	Bacteria	12965
251	Ga0157372_10015350	3300013307	Bacteria	8209
252	Ga0157372_10040879	3300013307	Bacteria	5124
253	Ga0157372_10050774	3300013307	Bacteria	4613
254	Ga0157372_10058010	3300013307	Bacteria	4327
255	Ga0157372_10106031	3300013307	Bacteria	3215
256	Ga0157375_10059747	3300013308	Bacteria	3778
257	Ga0157375_10229299	3300013308	Bacteria	2016
258	Ga0157375_10709448	3300013308	Unclassified	1159
259	Ga0157375_10878000	3300013308	Bacteria	1042
260	Ga0163163_10015464	3300014325	Bacteria	7056
261	Ga0163163_10056509	3300014325	Bacteria	3879
262	Ga0163163_10374451	3300014325	Bacteria	1481
263	Ga0182008_10002177	3300014497	Bacteria	12462
264	Ga0157377_10001351	3300014745	Bacteria	10531
265	Ga0157377_10094002	3300014745	Bacteria	1775
266	Ga0157379_10052516	3300014968	Bacteria	3641
267	Ga0157376_10003366	3300014969	Bacteria	11002
268	Ga0157376_10035479	3300014969	Bacteria	4034
269	Ga0157376_10037892	3300014969	Bacteria	3920
270	Ga0157376_10057634	3300014969	Bacteria	3250
271	Ga0157376_10198412	3300014969	Bacteria	1844
272	Ga0163161_10005251	3300017792	Bacteria	9015
273	Ga0213876_10012156	3300021384	Bacteria	4585
274	Ga0207697_10006744	3300025315	Bacteria	5166
275	Ga0207656_10006034	3300025321	Unclassified	4334
276	Ga0207656_10016935	3300025321	Bacteria	2846
277	Ga0207653_10118639	3300025885	Bacteria	950
278	Ga0207692_10101529	3300025898	Unclassified	1580
279	Ga0207710_10083015	3300025900	Unclassified	1489
280	Ga0207710_10095414	3300025900	Bacteria	1397
281	Ga0207688_10020215	3300025901	Bacteria	3634
282	Ga0207688_10082728	3300025901	Bacteria	1835
283	Ga0207680_10002941	3300025903	Bacteria	7986
284	Ga0207680_10179983	3300025903	Bacteria	1429
285	Ga0207647_10001252	3300025904	Bacteria	19532
286	Ga0207699_10007007	3300025906	Bacteria	5490
287	Ga0207645_10000252	3300025907	Bacteria	44594
288	Ga0207645_10011224	3300025907	Bacteria	6126
289	Ga0207645_10011677	3300025907	Bacteria	5988
290	Ga0207643_10000915	3300025908	Bacteria	17653
291	Ga0207643_10031482	3300025908	Bacteria	2957
292	Ga0207705_10030079	3300025909	Bacteria	3873
293	Ga0207684_10004554	3300025910	Bacteria	13024
294	Ga0207684_10012738	3300025910	Bacteria	7296
295	Ga0207684_10042263	3300025910	Unclassified	3864
296	Ga0207654_10009522	3300025911	Bacteria	4936
297	Ga0207654_10047102	3300025911	Bacteria	2462
298	Ga0207654_10184172	3300025911	Bacteria	1364
299	Ga0207695_10094635	3300025913	Bacteria	2994
300	Ga0207671_10009720	3300025914	Bacteria	8007
301	Ga0207693_10004046	3300025915	Bacteria	12462
302	Ga0207693_10027111	3300025915	Unclassified	4530
303	Ga0207693_10063443	3300025915	Bacteria	2894
304	Ga0207663_10022095	3300025916	Unclassified	3633
305	Ga0207663_10216800	3300025916	Unclassified	1390
306	Ga0207660_10067137	3300025917	Bacteria	2597
307	Ga0207662_10003938	3300025918	Bacteria	7739
308	Ga0207657_10002694	3300025919	Bacteria	19148
309	Ga0207657_10011766	3300025919	Bacteria	8667
310	Ga0207657_10013701	3300025919	Bacteria	7942
311	Ga0207649_10000124	3300025920	Bacteria	65086
312	Ga0207649_10067927	3300025920	Bacteria	2265
313	Ga0207652_10013888	3300025921	Bacteria	6517
314	Ga0207652_10371906	3300025921	Bacteria	1290
315	Ga0207646_10000054	3300025922	Bacteria	160414
316	Ga0207646_10006918	3300025922	Bacteria	11646
317	Ga0207646_10015243	3300025922	Bacteria	7271
318	Ga0207646_10042846	3300025922	Unclassified	4066
319	Ga0207681_10178855	3300025923	Bacteria	1614
320	Ga0207681_10195853	3300025923	Bacteria	1549
321	Ga0207681_10244906	3300025923	Unclassified	1397
322	Ga0207681_10517551	3300025923	Bacteria	979
323	Ga0207694_10130838	3300025924	Bacteria	2011
324	Ga0207650_10000665	3300025925	Bacteria	27103
325	Ga0207650_10386377	3300025925	Bacteria	1157
326	Ga0207650_10461602	3300025925	Bacteria	1058
