F459879
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 234 | 528 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300053090|Ga0500646_0012065|Ga0500646_0012065_839_1747 |
| Length | 302 |
| Sequence | MQQEVVTKSSSFKLADKLRDYMMLVKFSLTTMVVFSAVVSFLLVPGNHFNGKMMLLLFIAGFLVTGSANTINQVVEKDTDALMKRTAKRPVASGRMSTSEGYAFAIITGVLGVLMLWHFFNFTSAALAAFSLFLYAFIYTPLKKLNSISVLVGAVPGALPCLIGWTAGFYSDTVSWGGGWVLFGIQFFWQFPHFWAIAWLAHKDYSNAGFRLLPSVEGPTKYSAIQSIIYSLLLIPVGLLPYFTGMSGQVSLIIVLIANIFMIWQSVRLYREMEPKAARRVMFSSYIYLPIVLLALLMDKIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 160 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 161 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 162 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 163 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 164 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 165 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 166 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 167 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 190 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 201 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 202 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 203 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 205 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 208 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 209 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 210 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 211 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 226 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 227 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 228 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 229 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 230 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 231 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 232 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 233 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 234 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.21 |
| Nodule | 0 |
| Rhizoplane | 0.76 |
| Rhizosphere | 94.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000706 | 3300000545 | Bacteria | 2171 |
| 2 | rootH1_10041265 | 3300003323 | Bacteria | 2808 |
| 3 | rootH1_10369669 | 3300003323 | Bacteria | 1562 |
| 4 | Ga0065704_10095532 | 3300005289 | Bacteria | 2483 |
| 5 | Ga0065712_10001960 | 3300005290 | Bacteria | 13513 |
| 6 | Ga0065712_10089166 | 3300005290 | Bacteria | 2483 |
| 7 | Ga0065715_10097208 | 3300005293 | Bacteria | 3745 |
| 8 | Ga0065715_10124554 | 3300005293 | Bacteria | 2142 |
| 9 | Ga0065707_10002043 | 3300005295 | Bacteria | 6348 |
| 10 | Ga0065707_10119468 | 3300005295 | Bacteria | 2159 |
| 11 | Ga0070658_10020785 | 3300005327 | Bacteria | 5260 |
| 12 | Ga0070658_10345393 | 3300005327 | Bacteria | 1273 |
| 13 | Ga0070676_10014319 | 3300005328 | Bacteria | 4359 |
| 14 | Ga0070676_10247992 | 3300005328 | Bacteria | 1187 |
| 15 | Ga0070683_100191390 | 3300005329 | Bacteria | 1942 |
| 16 | Ga0070690_100096016 | 3300005330 | Bacteria | 1958 |
| 17 | Ga0070670_100038566 | 3300005331 | Bacteria | 4109 |
| 18 | Ga0070670_100317742 | 3300005331 | Bacteria | 1364 |
| 19 | Ga0070670_100455286 | 3300005331 | Bacteria | 1134 |
| 20 | Ga0070677_10057641 | 3300005333 | Bacteria | 1592 |
| 21 | Ga0070677_10126152 | 3300005333 | Bacteria | 1162 |
| 22 | Ga0068869_100015272 | 3300005334 | Bacteria | 5147 |
| 23 | Ga0068869_100016680 | 3300005334 | Bacteria | 4954 |
| 24 | Ga0068869_100027016 | 3300005334 | Bacteria | 3999 |
| 25 | Ga0068869_100074258 | 3300005334 | Bacteria | 2523 |
| 26 | Ga0068869_100103944 | 3300005334 | Bacteria | 2153 |
| 27 | Ga0070666_10002756 | 3300005335 | Bacteria | 10618 |
| 28 | Ga0070666_10058363 | 3300005335 | Bacteria | 2609 |
| 29 | Ga0068868_100007171 | 3300005338 | Bacteria | 7920 |
| 30 | Ga0068868_100008105 | 3300005338 | Bacteria | 7514 |
| 31 | Ga0068868_100013885 | 3300005338 | Bacteria | 5920 |
| 32 | Ga0068868_100093805 | 3300005338 | Bacteria | 2420 |
| 33 | Ga0068868_100244249 | 3300005338 | Bacteria | 1509 |
| 34 | Ga0070689_100018288 | 3300005340 | Bacteria | 5161 |
| 35 | Ga0070689_100138505 | 3300005340 | Bacteria | 1955 |
| 36 | Ga0070687_100015995 | 3300005343 | Bacteria | 3407 |
| 37 | Ga0070661_100019264 | 3300005344 | Bacteria | 4862 |
| 38 | Ga0070661_100058296 | 3300005344 | Bacteria | 2830 |
| 39 | Ga0070661_100070753 | 3300005344 | Bacteria | 2566 |
| 40 | Ga0070668_100009928 | 3300005347 | Bacteria | 7051 |
| 41 | Ga0070668_100027115 | 3300005347 | Bacteria | 4348 |
| 42 | Ga0070669_100006130 | 3300005353 | Bacteria | 8681 |
| 43 | Ga0070669_100037400 | 3300005353 | Bacteria | 3521 |
| 44 | Ga0070669_100340325 | 3300005353 | Unclassified | 1215 |
| 45 | Ga0070669_100511574 | 3300005353 | Bacteria | 997 |
| 46 | Ga0070675_100008867 | 3300005354 | Bacteria | 7819 |
| 47 | Ga0070675_100022703 | 3300005354 | Bacteria | 5013 |
| 48 | Ga0070675_100046846 | 3300005354 | Bacteria | 3542 |
| 49 | Ga0070675_100048483 | 3300005354 | Bacteria | 3483 |
| 50 | Ga0070675_100055342 | 3300005354 | Bacteria | 3265 |
| 51 | Ga0070675_100063944 | 3300005354 | Bacteria | 3042 |
| 52 | Ga0070675_100243738 | 3300005354 | Bacteria | 1571 |
| 53 | Ga0070671_100045722 | 3300005355 | Bacteria | 3639 |
| 54 | Ga0070671_100153881 | 3300005355 | Unclassified | 1942 |
| 55 | Ga0070671_100374770 | 3300005355 | Bacteria | 1216 |
| 56 | Ga0070671_100407822 | 3300005355 | Bacteria | 1163 |
| 57 | Ga0070674_100049306 | 3300005356 | Bacteria | 2894 |
| 58 | Ga0070673_100004569 | 3300005364 | Bacteria | 8773 |
| 59 | Ga0070673_100007203 | 3300005364 | Bacteria | 7314 |
| 60 | Ga0070673_100025956 | 3300005364 | Bacteria | 4320 |
| 61 | Ga0070673_100111691 | 3300005364 | Bacteria | 2268 |
| 62 | Ga0070688_100012159 | 3300005365 | Bacteria | 4813 |
| 63 | Ga0070688_100029947 | 3300005365 | Bacteria | 3263 |
| 64 | Ga0070688_100031379 | 3300005365 | Bacteria | 3196 |