327	Ga0207659_10029938	3300025926	Unclassified	3714
328	Ga0207659_10097351	3300025926	Bacteria	2210
329	Ga0207659_10176106	3300025926	Bacteria	1691
330	Ga0207659_10220573	3300025926	Bacteria	1524
331	Ga0207687_10179349	3300025927	Bacteria	1640
332	Ga0207700_10073807	3300025928	Bacteria	2636
333	Ga0207700_10312165	3300025928	Unclassified	1360
334	Ga0207664_10022312	3300025929	Bacteria	4724
335	Ga0207664_10197920	3300025929	Bacteria	1733
336	Ga0207644_10005267	3300025931	Bacteria	8440
337	Ga0207644_10024245	3300025931	Bacteria	4163
338	Ga0207644_10552215	3300025931	Bacteria	953
339	Ga0207690_10084230	3300025932	Bacteria	2228
340	Ga0207690_10582143	3300025932	Unclassified	912
341	Ga0207706_10000296	3300025933	Bacteria	54072
342	Ga0207706_10000375	3300025933	Bacteria	48561
343	Ga0207706_10005408	3300025933	Bacteria	11905
344	Ga0207706_10624225	3300025933	Bacteria	924
345	Ga0207686_10049980	3300025934	Bacteria	2598
346	Ga0207686_10069947	3300025934	Bacteria	2253
347	Ga0207686_10491957	3300025934	Unclassified	950
348	Ga0207709_10156542	3300025935	Bacteria	1584
349	Ga0207670_10012509	3300025936	Bacteria	4968
350	Ga0207670_10024428	3300025936	Bacteria	3776
351	Ga0207704_10076937	3300025938	Viruses	2140
352	Ga0207704_10516681	3300025938	Unclassified	965
353	Ga0207665_10008105	3300025939	Bacteria	6935
354	Ga0207665_10034948	3300025939	Unclassified	3335
355	Ga0207691_10001266	3300025940	Bacteria	25285
356	Ga0207691_10022312	3300025940	Bacteria	5971
357	Ga0207711_10011511	3300025941	Bacteria	7352
358	Ga0207711_10011913	3300025941	Bacteria	7227
359	Ga0207711_10072059	3300025941	Bacteria	3000
360	Ga0207689_10000615	3300025942	Bacteria	34012
361	Ga0207689_10007559	3300025942	Bacteria	9531
362	Ga0207689_10032041	3300025942	Bacteria	4372
363	Ga0207661_10000388	3300025944	Bacteria	28484
364	Ga0207661_10001687	3300025944	Bacteria	15068
365	Ga0207661_10028320	3300025944	Bacteria	4289
366	Ga0207679_10000051	3300025945	Bacteria	111207
367	Ga0207679_10105366	3300025945	Bacteria	2214
368	Ga0207679_10412095	3300025945	Unclassified	1191
369	Ga0207667_10006661	3300025949	Bacteria	13963
370	Ga0207667_10019652	3300025949	Bacteria	7532
371	Ga0207667_10100738	3300025949	Bacteria	2980
372	Ga0207667_10213534	3300025949	Bacteria	1977
373	Ga0207651_10001714	3300025960	Bacteria	10118
374	Ga0207712_10032068	3300025961	Bacteria	3544
375	Ga0207668_10052854	3300025972	Bacteria	2812
376	Ga0207668_10387910	3300025972	Bacteria	1177
377	Ga0207658_10020418	3300025986	Bacteria	4587
378	Ga0207677_10030160	3300026023	Bacteria	3457
379	Ga0207677_10051699	3300026023	Bacteria	2787
380	Ga0207677_10172928	3300026023	Bacteria	1691
381	Ga0207703_10083257	3300026035	Bacteria	2672
382	Ga0207639_10016066	3300026041	Bacteria	5289
383	Ga0207639_10060465	3300026041	Bacteria	2923
384	Ga0207678_10000178	3300026067	Bacteria	54207
385	Ga0207678_10002563	3300026067	Bacteria	16557
386	Ga0207678_10267724	3300026067	Bacteria	1465
387	Ga0207702_10000907	3300026078	Bacteria	30729
388	Ga0207702_10115392	3300026078	Bacteria	2395
389	Ga0207641_10000020	3300026088	Bacteria	286415
390	Ga0207641_10472726	3300026088	Bacteria	1214
391	Ga0207648_10000698	3300026089	Bacteria	37564
392	Ga0207676_10000081	3300026095	Bacteria	92635
393	Ga0207676_10007256	3300026095	Bacteria	7851
394	Ga0207676_10034816	3300026095	Bacteria	3815
395	Ga0207676_10255665	3300026095	Bacteria	1579
396	Ga0207676_10464130	3300026095	Unclassified	1196
397	Ga0207674_10000163	3300026116	Bacteria	79568
398	Ga0207674_10000421	3300026116	Bacteria	55179
399	Ga0207674_10026396	3300026116	Bacteria	6170
400	Ga0207675_100006376	3300026118	Bacteria	11184
401	Ga0207675_100922939	3300026118	Bacteria	890
402	Ga0207683_10002797	3300026121	Bacteria	15233
403	Ga0207683_10072098	3300026121	Bacteria	3055
404	Ga0207683_10105366	3300026121	Unclassified	2521
405	Ga0207698_10041597	3300026142	Bacteria	3426
406	Ga0207698_10337296	3300026142	Bacteria	1418
407	Ga0207428_10010401	3300027907	Bacteria	8312
408	Ga0207428_10012893	3300027907	Bacteria	7329
409	Ga0268266_10008135	3300028379	Bacteria	9365
410	Ga0268266_10226835	3300028379	Bacteria	1719
411	Ga0268266_10280462	3300028379	Bacteria	1549
412	Ga0268265_10060135	3300028380	Unclassified	2910
413	Ga0268264_10104361	3300028381	Unclassified	2470
414	Ga0268264_10240207	3300028381	Bacteria	1677
415	Ga0268264_10410780	3300028381	Bacteria	1303
416	Ga0265760_10012018	3300031090	Bacteria	2475
417	Ga0307409_100381476	3300031995	Bacteria	1340
418	Ga0373954_0000229	3300035118	Bacteria	20393
419	Ga0373955_0132445	3300035172	Archaea	1456
420	Ga0373962_0094767	3300035242	Unclassified	924
421	Ga0373931_0007038	3300035691	Bacteria	5291
422	Ga0373927_0122700	3300035695	Unclassified	1696
423	Ga0373933_0001596	3300035724	Bacteria	13282
424	Ga0373933_0034538	3300035724	Bacteria	2947
425	Ga0373937_0001795	3300036401	Bacteria	18032
426	Ga0373937_0008872	3300036401	Bacteria	8728
427	Ga0395900_0827946	3300037418	Unclassified	852
428	Ga0436364_0626162	3300037853	Bacteria	2411
429	Ga0436365_0393765	3300039437	Bacteria	1176
430	Ga0436362_0222234	3300039453	Unclassified	1559
431	Ga0466964_0056186	3300044706	Bacteria	1627
432	Ga0466967_0030897	3300045976	Bacteria	4501
433	Ga0495603_0030719	3300046455	Bacteria	3235
434	Ga0495629_0143144	3300046459	Bacteria	1663
435	Ga0495638_0090940	3300046460	Bacteria	1839
436	Ga0495651_0024141	3300046462	Bacteria	4730
437	Ga0495653_0033014	3300046463	Unclassified	4105
438	Ga0495650_0001506	3300046471	Bacteria	22209
439	Ga0495580_0039597	3300046472	Bacteria	3372
440	Ga0495580_0106777	3300046472	Bacteria	1945
441	Ga0495580_0141620	3300046472	Bacteria	1667
442	Ga0495580_0225824	3300046472	Unclassified	1286
443	Ga0495585_0034875	3300046492	Bacteria	2845
444	Ga0495585_0209173	3300046492	Unclassified	990
445	Ga0495594_0005714	3300046499	Bacteria	6391
446	Ga0495594_0078883	3300046499	Unclassified	1838
447	Ga0495596_0047215	3300046500	Bacteria	1690
448	Ga0495583_0047981	3300046506	Bacteria	1961
449	Ga0495608_0101743	3300046511	Unclassified	1852
450	Ga0495630_0152026	3300046517	Unclassified	1761
451	Ga0495644_0004849	3300046523	Bacteria	5283
452	Ga0495652_0056328	3300046529	Bacteria	3339
453	Ga0495587_0001452	3300046536	Bacteria	15811
454	Ga0495609_0069959	3300046538	Bacteria	1543
455	Ga0495645_0005663	3300046543	Bacteria	8603
456	Ga0495599_0025916	3300046678	Bacteria	3673
457	Ga0495623_0038585	3300046679	Bacteria	3054
458	Ga0495623_0173637	3300046679	Unclassified	1257
459	Ga0495669_0002410	3300046684	Bacteria	7668
460	Ga0495671_0154297	3300046692	Unclassified	1118
461	Ga0495600_0041107	3300046809	Bacteria	3013
462	Ga0495581_0025824	3300047315	Bacteria	3406
463	Ga0495604_0000609	3300047317	Bacteria	30758
464	Ga0495636_0004621	3300047318	Bacteria	5400
465	Ga0495672_0210810	3300047320	Bacteria	965
466	Ga0495683_0077927	3300047323	Bacteria	1620
467	Ga0495675_0004148	3300047444	Bacteria	8773
468	Ga0495675_0145662	3300047444	Unclassified	1466
469	Ga0495673_0045143	3300047469	Bacteria	1961
470	Ga0495684_0158533	3300047471	Unclassified	1689
471	Ga0495684_0351736	3300047471	Unclassified	1046
472	Ga0495686_0028414	3300047472	Bacteria	3643
473	Ga0495602_0002236	3300048088	Bacteria	19540
474	Ga0496101_0139078	3300048904	Bacteria	1850
475	Ga0496102_0034504	3300048905	Bacteria	4551
476	Ga0496103_0045053	3300048906	Bacteria	2721
477	Ga0496107_0036460	3300048910	Unclassified	3528
478	Ga0496108_0000655	3300048911	Bacteria	26703
479	Ga0496109_0000247	3300048912	Bacteria	51929
480	Ga0496109_0028034	3300048912	Bacteria	5034