| 65 | Ga0070688_100076558 | 3300005365 | Bacteria | 2153 |
| 66 | Ga0070688_100228082 | 3300005365 | Bacteria | 1316 |
| 67 | Ga0070659_100075000 | 3300005366 | Bacteria | 2696 |
| 68 | Ga0070667_100001797 | 3300005367 | Bacteria | 19092 |
| 69 | Ga0070667_100039008 | 3300005367 | Bacteria | 3982 |
| 70 | Ga0070667_100071668 | 3300005367 | Bacteria | 2951 |
| 71 | Ga0070667_100074788 | 3300005367 | Bacteria | 2890 |
| 72 | Ga0070667_100151519 | 3300005367 | Bacteria | 2037 |
| 73 | Ga0070667_100245029 | 3300005367 | Bacteria | 1601 |
| 74 | Ga0070701_10214139 | 3300005438 | Bacteria | 1145 |
| 75 | Ga0070663_100202543 | 3300005455 | Bacteria | 1550 |
| 76 | Ga0070678_100043720 | 3300005456 | Bacteria | 3194 |
| 77 | Ga0070678_100046095 | 3300005456 | Bacteria | 3123 |
| 78 | Ga0070678_100046738 | 3300005456 | Bacteria | 3106 |
| 79 | Ga0070662_100010103 | 3300005457 | Bacteria | 6184 |
| 80 | Ga0070662_100011969 | 3300005457 | Bacteria | 5738 |
| 81 | Ga0070662_100013705 | 3300005457 | Bacteria | 5400 |
| 82 | Ga0070662_100254106 | 3300005457 | Bacteria | 1414 |
| 83 | Ga0068867_100055002 | 3300005459 | Bacteria | 2941 |
| 84 | Ga0070685_10003854 | 3300005466 | Bacteria | 7589 |
| 85 | Ga0070685_10024747 | 3300005466 | Bacteria | 3300 |
| 86 | Ga0070685_10304188 | 3300005466 | Bacteria | 1075 |
| 87 | Ga0070685_10313348 | 3300005466 | Bacteria | 1061 |
| 88 | Ga0070698_100289902 | 3300005471 | Bacteria | 1568 |
| 89 | Ga0070684_100012518 | 3300005535 | Bacteria | 6803 |
| 90 | Ga0070684_100021281 | 3300005535 | Bacteria | 5394 |
| 91 | Ga0070684_100190517 | 3300005535 | Bacteria | 1866 |
| 92 | Ga0070684_100521868 | 3300005535 | Unclassified | 1101 |
| 93 | Ga0068853_100026519 | 3300005539 | Bacteria | 4866 |
| 94 | Ga0068853_100172361 | 3300005539 | Bacteria | 1958 |
| 95 | Ga0070672_100005202 | 3300005543 | Bacteria | 8607 |
| 96 | Ga0070672_100056859 | 3300005543 | Bacteria | 3069 |
| 97 | Ga0070686_100288168 | 3300005544 | Unclassified | 1213 |
| 98 | Ga0068855_100001990 | 3300005563 | Bacteria | 25375 |
| 99 | Ga0068855_100127618 | 3300005563 | Bacteria | 2907 |
| 100 | Ga0068855_100199390 | 3300005563 | Bacteria | 2254 |
| 101 | Ga0068855_100358101 | 3300005563 | Bacteria | 1606 |
| 102 | Ga0070664_100002665 | 3300005564 | Bacteria | 14400 |
| 103 | Ga0070664_100090677 | 3300005564 | Bacteria | 2645 |
| 104 | Ga0070664_100166405 | 3300005564 | Bacteria | 1954 |
| 105 | Ga0068857_100002147 | 3300005577 | Bacteria | 16027 |
| 106 | Ga0068857_100011198 | 3300005577 | Bacteria | 7801 |
| 107 | Ga0068857_100021713 | 3300005577 | Bacteria | 5648 |
| 108 | Ga0068854_100023210 | 3300005578 | Bacteria | 4235 |
| 109 | Ga0068854_100047100 | 3300005578 | Bacteria | 3072 |
| 110 | Ga0068854_100150145 | 3300005578 | Bacteria | 1796 |
| 111 | Ga0068856_100028452 | 3300005614 | Bacteria | 5458 |
| 112 | Ga0068856_100056543 | 3300005614 | Bacteria | 3871 |
| 113 | Ga0068852_100012296 | 3300005616 | Bacteria | 6492 |
| 114 | Ga0068852_100031270 | 3300005616 | Bacteria | 4391 |
| 115 | Ga0068852_100133886 | 3300005616 | Unclassified | 2286 |
| 116 | Ga0068852_100165662 | 3300005616 | Bacteria | 2068 |
| 117 | Ga0068859_100002273 | 3300005617 | Bacteria | 19500 |
| 118 | Ga0068859_100022848 | 3300005617 | Bacteria | 6271 |
| 119 | Ga0068859_100032409 | 3300005617 | Bacteria | 5250 |
| 120 | Ga0068859_100135588 | 3300005617 | Bacteria | 2534 |
| 121 | Ga0068859_100258939 | 3300005617 | Bacteria | 1831 |
| 122 | Ga0068859_100326181 | 3300005617 | Bacteria | 1629 |
| 123 | Ga0068859_100378117 | 3300005617 | Unclassified | 1512 |
| 124 | Ga0068859_100711870 | 3300005617 | Bacteria | 1094 |
| 125 | Ga0068864_100033309 | 3300005618 | Bacteria | 4380 |
| 126 | Ga0068864_100058674 | 3300005618 | Bacteria | 3327 |
| 127 | Ga0068866_10040342 | 3300005718 | Bacteria | 2310 |
| 128 | Ga0068866_10068080 | 3300005718 | Bacteria | 1871 |
| 129 | Ga0068861_100006143 | 3300005719 | Bacteria | 8170 |
| 130 | Ga0068861_100023330 | 3300005719 | Bacteria | 4462 |
| 131 | Ga0068870_10001114 | 3300005840 | Bacteria | 10708 |
| 132 | Ga0068870_10042382 | 3300005840 | Bacteria | 2370 |
| 133 | Ga0068863_100078523 | 3300005841 | Bacteria | 3126 |
| 134 | Ga0068863_100129113 | 3300005841 | Bacteria | 2413 |
| 135 | Ga0068863_100328153 | 3300005841 | Bacteria | 1487 |
| 136 | Ga0068858_100114610 | 3300005842 | Bacteria | 2518 |
| 137 | Ga0068858_100156333 | 3300005842 | Bacteria | 2146 |
| 138 | Ga0068860_100020848 | 3300005843 | Bacteria | 6350 |
| 139 | Ga0068860_100068417 | 3300005843 | Bacteria | 3374 |
| 140 | Ga0068860_100350084 | 3300005843 | Bacteria | 1454 |
| 141 | Ga0068862_100002954 | 3300005844 | Bacteria | 14850 |
| 142 | Ga0068862_100499200 | 3300005844 | Bacteria | 1155 |
| 143 | Ga0081539_10047752 | 3300005985 | Bacteria | 2441 |
| 144 | Ga0075366_10049791 | 3300006195 | Bacteria | 2487 |
| 145 | Ga0075366_10090574 | 3300006195 | Bacteria | 1832 |
| 146 | Ga0097621_100018519 | 3300006237 | Bacteria | 5323 |
| 147 | Ga0068871_100053443 | 3300006358 | Bacteria | 3274 |
| 148 | Ga0068871_100156147 | 3300006358 | Unclassified | 1948 |
| 149 | Ga0068871_100320111 | 3300006358 | Bacteria | 1365 |
| 150 | Ga0075428_100035534 | 3300006844 | Bacteria | 5493 |
| 151 | Ga0075430_100008274 | 3300006846 | Bacteria | 8783 |
| 152 | Ga0075431_100001819 | 3300006847 | Bacteria | 20141 |
| 153 | Ga0075431_100042240 | 3300006847 | Bacteria | 4701 |
| 154 | Ga0075431_100056175 | 3300006847 | Bacteria | 4061 |
| 155 | Ga0075429_100007759 | 3300006880 | Bacteria | 9319 |
| 156 | Ga0075429_100009788 | 3300006880 | Bacteria | 8312 |
| 157 | Ga0075429_100023082 | 3300006880 | Bacteria | 5394 |
| 158 | Ga0068865_100006196 | 3300006881 | Bacteria | 7291 |
| 159 | Ga0097620_100002273 | 3300006931 | Bacteria | 19500 |
| 160 | Ga0097620_100022848 | 3300006931 | Bacteria | 6271 |
| 161 | Ga0097620_100032409 | 3300006931 | Bacteria | 5250 |
| 162 | Ga0097620_100135583 | 3300006931 | Bacteria | 2534 |
| 163 | Ga0097620_100258957 | 3300006931 | Bacteria | 1831 |