481	Ga0496110_0000506	3300048913	Bacteria	26464
482	Ga0496112_0000062	3300048915	Bacteria	72601
483	Ga0496112_0001305	3300048915	Bacteria	18935
484	Ga0496112_0005442	3300048915	Bacteria	11015
485	Ga0496112_0030577	3300048915	Bacteria	5213
486	Ga0496113_0000663	3300048916	Bacteria	17441
487	Ga0496115_0080520	3300048918	Bacteria	2652
488	Ga0501036_0199928	3300049572	Bacteria	1681
489	Ga0501037_0119998	3300049573	Bacteria	1891
490	Ga0501037_0132200	3300049573	Bacteria	1789
491	Ga0501039_0000565	3300049575	Bacteria	26818
492	Ga0501039_0028240	3300049575	Bacteria	4317
493	Ga0501041_0062524	3300049577	Bacteria	2279
494	Ga0501042_0019359	3300049578	Unclassified	4725
495	Ga0501042_0028469	3300049578	Bacteria	3936
496	Ga0501043_0172566	3300049579	Bacteria	1687
497	Ga0501046_0012565	3300049580	Archaea	7201
498	Ga0501046_0046584	3300049580	Bacteria	3441
499	Ga0501048_0064964	3300049582	Bacteria	2580
500	Ga0501081_0102272	3300049743	Bacteria	2027
501	Ga0501035_0077955	3300049822	Bacteria	2928
502	Ga0501035_0236260	3300049822	Bacteria	1556
503	nmdc:mga03683_23819_c1	3300050489	Bacteria	2389
504	nmdc:mga00v17_4427_c1	3300050491	Bacteria	7309
505	nmdc:mga0yw44_298517_c1	3300050492	Unclassified	1079
506	nmdc:mga0yw44_311525_c1	3300050492	Bacteria	1056
507	nmdc:mga0k408_18664_c1	3300050493	Bacteria	3874
508	nmdc:mga0k408_32971_c1	3300050493	Bacteria	2960
509	nmdc:mga06z11_10193_c1	3300050494	Bacteria	3992
510	nmdc:mga07m45_5976_c2	3300050496	Bacteria	5083
511	nmdc:mga05p37_61412_c1	3300050507	Unclassified	4626
512	nmdc:mga05p37_789_c1	3300050507	Bacteria	35253
513	nmdc:mga09592_72308_c1	3300050508	Unclassified	2928
514	nmdc:mga0qj67_122873_c1	3300050509	Unclassified	2100
515	nmdc:mga0qj67_17776_c1	3300050509	Bacteria	5409
516	nmdc:mga0qj67_360587_c1	3300050509	Bacteria	1174
517	nmdc:mga0qj67_424342_c1	3300050509	Bacteria	1072
518	nmdc:mga08y16_30003_c1	3300050511	Bacteria	5726
519	nmdc:mga08y16_47279_c1	3300050511	Bacteria	4504
520	nmdc:mga08y16_6576_c1	3300050511	Bacteria	12183
521	nmdc:mga0n895_13968_c1	3300050512	Bacteria	7273
522	nmdc:mga0n895_171194_c1	3300050512	Bacteria	2203
523	nmdc:mga0rr50_110179_c1	3300050513	Unclassified	2177
524	nmdc:mga0rr50_159302_c1	3300050513	Bacteria	1831
525	nmdc:mga08x19_70385_c1	3300050514	Archaea	2279
526	nmdc:mga08x19_81089_c1	3300050514	Bacteria	2130
527	Ga0495595_0101163	3300053084	Bacteria	1391
528	Ga0500595_000025	3300053119	Bacteria	142073
529	2884218923	2884215851	Bacteria	4554841
530	nmdc:mga00v17_12465_c1
531	MBSR1b_contig_3247426
532	JGI24752J21851_1002128
533	JGI24737J22298_10034505
534	JGI24743J22301_10001481
535	JGI24034J26672_10001803
536	JGI24751J29686_10031241
537	Ga0065704_10039033
538	Ga0065715_10004874
539	Ga0065707_10087931
540	Ga0065707_10134902
541	Ga0070658_10082795
542	Ga0070676_10002402
543	Ga0070676_10020135
544	Ga0070676_10208098
545	Ga0070683_100005098
546	Ga0070683_100070741
547	Ga0070683_100108030
548	Ga0070690_100021321
549	Ga0070690_100049281
550	Ga0070690_100091916
551	Ga0070670_100555712
552	Ga0068869_100038133
553	Ga0068869_100040482
554	Ga0068869_100070991
555	Ga0070666_10008378
556	Ga0070666_10228709
557	Ga0070666_10265792
558	Ga0070680_100080224
559	Ga0070680_100184883
560	Ga0070682_100019497
561	Ga0068868_100015225
562	Ga0068868_100055424
563	Ga0068868_100094273
564	Ga0068868_100103836
565	Ga0070660_100002803
566	Ga0070660_100007134
567	Ga0070689_100000875
568	Ga0070689_100055344
569	Ga0070691_10031379
570	Ga0070691_10073002
571	Ga0070687_100010390
572	Ga0070661_100020145
573	Ga0070661_100022261
574	Ga0070661_100053448
575	Ga0070661_100357762
576	Ga0070668_100012104
577	Ga0070675_100005332
578	Ga0070675_100008903
579	Ga0070675_100733293
580	Ga0070671_100162278
581	Ga0070674_100002171
582	Ga0070673_100008692
583	Ga0070673_100274460
584	Ga0070688_100003079
585	Ga0070659_100001041
586	Ga0070667_100087245
587	Ga0070667_100579795
588	Ga0070703_10075375
589	Ga0070709_10001988
590	Ga0070713_100058417
591	Ga0070713_100183796
592	Ga0070711_100008362
593	Ga0070711_100029989
594	Ga0070711_100176235
595	Ga0070694_100327937
596	Ga0070708_100023402
597	Ga0070678_100106618
598	Ga0070662_100044085
599	Ga0070662_100149718
600	Ga0070662_100207552
601	Ga0070662_100378398
602	Ga0070662_100623614
603	Ga0070681_10099734
604	Ga0070685_10003676
605	Ga0070706_100009908
606	Ga0070706_100013892
607	Ga0070706_100574753
608	Ga0070707_100000271
609	Ga0070707_100040962
610	Ga0070707_100060769
611	Ga0070707_100074591
612	Ga0070707_100250561
613	Ga0070698_100037308
614	Ga0070698_100365990
615	Ga0070679_100109987
616	Ga0070679_100175984
617	Ga0070679_100233051
618	Ga0070684_100015235
619	Ga0070684_100019344
620	Ga0070684_100034079
621	Ga0070684_100131826
622	Ga0070697_100112119
623	Ga0070697_100190305
624	Ga0070697_100352315
625	Ga0068853_100018453
626	Ga0068853_100345866
627	Ga0070672_100001909
628	Ga0070672_100011483
629	Ga0070686_100014266
630	Ga0070695_100018210
631	Ga0070696_100215576
632	Ga0070693_100030746
633	Ga0070665_100058802
634	Ga0070665_100326749
635	Ga0070704_100448075
636	Ga0068855_100001183
637	Ga0068855_100040756
638	Ga0068855_100049496
639	Ga0068855_100298370
640	Ga0070664_100084680
641	Ga0070664_100106109
642	Ga0070664_100132809
643	Ga0068857_100013448
644	Ga0068857_100057269
645	Ga0068857_100107286
646	Ga0068857_100499102
647	Ga0068854_100004678
648	Ga0068856_100004782
649	Ga0068856_100023007
650	Ga0068856_100053294
651	Ga0068856_100101985
652	Ga0068856_100103199
653	Ga0068856_100545767
654	Ga0070702_100014074
655	Ga0070702_100026423
656	Ga0070702_100101998
657	Ga0068852_100010336
658	Ga0068859_100102991
659	Ga0068859_100141102
660	Ga0068859_100142152
661	Ga0068859_100306768
662	Ga0068864_100011549
663	Ga0068864_100044150
664	Ga0068864_100111839
665	Ga0068864_100169761
666	Ga0068866_10000995
667	Ga0068866_10155920
668	Ga0068861_100030616
669	Ga0068851_10008126
670	Ga0068851_10021035
671	Ga0068870_10000744
672	Ga0068870_10214364
673	Ga0068863_100013713
674	Ga0068863_100433661
675	Ga0068858_100110687
676	Ga0068860_100065324
677	Ga0068860_100069695
678	Ga0081455_10006738
679	Ga0070717_10000863
680	Ga0070717_10315827
681	Ga0075365_10000517
682	Ga0075365_10020776
683	Ga0075363_100064101
684	Ga0075364_10001498
685	Ga0075364_10006634
686	Ga0070716_100001583
687	Ga0070716_100086727
688	Ga0070712_100029823
689	Ga0070712_100033445
690	Ga0070712_100160410
691	Ga0070712_100166234
692	Ga0075362_10008142
693	Ga0075367_10005825
694	Ga0075366_10008829
695	Ga0075366_10030016
696	Ga0097621_100000234
697	Ga0097621_100029876
698	Ga0075370_10005588
699	Ga0068871_100000528
700	Ga0068871_100003295
701	Ga0068871_100093903
702	Ga0075428_100032195
703	Ga0075430_100064992
704	Ga0075430_100113642
705	Ga0075431_100077895
706	Ga0075434_100015065
707	Ga0075429_100044002
708	Ga0075429_100117742
709	Ga0075436_100098580
710	Ga0097620_100102990
711	Ga0097620_100141112
712	Ga0097620_100142172
713	Ga0097620_100306766
714	Ga0075435_100171357
715	Ga0075435_100222367
716	Ga0105250_10022379
717	Ga0105240_10024355
718	Ga0105240_10086424
719	Ga0105240_10139145
720	Ga0111539_10074702
721	Ga0111539_10456132
722	Ga0105245_10002780
723	Ga0105245_10010677
724	Ga0105245_10069558
725	Ga0105247_10004864
726	Ga0105247_10024150
727	Ga0114129_10000069
728	Ga0114129_10082158
729	Ga0114129_10255328
730	Ga0105243_10055388
731	Ga0105241_10003569
732	Ga0105241_10007983
733	Ga0105241_10319546
734	Ga0105241_10337243
735	Ga0105242_10000971
736	Ga0105242_10043590
737	Ga0105242_10424741
738	Ga0105248_10002091
739	Ga0105248_10039887