| 164 | Ga0097620_100326190 | 3300006931 | Bacteria | 1629 |
| 165 | Ga0097620_100378104 | 3300006931 | Unclassified | 1512 |
| 166 | Ga0097620_100711878 | 3300006931 | Bacteria | 1094 |
| 167 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 168 | Ga0105240_10316322 | 3300009093 | Bacteria | 1781 |
| 169 | Ga0105240_10323724 | 3300009093 | Bacteria | 1756 |
| 170 | Ga0111539_10016779 | 3300009094 | Bacteria | 9073 |
| 171 | Ga0111539_10082947 | 3300009094 | Bacteria | 3770 |
| 172 | Ga0105245_10046668 | 3300009098 | Bacteria | 3871 |
| 173 | Ga0105247_10014858 | 3300009101 | Bacteria | 4667 |
| 174 | Ga0114129_10004788 | 3300009147 | Bacteria | 19131 |
| 175 | Ga0105241_10000333 | 3300009174 | Bacteria | 35848 |
| 176 | Ga0105241_10001117 | 3300009174 | Bacteria | 20448 |
| 177 | Ga0105241_10042451 | 3300009174 | Bacteria | 3441 |
| 178 | Ga0105241_10062358 | 3300009174 | Bacteria | 2874 |
| 179 | Ga0105241_10093641 | 3300009174 | Bacteria | 2374 |
| 180 | Ga0105242_10012927 | 3300009176 | Bacteria | 6435 |
| 181 | Ga0105242_10123866 | 3300009176 | Unclassified | 2222 |
| 182 | Ga0105242_10216925 | 3300009176 | Bacteria | 1708 |
| 183 | Ga0105242_10376769 | 3300009176 | Bacteria | 1318 |
| 184 | Ga0105242_10492099 | 3300009176 | Bacteria | 1165 |
| 185 | Ga0105242_10507288 | 3300009176 | Bacteria | 1148 |
| 186 | Ga0105248_10432377 | 3300009177 | Bacteria | 1482 |
| 187 | Ga0105237_10002380 | 3300009545 | Bacteria | 23342 |
| 188 | Ga0105237_10005940 | 3300009545 | Bacteria | 13687 |
| 189 | Ga0105237_10014958 | 3300009545 | Bacteria | 8089 |
| 190 | Ga0105237_10018678 | 3300009545 | Bacteria | 7168 |
| 191 | Ga0105237_10173365 | 3300009545 | Bacteria | 2157 |
| 192 | Ga0105238_10017549 | 3300009551 | Bacteria | 7278 |
| 193 | Ga0105238_10103405 | 3300009551 | Bacteria | 2830 |
| 194 | Ga0105238_10273999 | 3300009551 | Bacteria | 1668 |
| 195 | Ga0105249_10001813 | 3300009553 | Bacteria | 18581 |
| 196 | Ga0105249_10078154 | 3300009553 | Bacteria | 3070 |
| 197 | Ga0105249_10112821 | 3300009553 | Bacteria | 2571 |
| 198 | Ga0105249_10124897 | 3300009553 | Bacteria | 2449 |
| 199 | Ga0105249_10782085 | 3300009553 | Bacteria | 1018 |
| 200 | Ga0105239_10007405 | 3300010375 | Bacteria | 12592 |
| 201 | Ga0105239_10009676 | 3300010375 | Bacteria | 10839 |
| 202 | Ga0105239_10015390 | 3300010375 | Bacteria | 8475 |
| 203 | Ga0105239_10170872 | 3300010375 | Bacteria | 2431 |
| 204 | Ga0105246_10001264 | 3300011119 | Bacteria | 14839 |
| 205 | Ga0105246_10079360 | 3300011119 | Bacteria | 2334 |
| 206 | Ga0105246_10162624 | 3300011119 | Bacteria | 1702 |
| 207 | Ga0105246_10186876 | 3300011119 | Bacteria | 1600 |
| 208 | Ga0157370_10004229 | 3300013104 | Bacteria | 16610 |
| 209 | Ga0157374_10002752 | 3300013296 | Bacteria | 14766 |
| 210 | Ga0157374_10038728 | 3300013296 | Unclassified | 4383 |
| 211 | Ga0157374_10073936 | 3300013296 | Bacteria | 3217 |
| 212 | Ga0157374_10135901 | 3300013296 | Bacteria | 2383 |
| 213 | Ga0157374_10215386 | 3300013296 | Bacteria | 1884 |
| 214 | Ga0157378_10112642 | 3300013297 | Bacteria | 2496 |
| 215 | Ga0157378_10121749 | 3300013297 | Bacteria | 2405 |
| 216 | Ga0157378_10183188 | 3300013297 | Unclassified | 1971 |
| 217 | Ga0157378_10206522 | 3300013297 | Bacteria | 1860 |
| 218 | Ga0157378_10208462 | 3300013297 | Unclassified | 1852 |
| 219 | Ga0157378_10298636 | 3300013297 | Bacteria | 1558 |
| 220 | Ga0163162_10000612 | 3300013306 | Bacteria | 33144 |
| 221 | Ga0163162_10001367 | 3300013306 | Bacteria | 22697 |
| 222 | Ga0163162_10001786 | 3300013306 | Bacteria | 20177 |
| 223 | Ga0163162_10165389 | 3300013306 | Unclassified | 2335 |
| 224 | Ga0163162_10171057 | 3300013306 | Bacteria | 2297 |
| 225 | Ga0163162_10197494 | 3300013306 | Bacteria | 2141 |
| 226 | Ga0163162_10199989 | 3300013306 | Bacteria | 2127 |
| 227 | Ga0163162_10475840 | 3300013306 | Bacteria | 1380 |
| 228 | Ga0163162_10599510 | 3300013306 | Bacteria | 1228 |
| 229 | Ga0163162_10632511 | 3300013306 | Bacteria | 1195 |
| 230 | Ga0157372_10000463 | 3300013307 | Bacteria | 44664 |
| 231 | Ga0157372_10181378 | 3300013307 | Bacteria | 2437 |
| 232 | Ga0157372_10462248 | 3300013307 | Unclassified | 1479 |
| 233 | Ga0157372_10554323 | 3300013307 | Bacteria | 1340 |
| 234 | Ga0157375_10009867 | 3300013308 | Bacteria | 8397 |
| 235 | Ga0157375_10020099 | 3300013308 | Bacteria | 6095 |
| 236 | Ga0157375_10035566 | 3300013308 | Bacteria | 4756 |
| 237 | Ga0157375_10055142 | 3300013308 | Bacteria | 3918 |
| 238 | Ga0157375_10121739 | 3300013308 | Bacteria | 2719 |
| 239 | Ga0157375_10161888 | 3300013308 | Bacteria | 2380 |
| 240 | Ga0157375_10181663 | 3300013308 | Bacteria | 2255 |
| 241 | Ga0163163_10001998 | 3300014325 | Bacteria | 17228 |
| 242 | Ga0163163_10141344 | 3300014325 | Bacteria | 2450 |
| 243 | Ga0163163_10339595 | 3300014325 | Bacteria | 1557 |
| 244 | Ga0157380_10000255 | 3300014326 | Bacteria | 31852 |
| 245 | Ga0157380_10304165 | 3300014326 | Bacteria | 1470 |
| 246 | Ga0157377_10000877 | 3300014745 | Bacteria | 12514 |
| 247 | Ga0157377_10023386 | 3300014745 | Bacteria | 3274 |
| 248 | Ga0157377_10050702 | 3300014745 | Bacteria | 2338 |
| 249 | Ga0157379_10037393 | 3300014968 | Bacteria | 4328 |
| 250 | Ga0157379_10081389 | 3300014968 | Bacteria | 2901 |
| 251 | Ga0157379_10422469 | 3300014968 | Bacteria | 1228 |
| 252 | Ga0157376_10007329 | 3300014969 | Bacteria | 7862 |
| 253 | Ga0157376_10026592 | 3300014969 | Bacteria | 4575 |
| 254 | Ga0157376_10133097 | 3300014969 | Unclassified | 2222 |
| 255 | Ga0157376_10184917 | 3300014969 | Bacteria | 1907 |
| 256 | Ga0157376_10212783 | 3300014969 | Bacteria | 1786 |
| 257 | Ga0163161_10024623 | 3300017792 | Bacteria | 4253 |
| 258 | Ga0163161_10070335 | 3300017792 | Bacteria | 2559 |
| 259 | Ga0163161_10073748 | 3300017792 | Bacteria | 2501 |
| 260 | Ga0209646_1001248 | 3300025246 | Bacteria | 7215 |
| 261 | Ga0207666_1006123 | 3300025271 | Bacteria | 1553 |
| 262 | Ga0207697_10042943 | 3300025315 | Bacteria | 1858 |
| 263 | Ga0207697_10054196 | 3300025315 | Bacteria | 1662 |
| 264 | Ga0207656_10020010 | 3300025321 | Bacteria | 2654 |
| 265 | Ga0207682_10015835 | 3300025893 | Bacteria | 2939 |
| 266 | Ga0207642_10004323 | 3300025899 | Bacteria | 4579 |
| 267 | Ga0207642_10041665 | 3300025899 | Bacteria | 2012 |
| 268 | Ga0207710_10001781 | 3300025900 | Bacteria | 10400 |
| 269 | Ga0207688_10003300 | 3300025901 | Bacteria | 8816 |
| 270 | Ga0207680_10007538 | 3300025903 | Bacteria | 5315 |
| 271 | Ga0207680_10079798 | 3300025903 | Bacteria | 2053 |
| 272 | Ga0207647_10004599 | 3300025904 | Bacteria | 10219 |
| 273 | Ga0207645_10003291 | 3300025907 | Bacteria | 12324 |
| 274 | Ga0207645_10005892 | 3300025907 | Bacteria | 8831 |
| 275 | Ga0207643_10017667 | 3300025908 | Bacteria | 3903 |
| 276 | Ga0207643_10069206 | 3300025908 | Bacteria | 2028 |
| 277 | Ga0207705_10114161 | 3300025909 | Bacteria | 1998 |
| 278 | Ga0207705_10281595 | 3300025909 | Bacteria | 1273 |
| 279 | Ga0207684_10498792 | 3300025910 | Bacteria | 1043 |
| 280 | Ga0207654_10000620 | 3300025911 | Bacteria | 20025 |
| 281 | Ga0207654_10024091 | 3300025911 | Bacteria | 3268 |
| 282 | Ga0207654_10026063 | 3300025911 | Bacteria | 3162 |
| 283 | Ga0207654_10078538 | 3300025911 | Bacteria | 1980 |
| 284 | Ga0207695_10003167 | 3300025913 | Bacteria | 23458 |
| 285 | Ga0207695_10018118 | 3300025913 | Bacteria | 8149 |
| 286 | Ga0207695_10029606 | 3300025913 | Bacteria | 6043 |
| 287 | Ga0207671_10002324 | 3300025914 | Bacteria | 20513 |
| 288 | Ga0207671_10002511 | 3300025914 | Bacteria | 19577 |
| 289 | Ga0207671_10008910 | 3300025914 | Bacteria | 8449 |
| 290 | Ga0207662_10046491 | 3300025918 | Bacteria | 2568 |
| 291 | Ga0207649_10068425 | 3300025920 | Bacteria | 2257 |
| 292 | Ga0207649_10284569 | 3300025920 | Bacteria | 1203 |
| 293 | Ga0207681_10016574 | 3300025923 | Bacteria | 4611 |
| 294 | Ga0207681_10173295 | 3300025923 | Unclassified | 1637 |
| 295 | Ga0207681_10397603 | 3300025923 | Bacteria | 1112 |
| 296 | Ga0207694_10005398 | 3300025924 | Bacteria | 9836 |
| 297 | Ga0207694_10102112 | 3300025924 | Bacteria | 2273 |
| 298 | Ga0207650_10022618 | 3300025925 | Bacteria | 4450 |
| 299 | Ga0207650_10031707 | 3300025925 | Bacteria | 3818 |
| 300 | Ga0207650_10182120 | 3300025925 | Bacteria | 1674 |
| 301 | Ga0207650_10203713 | 3300025925 | Bacteria | 1586 |
| 302 | Ga0207650_10374720 | 3300025925 | Bacteria | 1174 |
| 303 | Ga0207659_10015767 | 3300025926 | Bacteria | 4906 |
| 304 | Ga0207659_10021826 | 3300025926 | Bacteria | 4257 |
| 305 | Ga0207659_10045946 | 3300025926 | Bacteria | 3081 |
| 306 | Ga0207659_10096159 | 3300025926 | Bacteria | 2223 |
| 307 | Ga0207659_10108763 | 3300025926 | Bacteria | 2103 |
| 308 | Ga0207644_10250003 | 3300025931 | Unclassified | 1414 |
| 309 | Ga0207690_10262676 | 3300025932 | Bacteria | 1338 |
| 310 | Ga0207706_10004710 | 3300025933 | Bacteria | 12777 |
| 311 | Ga0207706_10015998 | 3300025933 | Bacteria | 6778 |
| 312 | Ga0207706_10019841 | 3300025933 | Bacteria | 6042 |
| 313 | Ga0207706_10054002 | 3300025933 | Bacteria | 3546 |
| 314 | Ga0207706_10258254 | 3300025933 | Bacteria | 1521 |
| 315 | Ga0207706_10347699 | 3300025933 | Bacteria | 1289 |
| 316 | Ga0207686_10029678 | 3300025934 | Bacteria | 3229 |
| 317 | Ga0207686_10090156 | 3300025934 | Unclassified | 2022 |
| 318 | Ga0207686_10178682 | 3300025934 | Bacteria | 1503 |
| 319 | Ga0207686_10264597 | 3300025934 | Bacteria | 1262 |
| 320 | Ga0207670_10016254 | 3300025936 | Bacteria | 4467 |
| 321 | Ga0207670_10076046 | 3300025936 | Bacteria | 2336 |
| 322 | Ga0207670_10180626 | 3300025936 | Bacteria | 1589 |
| 323 | Ga0207670_10263269 | 3300025936 | Bacteria | 1337 |
| 324 | Ga0207669_10037332 | 3300025937 | Bacteria | 2786 |
| 325 | Ga0207704_10038307 | 3300025938 | Bacteria | 2779 |
| 326 | Ga0207704_10090436 | 3300025938 | Bacteria | 2009 |
| 327 | Ga0207704_10165799 | 3300025938 | Bacteria | 1578 |
| 328 | Ga0207691_10031370 | 3300025940 | Bacteria | 4960 |
| 329 | Ga0207691_10039933 | 3300025940 | Bacteria | 4340 |
| 330 | Ga0207691_10042959 | 3300025940 | Bacteria | 4167 |
| 331 | Ga0207691_10065407 | 3300025940 | Bacteria | 3291 |
| 332 | Ga0207711_10338106 | 3300025941 | Bacteria | 1393 |
| 333 | Ga0207689_10001049 | 3300025942 | Bacteria | 26546 |
| 334 | Ga0207689_10010413 | 3300025942 | Bacteria | 8005 |
| 335 | Ga0207689_10012954 | 3300025942 | Bacteria | 7122 |
| 336 | Ga0207689_10023916 | 3300025942 | Bacteria | 5125 |
| 337 | Ga0207689_10031493 | 3300025942 | Bacteria | 4414 |
| 338 | Ga0207689_10037971 | 3300025942 | Bacteria | 3991 |
| 339 | Ga0207689_10067436 | 3300025942 | Bacteria | 2941 |
| 340 | Ga0207689_10168893 | 3300025942 | Bacteria | 1803 |
| 341 | Ga0207661_10053129 | 3300025944 | Bacteria | 3240 |
| 342 | Ga0207661_10072945 | 3300025944 | Bacteria | 2810 |
| 343 | Ga0207679_10001622 | 3300025945 | Bacteria | 14023 |
| 344 | Ga0207679_10058749 | 3300025945 | Bacteria | 2851 |
| 345 | Ga0207679_10070163 | 3300025945 | Bacteria | 2640 |
| 346 | Ga0207679_10239284 | 3300025945 | Bacteria | 1537 |
| 347 | Ga0207667_10001242 | 3300025949 | Bacteria | 31953 |
| 348 | Ga0207667_10018750 | 3300025949 | Bacteria | 7750 |
| 349 | Ga0207667_10020034 | 3300025949 | Bacteria | 7449 |
| 350 | Ga0207651_10005729 | 3300025960 | Bacteria | 6415 |
| 351 | Ga0207651_10047510 | 3300025960 | Bacteria | 2895 |
| 352 | Ga0207651_10107640 | 3300025960 | Bacteria | 2084 |
| 353 | Ga0207651_10344345 | 3300025960 | Bacteria | 1253 |
| 354 | Ga0207712_10015278 | 3300025961 | Bacteria | 4949 |
| 355 | Ga0207712_10047061 | 3300025961 | Bacteria | 2993 |
| 356 | Ga0207712_10102733 | 3300025961 | Bacteria | 2128 |
| 357 | Ga0207712_10133284 | 3300025961 | Bacteria | 1896 |
| 358 | Ga0207668_10048032 | 3300025972 | Bacteria | 2926 |
| 359 | Ga0207668_10158163 | 3300025972 | Bacteria | 1762 |
| 360 | Ga0207640_10032118 | 3300025981 | Bacteria | 3253 |
| 361 | Ga0207640_10248329 | 3300025981 | Bacteria | 1379 |
| 362 | Ga0207658_10022996 | 3300025986 | Bacteria | 4345 |
| 363 | Ga0207658_10068969 | 3300025986 | Bacteria | 2670 |