740	Ga0105248_10346877
741	Ga0105237_10015858
742	Ga0105237_10211277
743	Ga0105237_10870544
744	Ga0105238_10045980
745	Ga0105238_10047826
746	Ga0105238_10052342
747	Ga0105238_10073886
748	Ga0105249_10017451
749	Ga0105249_10035428
750	Ga0099796_10063481
751	Ga0105239_10037257
752	Ga0105239_10058363
753	Ga0105239_10135963
754	Ga0105246_10000310
755	Ga0105246_10017050
756	Ga0105246_10134898
757	Ga0105246_10183894
758	Ga0157373_10004802
759	Ga0157373_10081829
760	Ga0157371_10012033
761	Ga0157371_10019895
762	Ga0157371_10035843
763	Ga0157370_10003991
764	Ga0157369_10017549
765	Ga0157369_10027646
766	Ga0157369_10079754
767	Ga0157369_10110316
768	Ga0157369_10173888
769	Ga0157374_10007382
770	Ga0157374_10093645
771	Ga0157374_10182716
772	Ga0157374_10238335
773	Ga0157374_10711475
774	Ga0157378_10000169
775	Ga0157378_10109875
776	Ga0163162_10026727
777	Ga0163162_10206901
778	Ga0157372_10002925
779	Ga0157372_10005951
780	Ga0157372_10015350
781	Ga0157372_10040879
782	Ga0157372_10050774
783	Ga0157372_10058010
784	Ga0157372_10106031
785	Ga0157375_10059747
786	Ga0157375_10229299
787	Ga0157375_10709448
788	Ga0157375_10878000
789	Ga0163163_10015464
790	Ga0163163_10056509
791	Ga0163163_10374451
792	Ga0182008_10002177
793	Ga0157377_10001351
794	Ga0157377_10094002
795	Ga0157379_10052516
796	Ga0157376_10003366
797	Ga0157376_10035479
798	Ga0157376_10037892
799	Ga0157376_10057634
800	Ga0157376_10198412
801	Ga0163161_10005251
802	Ga0213876_10012156
803	Ga0207697_10006744
804	Ga0207656_10006034
805	Ga0207656_10016935
806	Ga0207653_10118639
807	Ga0207692_10101529
808	Ga0207710_10083015
809	Ga0207710_10095414
810	Ga0207688_10020215
811	Ga0207688_10082728
812	Ga0207680_10002941
813	Ga0207680_10179983
814	Ga0207647_10001252
815	Ga0207699_10007007
816	Ga0207645_10000252
817	Ga0207645_10011224
818	Ga0207645_10011677
819	Ga0207643_10000915
820	Ga0207643_10031482
821	Ga0207705_10030079
822	Ga0207684_10004554
823	Ga0207684_10012738
824	Ga0207684_10042263
825	Ga0207654_10009522
826	Ga0207654_10047102
827	Ga0207654_10184172
828	Ga0207695_10094635
829	Ga0207671_10009720
830	Ga0207693_10004046
831	Ga0207693_10027111
832	Ga0207693_10063443
833	Ga0207663_10022095
834	Ga0207663_10216800
835	Ga0207660_10067137
836	Ga0207662_10003938
837	Ga0207657_10002694
838	Ga0207657_10011766
839	Ga0207657_10013701
840	Ga0207649_10000124
841	Ga0207649_10067927
842	Ga0207652_10013888
843	Ga0207652_10371906
844	Ga0207646_10000054
845	Ga0207646_10006918
846	Ga0207646_10015243
847	Ga0207646_10042846
848	Ga0207681_10178855
849	Ga0207681_10195853
850	Ga0207681_10244906
851	Ga0207681_10517551
852	Ga0207694_10130838
853	Ga0207650_10000665
854	Ga0207650_10386377
855	Ga0207650_10461602
856	Ga0207659_10029938
857	Ga0207659_10097351
858	Ga0207659_10176106
859	Ga0207659_10220573
860	Ga0207687_10179349
861	Ga0207700_10073807
862	Ga0207700_10312165
863	Ga0207664_10022312
864	Ga0207664_10197920
865	Ga0207644_10005267
866	Ga0207644_10024245
867	Ga0207644_10552215
868	Ga0207690_10084230
869	Ga0207690_10582143
870	Ga0207706_10000296
871	Ga0207706_10000375
872	Ga0207706_10005408
873	Ga0207706_10624225
874	Ga0207686_10049980
875	Ga0207686_10069947
876	Ga0207686_10491957
877	Ga0207709_10156542
878	Ga0207670_10012509
879	Ga0207670_10024428
880	Ga0207704_10076937
881	Ga0207704_10516681
882	Ga0207665_10008105
883	Ga0207665_10034948
884	Ga0207691_10001266
885	Ga0207691_10022312
886	Ga0207711_10011511
887	Ga0207711_10011913
888	Ga0207711_10072059
889	Ga0207689_10000615
890	Ga0207689_10007559
891	Ga0207689_10032041
892	Ga0207661_10000388
893	Ga0207661_10001687
894	Ga0207661_10028320
895	Ga0207679_10000051
896	Ga0207679_10105366
897	Ga0207679_10412095
898	Ga0207667_10006661
899	Ga0207667_10019652
900	Ga0207667_10100738
901	Ga0207667_10213534