| 364 | Ga0207658_10209613 | 3300025986 | Bacteria | 1632 |
| 365 | Ga0207658_10424517 | 3300025986 | Bacteria | 1173 |
| 366 | Ga0207677_10007320 | 3300026023 | Bacteria | 6096 |
| 367 | Ga0207677_10044906 | 3300026023 | Bacteria | 2947 |
| 368 | Ga0207677_10198727 | 3300026023 | Bacteria | 1592 |
| 369 | Ga0207677_10252854 | 3300026023 | Unclassified | 1432 |
| 370 | Ga0207677_10295960 | 3300026023 | Bacteria | 1335 |
| 371 | Ga0207703_10175097 | 3300026035 | Bacteria | 1890 |
| 372 | Ga0207639_10021393 | 3300026041 | Bacteria | 4645 |
| 373 | Ga0207639_10127747 | 3300026041 | Bacteria | 2099 |
| 374 | Ga0207639_10183532 | 3300026041 | Bacteria | 1781 |
| 375 | Ga0207678_10119695 | 3300026067 | Bacteria | 2247 |
| 376 | Ga0207702_10050648 | 3300026078 | Bacteria | 3506 |
| 377 | Ga0207702_10084238 | 3300026078 | Bacteria | 2768 |
| 378 | Ga0207641_10000318 | 3300026088 | Bacteria | 59432 |
| 379 | Ga0207641_10100939 | 3300026088 | Unclassified | 2542 |
| 380 | Ga0207641_10116934 | 3300026088 | Bacteria | 2373 |
| 381 | Ga0207648_10005292 | 3300026089 | Bacteria | 13021 |
| 382 | Ga0207648_10006356 | 3300026089 | Bacteria | 11747 |
| 383 | Ga0207648_10182328 | 3300026089 | Bacteria | 1858 |
| 384 | Ga0207676_10265047 | 3300026095 | Bacteria | 1553 |
| 385 | Ga0207674_10000453 | 3300026116 | Bacteria | 53589 |
| 386 | Ga0207674_10002491 | 3300026116 | Bacteria | 23220 |
| 387 | Ga0207674_10037607 | 3300026116 | Bacteria | 5032 |
| 388 | Ga0207674_10296688 | 3300026116 | Bacteria | 1565 |
| 389 | Ga0207675_100000282 | 3300026118 | Bacteria | 48883 |
| 390 | Ga0207675_100012049 | 3300026118 | Bacteria | 8077 |
| 391 | Ga0207683_10000957 | 3300026121 | Bacteria | 26469 |
| 392 | Ga0207683_10003845 | 3300026121 | Bacteria | 13020 |
| 393 | Ga0207683_10017665 | 3300026121 | Bacteria | 6082 |
| 394 | Ga0207698_10018771 | 3300026142 | Bacteria | 4720 |
| 395 | Ga0207698_10018924 | 3300026142 | Bacteria | 4703 |
| 396 | Ga0207698_10022200 | 3300026142 | Bacteria | 4405 |
| 397 | Ga0207698_10089065 | 3300026142 | Bacteria | 2519 |
| 398 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 399 | Ga0268266_10022104 | 3300028379 | Bacteria | 5422 |
| 400 | Ga0268266_10146482 | 3300028379 | Bacteria | 2124 |
| 401 | Ga0268265_10029729 | 3300028380 | Bacteria | 3927 |
| 402 | Ga0268265_10331563 | 3300028380 | Bacteria | 1382 |
| 403 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 404 | Ga0268264_10014694 | 3300028381 | Bacteria | 6433 |
| 405 | Ga0268264_10014908 | 3300028381 | Bacteria | 6385 |
| 406 | Ga0268264_10051437 | 3300028381 | Bacteria | 3433 |
| 407 | Ga0307515_10004954 | 3300028794 | Bacteria | 27162 |
| 408 | Ga0307513_10118555 | 3300031456 | Bacteria | 2621 |
| 409 | Ga0307513_10246855 | 3300031456 | Bacteria | 1585 |
| 410 | Ga0307509_10073328 | 3300031507 | Bacteria | 3564 |
| 411 | Ga0307406_10136073 | 3300031901 | Bacteria | 1732 |
| 412 | Ga0307412_10140120 | 3300031911 | Bacteria | 1770 |
| 413 | Ga0307416_100281525 | 3300032002 | Bacteria | 1640 |
| 414 | Ga0307414_10143496 | 3300032004 | Bacteria | 1873 |
| 415 | Ga0307414_10363021 | 3300032004 | Bacteria | 1247 |
| 416 | Ga0307415_100057989 | 3300032126 | Bacteria | 2664 |
| 417 | Ga0373927_0024799 | 3300035695 | Bacteria | 3919 |
| 418 | Ga0373933_0119857 | 3300035724 | Unclassified | 1647 |
| 419 | Ga0373937_0019641 | 3300036401 | Bacteria | 6049 |
| 420 | Ga0373925_0543544 | 3300037068 | Bacteria | 955 |
| 421 | Ga0439436_0000372 | 3300041404 | Bacteria | 11185 |
| 422 | Ga0451849_0713589 | 3300041505 | Bacteria | 2131 |
| 423 | Ga0439441_001208 | 3300042001 | Bacteria | 3289 |
| 424 | Ga0439457_000079 | 3300042014 | Bacteria | 21395 |
| 425 | Ga0439457_008871 | 3300042014 | Bacteria | 2358 |
| 426 | Ga0450923_003226 | 3300042125 | Bacteria | 2437 |
| 427 | Ga0450897_002901 | 3300042128 | Bacteria | 1332 |
| 428 | Ga0439444_0018094 | 3300042437 | Bacteria | 1217 |
| 429 | Ga0451577_0186842 | 3300042876 | Bacteria | 1869 |
| 430 | Ga0466969_0000869 | 3300044656 | Bacteria | 16375 |
| 431 | Ga0466972_0000049 | 3300044658 | Bacteria | 118829 |
| 432 | Ga0466972_0000640 | 3300044658 | Bacteria | 16947 |
| 433 | Ga0466966_0000096 | 3300044684 | Bacteria | 54307 |
| 434 | Ga0466968_0006651 | 3300044735 | Bacteria | 4366 |
| 435 | Ga0466957_0006774 | 3300044842 | Bacteria | 6474 |
| 436 | Ga0466960_0025224 | 3300044901 | Bacteria | 2689 |
| 437 | Ga0466959_0000014 | 3300045049 | Bacteria | 150962 |
| 438 | Ga0495638_0031164 | 3300046460 | Bacteria | 3428 |
| 439 | Ga0495638_0080380 | 3300046460 | Bacteria | 1981 |
| 440 | Ga0495653_0250432 | 3300046463 | Bacteria | 1176 |
| 441 | Ga0495594_0133025 | 3300046499 | Bacteria | 1409 |
| 442 | Ga0495618_0179204 | 3300046514 | Unclassified | 1347 |
| 443 | Ga0495628_0115970 | 3300046516 | Bacteria | 2057 |
| 444 | Ga0495643_0017227 | 3300046522 | Bacteria | 4227 |
| 445 | Ga0495648_0001979 | 3300046524 | Bacteria | 19467 |
| 446 | Ga0495598_0052181 | 3300046537 | Bacteria | 1235 |
| 447 | Ga0495621_0007054 | 3300046539 | Bacteria | 3310 |
| 448 | Ga0495668_0002514 | 3300046616 | Bacteria | 14989 |
| 449 | Ga0495634_0038674 | 3300046642 | Bacteria | 3252 |
| 450 | Ga0495611_0124335 | 3300046648 | Bacteria | 1203 |
| 451 | Ga0495674_0207469 | 3300047319 | Unclassified | 1624 |
| 452 | Ga0496104_0269251 | 3300048907 | Bacteria | 1616 |
| 453 | Ga0496110_0464666 | 3300048913 | Bacteria | 1153 |
| 454 | Ga0496111_0197353 | 3300048914 | Bacteria | 1496 |
| 455 | Ga0496111_0227246 | 3300048914 | Bacteria | 1386 |
| 456 | Ga0501290_000624 | 3300049513 | Bacteria | 5309 |
| 457 | Ga0501031_0016589 | 3300049568 | Bacteria | 4782 |
| 458 | Ga0501032_0002853 | 3300049569 | Bacteria | 13437 |
| 459 | Ga0501032_0035240 | 3300049569 | Bacteria | 3423 |
| 460 | Ga0501034_0003412 | 3300049571 | Bacteria | 18136 |
| 461 | Ga0501034_0227450 | 3300049571 | Bacteria | 1816 |
| 462 | Ga0501034_0380490 | 3300049571 | Bacteria | 1336 |
| 463 | Ga0501034_0434594 | 3300049571 | Bacteria | 1232 |
| 464 | Ga0501036_0039650 | 3300049572 | Bacteria | 3985 |
| 465 | Ga0501036_0046770 | 3300049572 | Bacteria | 3664 |
| 466 | Ga0501036_0168788 | 3300049572 | Bacteria | 1844 |
| 467 | Ga0501037_0053750 | 3300049573 | Bacteria | 2946 |
| 468 | Ga0501037_0143368 | 3300049573 | Bacteria | 1709 |
| 469 | Ga0501038_0002256 | 3300049574 | Bacteria | 17927 |
| 470 | Ga0501043_0012846 | 3300049579 | Bacteria | 6545 |
| 471 | Ga0501043_0074642 | 3300049579 | Bacteria | 2664 |
| 472 | Ga0501043_0088724 | 3300049579 | Bacteria | 2430 |
| 473 | Ga0501043_0283147 | 3300049579 | Bacteria | 1270 |
| 474 | Ga0501043_0324773 | 3300049579 | Bacteria | 1173 |
| 475 | Ga0501047_0015552 | 3300049581 | Bacteria | 7250 |
| 476 | Ga0501047_0089002 | 3300049581 | Bacteria | 2964 |
| 477 | Ga0501048_0109238 | 3300049582 | Bacteria | 1953 |
| 478 | Ga0501072_0084708 | 3300049588 | Bacteria | 2514 |
| 479 | Ga0501201_000509 | 3300049651 | Bacteria | 3595 |
| 480 | Ga0501201_003224 | 3300049651 | Bacteria | 1495 |
| 481 | Ga0501202_000030 | 3300049652 | Bacteria | 14265 |
| 482 | Ga0501202_007110 | 3300049652 | Bacteria | 2018 |
| 483 | Ga0501202_011460 | 3300049652 | Bacteria | 1661 |
| 484 | Ga0501207_000663 | 3300049654 | Bacteria | 4009 |
| 485 | Ga0501223_001644 | 3300049663 | Bacteria | 5126 |
| 486 | Ga0501223_007789 | 3300049663 | Bacteria | 2187 |
| 487 | Ga0501224_000870 | 3300049664 | Bacteria | 3879 |
| 488 | Ga0501233_001309 | 3300049668 | Bacteria | 4254 |
| 489 | Ga0501233_027344 | 3300049668 | Bacteria | 1266 |
| 490 | Ga0501235_000549 | 3300049669 | Bacteria | 7508 |
| 491 | Ga0501242_005821 | 3300049674 | Bacteria | 1396 |
| 492 | Ga0501257_018887 | 3300049686 | Bacteria | 1611 |
| 493 | Ga0501259_000179 | 3300049688 | Bacteria | 9653 |
| 494 | Ga0501221_000643 | 3300049704 | Bacteria | 5600 |
| 495 | Ga0501221_018127 | 3300049704 | Bacteria | 1352 |
| 496 | Ga0501225_0000262 | 3300049705 | Bacteria | 16611 |
| 497 | Ga0501225_0002072 | 3300049705 | Bacteria | 6235 |
| 498 | Ga0501234_000856 | 3300049707 | Bacteria | 4788 |
| 499 | Ga0501080_0488231 | 3300049742 | Unclassified | 1101 |
| 500 | Ga0501279_002155 | 3300049775 | Bacteria | 2606 |
| 501 | Ga0501035_0009144 | 3300049822 | Bacteria | 9215 |
| 502 | Ga0501035_0016465 | 3300049822 | Bacteria | 6818 |
| 503 | Ga0501035_0167748 | 3300049822 | Bacteria | 1898 |
| 504 | Ga0501044_0001096 | 3300049823 | Bacteria | 32262 |
| 505 | Ga0501044_0026464 | 3300049823 | Bacteria | 6139 |
| 506 | Ga0501284_00934 | 3300050005 | Bacteria | 1521 |
| 507 | nmdc:mga0k408_10915_c1 | 3300050493 | Bacteria | 4927 |
| 508 | nmdc:mga0k408_77710_c1 | 3300050493 | Bacteria | 1941 |
| 509 | nmdc:mga05p37_13282_c1 | 3300050507 | Bacteria | 9860 |
| 510 | nmdc:mga09592_55522_c1 | 3300050508 | Bacteria | 3347 |
| 511 | nmdc:mga0qj67_25048_c1 | 3300050509 | Bacteria | 4606 |
| 512 | nmdc:mga06r32_145250_c1 | 3300050510 | Bacteria | 2350 |
| 513 | nmdc:mga06r32_146168_c1 | 3300050510 | Bacteria | 2341 |
| 514 | nmdc:mga08y16_33392_c1 | 3300050511 | Bacteria | 5404 |
| 515 | Ga0495619_0060746 | 3300053085 | Bacteria | 2513 |
| 516 | Ga0500578_0000325 | 3300053086 | Bacteria | 58251 |
| 517 | Ga0500646_0012065 | 3300053090 | Bacteria | 2229 |
| 518 | Ga0500646_0034595 | 3300053090 | Bacteria | 1401 |
| 519 | Ga0500583_0000001 | 3300053092 | Bacteria | 241642 |
| 520 | Ga0500583_0000568 | 3300053092 | Bacteria | 11176 |
| 521 | Ga0500583_0117748 | 3300053092 | Bacteria | 1312 |
| 522 | Ga0500641_0019019 | 3300053096 | Bacteria | 2592 |
| 523 | Ga0500642_0028245 | 3300053130 | Bacteria | 2312 |
| 524 | Ga0500652_047039 | 3300053131 | Bacteria | 1752 |
| 525 | Ga0500559_0037090 | 3300053136 | Bacteria | 2112 |
| 526 | Ga0500622_0025163 | 3300053156 | Bacteria | 3147 |
| 527 | Ga0500637_0156285 | 3300053178 | Bacteria | 1316 |
| 528 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005295 | Ga0065707_10119468 | Ga0065707_101194682 | 268 |
| 2 | 3300049569 | Ga0501032_0035240 | Ga0501032_0035240_1816_2727 | 270 |
| 3 | 3300049571 | Ga0501034_0380490 | Ga0501034_0380490_53_964 | 270 |
| 4 | 3300049572 | Ga0501036_0168788 | Ga0501036_0168788_451_1362 | 270 |
| 5 | 3300049573 | Ga0501037_0143368 | Ga0501037_0143368_36_947 | 270 |
| 6 | 3300049579 | Ga0501043_0283147 | Ga0501043_0283147_177_1088 | 270 |
| 7 | 3300049822 | Ga0501035_0167748 | Ga0501035_0167748_481_1392 | 270 |
| 8 | 3300031456 | Ga0307513_10118555 | Ga0307513_101185552 | 271 |
| 9 | 3300005340 | Ga0070689_100018288 | Ga0070689_1000182882 | 274 |
| 10 | 3300005365 | Ga0070688_100031379 | Ga0070688_1000313792 | 274 |
| 11 | 3300009094 | Ga0111539_10016779 | Ga0111539_100167796 | 274 |
| 12 | 3300009553 | Ga0105249_10078154 | Ga0105249_100781543 | 274 |
| 13 | 3300013306 | Ga0163162_10475840 | Ga0163162_104758401 | 274 |
| 14 | 3300013308 | Ga0157375_10020099 | Ga0157375_100200992 | 274 |
| 15 | 3300014326 | Ga0157380_10000255 | Ga0157380_100002559 | 274 |
| 16 | 3300014745 | Ga0157377_10000877 | Ga0157377_100008775 | 274 |
| 17 | 3300025923 | Ga0207681_10016574 | Ga0207681_100165743 | 274 |
| 18 | 3300025972 | Ga0207668_10158163 | Ga0207668_101581632 | 274 |
| 19 | 3300050511 | nmdc:mga08y16_33392_c1 | nmdc:mga08y16_33392_c1_2166_3014 | 274 |
| 20 | 3300005578 | Ga0068854_100150145 | Ga0068854_1001501452 | 275 |
| 21 | 3300049571 | Ga0501034_0003412 | Ga0501034_0003412_1105_1944 | 278 |
| 22 | 3300049572 | Ga0501036_0046770 | Ga0501036_0046770_1775_2614 | 278 |
| 23 | 3300049573 | Ga0501037_0053750 | Ga0501037_0053750_269_1108 | 278 |
| 24 | 3300049579 | Ga0501043_0074642 | Ga0501043_0074642_1747_2586 | 278 |
| 25 | 3300049579 | Ga0501043_0088724 | Ga0501043_0088724_524_1363 | 278 |
| 26 | 3300049581 | Ga0501047_0089002 | Ga0501047_0089002_1820_2659 | 278 |
| 27 | 3300049823 | Ga0501044_0001096 | Ga0501044_0001096_20439_21278 | 278 |
| 28 | 3300050005 | Ga0501284_00934 | Ga0501284_00934_93_980 | 281 |
| 29 | 3300005366 | Ga0070659_100075000 | Ga0070659_1000750002 | 282 |
| 30 | 3300005563 | Ga0068855_100127618 | Ga0068855_1001276182 | 282 |