902	Ga0207651_10001714
903	Ga0207712_10032068
904	Ga0207668_10052854
905	Ga0207668_10387910
906	Ga0207658_10020418
907	Ga0207677_10030160
908	Ga0207677_10051699
909	Ga0207677_10172928
910	Ga0207703_10083257
911	Ga0207639_10016066
912	Ga0207639_10060465
913	Ga0207678_10000178
914	Ga0207678_10002563
915	Ga0207678_10267724
916	Ga0207702_10000907
917	Ga0207702_10115392
918	Ga0207641_10000020
919	Ga0207641_10472726
920	Ga0207648_10000698
921	Ga0207676_10000081
922	Ga0207676_10007256
923	Ga0207676_10034816
924	Ga0207676_10255665
925	Ga0207676_10464130
926	Ga0207674_10000163
927	Ga0207674_10000421
928	Ga0207674_10026396
929	Ga0207675_100006376
930	Ga0207675_100922939
931	Ga0207683_10002797
932	Ga0207683_10072098
933	Ga0207683_10105366
934	Ga0207698_10041597
935	Ga0207698_10337296
936	Ga0207428_10010401
937	Ga0207428_10012893
938	Ga0268266_10008135
939	Ga0268266_10226835
940	Ga0268266_10280462
941	Ga0268265_10060135
942	Ga0268264_10104361
943	Ga0268264_10240207
944	Ga0268264_10410780
945	Ga0265760_10012018
946	Ga0307409_100381476
947	Ga0373954_0000229
948	Ga0373955_0132445
949	Ga0373962_0094767
950	Ga0373931_0007038
951	Ga0373927_0122700
952	Ga0373933_0001596
953	Ga0373933_0034538
954	Ga0373937_0001795
955	Ga0373937_0008872
956	Ga0395900_0827946
957	Ga0436364_0626162
958	Ga0436365_0393765
959	Ga0436362_0222234
960	Ga0466964_0056186
961	Ga0466967_0030897
962	Ga0495603_0030719
963	Ga0495629_0143144
964	Ga0495638_0090940
965	Ga0495651_0024141
966	Ga0495653_0033014
967	Ga0495650_0001506
968	Ga0495580_0039597
969	Ga0495580_0106777
970	Ga0495580_0141620
971	Ga0495580_0225824
972	Ga0495585_0034875
973	Ga0495585_0209173
974	Ga0495594_0005714
975	Ga0495594_0078883
976	Ga0495596_0047215
977	Ga0495583_0047981
978	Ga0495608_0101743
979	Ga0495630_0152026
980	Ga0495644_0004849
981	Ga0495652_0056328
982	Ga0495587_0001452
983	Ga0495609_0069959
984	Ga0495645_0005663
985	Ga0495599_0025916
986	Ga0495623_0038585
987	Ga0495623_0173637
988	Ga0495669_0002410
989	Ga0495671_0154297
990	Ga0495600_0041107
991	Ga0495581_0025824
992	Ga0495604_0000609
993	Ga0495636_0004621
994	Ga0495672_0210810
995	Ga0495683_0077927
996	Ga0495675_0004148
997	Ga0495675_0145662
998	Ga0495673_0045143
999	Ga0495684_0158533
1000	Ga0495684_0351736
1001	Ga0495686_0028414
1002	Ga0495602_0002236
1003	Ga0496101_0139078
1004	Ga0496102_0034504
1005	Ga0496103_0045053
1006	Ga0496107_0036460
1007	Ga0496108_0000655
1008	Ga0496109_0000247
1009	Ga0496109_0028034
1010	Ga0496110_0000506
1011	Ga0496112_0000062
1012	Ga0496112_0001305
1013	Ga0496112_0005442
1014	Ga0496112_0030577
1015	Ga0496113_0000663
1016	Ga0496115_0080520
1017	Ga0501036_0199928
1018	Ga0501037_0119998
1019	Ga0501037_0132200
1020	Ga0501039_0000565
1021	Ga0501039_0028240
1022	Ga0501041_0062524
1023	Ga0501042_0019359
1024	Ga0501042_0028469
1025	Ga0501043_0172566
1026	Ga0501046_0012565
1027	Ga0501046_0046584
1028	Ga0501048_0064964
1029	Ga0501081_0102272
1030	Ga0501035_0077955
1031	Ga0501035_0236260
1032	nmdc:mga03683_23819_c1
1033	nmdc:mga00v17_4427_c1
1034	nmdc:mga0yw44_298517_c1
1035	nmdc:mga0yw44_311525_c1
1036	nmdc:mga0k408_18664_c1
1037	nmdc:mga0k408_32971_c1
1038	nmdc:mga06z11_10193_c1
1039	nmdc:mga07m45_5976_c2
1040	nmdc:mga05p37_61412_c1
1041	nmdc:mga05p37_789_c1
1042	nmdc:mga09592_72308_c1
1043	nmdc:mga0qj67_122873_c1
1044	nmdc:mga0qj67_17776_c1
1045	nmdc:mga0qj67_360587_c1
1046	nmdc:mga0qj67_424342_c1
1047	nmdc:mga08y16_30003_c1
1048	nmdc:mga08y16_47279_c1
1049	nmdc:mga08y16_6576_c1
1050	nmdc:mga0n895_13968_c1
1051	nmdc:mga0n895_171194_c1
1052	nmdc:mga0rr50_110179_c1
1053	nmdc:mga0rr50_159302_c1
1054	nmdc:mga08x19_70385_c1
1055	nmdc:mga08x19_81089_c1
1056	Ga0495595_0101163
1057	Ga0500595_000025
1058	2884218923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