| 31 | 3300005577 | Ga0068857_100002147 | Ga0068857_1000021479 | 282 |
| 32 | 3300005614 | Ga0068856_100056543 | Ga0068856_1000565435 | 282 |
| 33 | 3300005616 | Ga0068852_100012296 | Ga0068852_1000122962 | 282 |
| 34 | 3300009093 | Ga0105240_10323724 | Ga0105240_103237242 | 282 |
| 35 | 3300009174 | Ga0105241_10062358 | Ga0105241_100623582 | 282 |
| 36 | 3300009551 | Ga0105238_10017549 | Ga0105238_100175492 | 282 |
| 37 | 3300013307 | Ga0157372_10000463 | Ga0157372_1000046331 | 282 |
| 38 | 3300025904 | Ga0207647_10004599 | Ga0207647_100045995 | 282 |
| 39 | 3300025911 | Ga0207654_10026063 | Ga0207654_100260634 | 282 |
| 40 | 3300025924 | Ga0207694_10005398 | Ga0207694_100053989 | 282 |
| 41 | 3300025932 | Ga0207690_10262676 | Ga0207690_102626762 | 282 |
| 42 | 3300025949 | Ga0207667_10001242 | Ga0207667_1000124215 | 282 |
| 43 | 3300026078 | Ga0207702_10050648 | Ga0207702_100506484 | 282 |
| 44 | 3300026116 | Ga0207674_10000453 | Ga0207674_1000045318 | 282 |
| 45 | 3300026142 | Ga0207698_10018771 | Ga0207698_100187712 | 282 |
| 46 | 3300005327 | Ga0070658_10020785 | Ga0070658_100207852 | 283 |
| 47 | 3300005327 | Ga0070658_10345393 | Ga0070658_103453931 | 283 |
| 48 | 3300005563 | Ga0068855_100358101 | Ga0068855_1003581011 | 283 |
| 49 | 3300013297 | Ga0157378_10208462 | Ga0157378_102084622 | 283 |
| 50 | 3300025903 | Ga0207680_10007538 | Ga0207680_100075383 | 283 |
| 51 | 3300025909 | Ga0207705_10114161 | Ga0207705_101141612 | 283 |
| 52 | 3300025909 | Ga0207705_10281595 | Ga0207705_102815952 | 283 |
| 53 | 3300005328 | Ga0070676_10014319 | Ga0070676_100143193 | 284 |
| 54 | 3300005333 | Ga0070677_10057641 | Ga0070677_100576412 | 284 |
| 55 | 3300005334 | Ga0068869_100074258 | Ga0068869_1000742583 | 284 |
| 56 | 3300005334 | Ga0068869_100103944 | Ga0068869_1001039442 | 284 |
| 57 | 3300005335 | Ga0070666_10002756 | Ga0070666_100027566 | 284 |
| 58 | 3300005338 | Ga0068868_100013885 | Ga0068868_1000138855 | 284 |
| 59 | 3300005347 | Ga0070668_100009928 | Ga0070668_1000099283 | 284 |
| 60 | 3300005353 | Ga0070669_100037400 | Ga0070669_1000374002 | 284 |
| 61 | 3300005355 | Ga0070671_100374770 | Ga0070671_1003747701 | 284 |
| 62 | 3300005356 | Ga0070674_100049306 | Ga0070674_1000493063 | 284 |
| 63 | 3300005364 | Ga0070673_100025956 | Ga0070673_1000259563 | 284 |
| 64 | 3300005367 | Ga0070667_100071668 | Ga0070667_1000716683 | 284 |
| 65 | 3300005367 | Ga0070667_100245029 | Ga0070667_1002450292 | 284 |
| 66 | 3300005456 | Ga0070678_100046738 | Ga0070678_1000467382 | 284 |
| 67 | 3300005457 | Ga0070662_100254106 | Ga0070662_1002541061 | 284 |
| 68 | 3300005459 | Ga0068867_100055002 | Ga0068867_1000550022 | 284 |
| 69 | 3300005543 | Ga0070672_100005202 | Ga0070672_1000052027 | 284 |
| 70 | 3300005564 | Ga0070664_100166405 | Ga0070664_1001664052 | 284 |
| 71 | 3300005578 | Ga0068854_100023210 | Ga0068854_1000232101 | 284 |
| 72 | 3300005617 | Ga0068859_100002273 | Ga0068859_10000227310 | 284 |
| 73 | 3300005718 | Ga0068866_10068080 | Ga0068866_100680802 | 284 |
| 74 | 3300005841 | Ga0068863_100328153 | Ga0068863_1003281532 | 284 |
| 75 | 3300005844 | Ga0068862_100499200 | Ga0068862_1004992001 | 284 |
| 76 | 3300006195 | Ga0075366_10090574 | Ga0075366_100905743 | 284 |
| 77 | 3300006237 | Ga0097621_100018519 | Ga0097621_1000185194 | 284 |
| 78 | 3300006358 | Ga0068871_100053443 | Ga0068871_1000534433 | 284 |
| 79 | 3300006881 | Ga0068865_100006196 | Ga0068865_1000061963 | 284 |
| 80 | 3300006931 | Ga0097620_100002273 | Ga0097620_10000227310 | 284 |
| 81 | 3300009174 | Ga0105241_10093641 | Ga0105241_100936413 | 284 |
| 82 | 3300009176 | Ga0105242_10012927 | Ga0105242_100129273 | 284 |
| 83 | 3300009176 | Ga0105242_10216925 | Ga0105242_102169252 | 284 |
| 84 | 3300009176 | Ga0105242_10376769 | Ga0105242_103767691 | 284 |
| 85 | 3300009553 | Ga0105249_10124897 | Ga0105249_101248972 | 284 |
| 86 | 3300011119 | Ga0105246_10001264 | Ga0105246_1000126410 | 284 |
| 87 | 3300013296 | Ga0157374_10135901 | Ga0157374_101359012 | 284 |
| 88 | 3300013297 | Ga0157378_10298636 | Ga0157378_102986362 | 284 |
| 89 | 3300013306 | Ga0163162_10197494 | Ga0163162_101974941 | 284 |
| 90 | 3300013308 | Ga0157375_10055142 | Ga0157375_100551422 | 284 |
| 91 | 3300025893 | Ga0207682_10015835 | Ga0207682_100158352 | 284 |
| 92 | 3300025899 | Ga0207642_10041665 | Ga0207642_100416652 | 284 |
| 93 | 3300025901 | Ga0207688_10003300 | Ga0207688_100033004 | 284 |
| 94 | 3300025907 | Ga0207645_10003291 | Ga0207645_1000329111 | 284 |
| 95 | 3300025933 | Ga0207706_10054002 | Ga0207706_100540025 | 284 |
| 96 | 3300025934 | Ga0207686_10029678 | Ga0207686_100296783 | 284 |
| 97 | 3300025937 | Ga0207669_10037332 | Ga0207669_100373323 | 284 |
| 98 | 3300025938 | Ga0207704_10038307 | Ga0207704_100383072 | 284 |
| 99 | 3300025938 | Ga0207704_10090436 | Ga0207704_100904362 | 284 |
| 100 | 3300025940 | Ga0207691_10031370 | Ga0207691_100313703 | 284 |
| 101 | 3300025942 | Ga0207689_10001049 | Ga0207689_1000104910 | 284 |
| 102 | 3300025942 | Ga0207689_10012954 | Ga0207689_100129543 | 284 |
| 103 | 3300025960 | Ga0207651_10107640 | Ga0207651_101076402 | 284 |
| 104 | 3300025961 | Ga0207712_10047061 | Ga0207712_100470613 | 284 |
| 105 | 3300025961 | Ga0207712_10102733 | Ga0207712_101027332 | 284 |
| 106 | 3300025972 | Ga0207668_10048032 | Ga0207668_100480322 | 284 |
| 107 | 3300025981 | Ga0207640_10248329 | Ga0207640_102483292 | 284 |
| 108 | 3300025986 | Ga0207658_10068969 | Ga0207658_100689693 | 284 |
| 109 | 3300026023 | Ga0207677_10044906 | Ga0207677_100449062 | 284 |
| 110 | 3300026035 | Ga0207703_10175097 | Ga0207703_101750972 | 284 |
| 111 | 3300026089 | Ga0207648_10005292 | Ga0207648_1000529210 | 284 |
| 112 | 3300026121 | Ga0207683_10000957 | Ga0207683_1000095720 | 284 |
| 113 | 3300028379 | Ga0268266_10022104 | Ga0268266_100221043 | 284 |
| 114 | 3300028380 | Ga0268265_10331563 | Ga0268265_103315632 | 284 |
| 115 | 3300053090 | Ga0500646_0012065 | Ga0500646_0012065_839_1747 | 284 |
| 116 | 3300003323 | rootH1_10041265 | rootH1_100412653 | 285 |