103

202

0.97 PF13649

Methyltransf_25

Methyltransferase domain

102

198

0.94 PF13847

Methyltransf_31

Methyltransferase domain

96

229

0.91 PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

81

216

0.89 PF08242

Methyltransf_12

Methyltransferase domain

103

200

0.88 PF13489

Methyltransf_23

Methyltransferase domain

83

271

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3bus-assembly2.cif.gz_B	crystal structure of rebm	0.9243	41	267
2o57-assembly2.cif.gz_C	crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria	0.9003	43	265
5gm2-assembly3.cif.gz_O	crystal structure of methyltransferase tled complexed with sah and teleocidin a1	0.8873	34	266
5gm2-assembly2.cif.gz_L	crystal structure of methyltransferase tled complexed with sah and teleocidin a1	0.8841	34	266
3bus-assembly1.cif.gz_A	crystal structure of rebm	0.8773	30	267

ID	Description	Score	Start	End	Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9215	51	113	3.40.50.150
5gm2R01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9196	41	266	3.40.50.150
af_Q4CM63_15_263_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.911	41	200	3.40.50.150
af_K7KE15_1_124_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9056	43	158	3.40.50.150
af_K7LTE4_237_888_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9038	41	114	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-J9DMY3-F1-model_v4	Cyclopropane-fatty-acyl-phospholipid synthase	0.9584	41	112
AF-A0A3C1Q3W0-F1-model_v4	Cyclopropane-fatty-acyl-phospholipid synthase	0.9536	40	112	GO:0008168 GO:0008610 GO:0032259
AF-A0A7Y3BP58-F1-model_v4	SAM-dependent methyltransferase Erg6/SMT-type domain-containing protein	0.9517	41	112	GO:0003838 GO:0016126
AF-C6H5G6-F1-model_v4	Sterol 24-C-methyltransferase	0.9299	41	170	GO:0003838 GO:0005783 GO:0006696 GO:0032259
AF-K8ED88-F1-model_v4	Sarcosine-dimethylglycine methyltransferase	0.912	43	266	GO:0008168 GO:0032259

Map