| 117 | 3300003323 | rootH1_10369669 | rootH1_103696692 | 285 |
| 118 | 3300005289 | Ga0065704_10095532 | Ga0065704_100955322 | 285 |
| 119 | 3300005290 | Ga0065712_10089166 | Ga0065712_100891663 | 285 |
| 120 | 3300005293 | Ga0065715_10124554 | Ga0065715_101245542 | 285 |
| 121 | 3300005329 | Ga0070683_100191390 | Ga0070683_1001913902 | 285 |
| 122 | 3300005330 | Ga0070690_100096016 | Ga0070690_1000960162 | 285 |
| 123 | 3300005331 | Ga0070670_100038566 | Ga0070670_1000385662 | 285 |
| 124 | 3300005331 | Ga0070670_100317742 | Ga0070670_1003177421 | 285 |
| 125 | 3300005331 | Ga0070670_100455286 | Ga0070670_1004552862 | 285 |
| 126 | 3300005333 | Ga0070677_10126152 | Ga0070677_101261521 | 285 |
| 127 | 3300005334 | Ga0068869_100015272 | Ga0068869_1000152726 | 285 |
| 128 | 3300005334 | Ga0068869_100016680 | Ga0068869_1000166804 | 285 |
| 129 | 3300005334 | Ga0068869_100027016 | Ga0068869_1000270165 | 285 |
| 130 | 3300005335 | Ga0070666_10058363 | Ga0070666_100583632 | 285 |
| 131 | 3300005338 | Ga0068868_100007171 | Ga0068868_1000071714 | 285 |
| 132 | 3300005338 | Ga0068868_100008105 | Ga0068868_1000081057 | 285 |
| 133 | 3300005338 | Ga0068868_100093805 | Ga0068868_1000938053 | 285 |
| 134 | 3300005338 | Ga0068868_100244249 | Ga0068868_1002442492 | 285 |
| 135 | 3300005340 | Ga0070689_100138505 | Ga0070689_1001385052 | 285 |
| 136 | 3300005343 | Ga0070687_100015995 | Ga0070687_1000159953 | 285 |
| 137 | 3300005344 | Ga0070661_100019264 | Ga0070661_1000192646 | 285 |
| 138 | 3300005344 | Ga0070661_100058296 | Ga0070661_1000582962 | 285 |
| 139 | 3300005344 | Ga0070661_100070753 | Ga0070661_1000707532 | 285 |
| 140 | 3300005353 | Ga0070669_100340325 | Ga0070669_1003403251 | 285 |
| 141 | 3300005354 | Ga0070675_100008867 | Ga0070675_1000088677 | 285 |
| 142 | 3300005354 | Ga0070675_100022703 | Ga0070675_1000227035 | 285 |
| 143 | 3300005354 | Ga0070675_100046846 | Ga0070675_1000468464 | 285 |
| 144 | 3300005354 | Ga0070675_100048483 | Ga0070675_1000484834 | 285 |
| 145 | 3300005354 | Ga0070675_100063944 | Ga0070675_1000639441 | 285 |
| 146 | 3300005354 | Ga0070675_100243738 | Ga0070675_1002437381 | 285 |
| 147 | 3300005355 | Ga0070671_100045722 | Ga0070671_1000457222 | 285 |
| 148 | 3300005355 | Ga0070671_100153881 | Ga0070671_1001538812 | 285 |
| 149 | 3300005355 | Ga0070671_100407822 | Ga0070671_1004078221 | 285 |
| 150 | 3300005364 | Ga0070673_100007203 | Ga0070673_1000072039 | 285 |
| 151 | 3300005364 | Ga0070673_100111691 | Ga0070673_1001116912 | 285 |
| 152 | 3300005365 | Ga0070688_100012159 | Ga0070688_1000121592 | 285 |
| 153 | 3300005365 | Ga0070688_100029947 | Ga0070688_1000299473 | 285 |
| 154 | 3300005365 | Ga0070688_100076558 | Ga0070688_1000765582 | 285 |
| 155 | 3300005365 | Ga0070688_100228082 | Ga0070688_1002280822 | 285 |
| 156 | 3300005367 | Ga0070667_100001797 | Ga0070667_10000179711 | 285 |
| 157 | 3300005367 | Ga0070667_100039008 | Ga0070667_1000390082 | 285 |
| 158 | 3300005367 | Ga0070667_100074788 | Ga0070667_1000747882 | 285 |
| 159 | 3300005367 | Ga0070667_100151519 | Ga0070667_1001515193 | 285 |
| 160 | 3300005455 | Ga0070663_100202543 | Ga0070663_1002025433 | 285 |
| 161 | 3300005456 | Ga0070678_100043720 | Ga0070678_1000437203 | 285 |
| 162 | 3300005456 | Ga0070678_100046095 | Ga0070678_1000460953 | 285 |
| 163 | 3300005457 | Ga0070662_100011969 | Ga0070662_1000119696 | 285 |
| 164 | 3300005457 | Ga0070662_100013705 | Ga0070662_1000137052 | 285 |
| 165 | 3300005466 | Ga0070685_10003854 | Ga0070685_100038544 | 285 |
| 166 | 3300005466 | Ga0070685_10024747 | Ga0070685_100247475 | 285 |
| 167 | 3300005466 | Ga0070685_10304188 | Ga0070685_103041881 | 285 |
| 168 | 3300005466 | Ga0070685_10313348 | Ga0070685_103133481 | 285 |
| 169 | 3300005471 | Ga0070698_100289902 | Ga0070698_1002899021 | 285 |
| 170 | 3300005535 | Ga0070684_100012518 | Ga0070684_1000125186 | 285 |
| 171 | 3300005535 | Ga0070684_100021281 | Ga0070684_1000212812 | 285 |
| 172 | 3300005535 | Ga0070684_100190517 | Ga0070684_1001905172 | 285 |
| 173 | 3300005535 | Ga0070684_100521868 | Ga0070684_1005218682 | 285 |
| 174 | 3300005539 | Ga0068853_100026519 | Ga0068853_1000265192 | 285 |
| 175 | 3300005539 | Ga0068853_100172361 | Ga0068853_1001723612 | 285 |
| 176 | 3300005544 | Ga0070686_100288168 | Ga0070686_1002881681 | 285 |
| 177 | 3300005563 | Ga0068855_100001990 | Ga0068855_10000199021 | 285 |
| 178 | 3300005563 | Ga0068855_100199390 | Ga0068855_1001993902 | 285 |
| 179 | 3300005564 | Ga0070664_100002665 | Ga0070664_10000266510 | 285 |
| 180 | 3300005564 | Ga0070664_100090677 | Ga0070664_1000906772 | 285 |
| 181 | 3300005577 | Ga0068857_100021713 | Ga0068857_1000217132 | 285 |
| 182 | 3300005578 | Ga0068854_100047100 | Ga0068854_1000471003 | 285 |
| 183 | 3300005614 | Ga0068856_100028452 | Ga0068856_1000284523 | 285 |
| 184 | 3300005616 | Ga0068852_100031270 | Ga0068852_1000312703 | 285 |
| 185 | 3300005616 | Ga0068852_100133886 | Ga0068852_1001338862 | 285 |
| 186 | 3300005616 | Ga0068852_100165662 | Ga0068852_1001656622 | 285 |
| 187 | 3300005617 | Ga0068859_100022848 | Ga0068859_1000228481 | 285 |
| 188 | 3300005617 | Ga0068859_100032409 | Ga0068859_1000324096 | 285 |
| 189 | 3300005617 | Ga0068859_100135588 | Ga0068859_1001355882 | 285 |
| 190 | 3300005617 | Ga0068859_100326181 | Ga0068859_1003261812 | 285 |
| 191 | 3300005617 | Ga0068859_100378117 | Ga0068859_1003781172 | 285 |
| 192 | 3300005617 | Ga0068859_100711870 | Ga0068859_1007118701 | 285 |
| 193 | 3300005618 | Ga0068864_100033309 | Ga0068864_1000333092 | 285 |
| 194 | 3300005618 | Ga0068864_100058674 | Ga0068864_1000586744 | 285 |
| 195 | 3300005718 | Ga0068866_10040342 | Ga0068866_100403423 | 285 |
| 196 | 3300005719 | Ga0068861_100006143 | Ga0068861_1000061433 | 285 |
| 197 | 3300005840 | Ga0068870_10042382 | Ga0068870_100423822 | 285 |
| 198 | 3300005841 | Ga0068863_100078523 | Ga0068863_1000785232 | 285 |
| 199 | 3300005841 | Ga0068863_100129113 | Ga0068863_1001291133 | 285 |
| 200 | 3300005842 | Ga0068858_100114610 | Ga0068858_1001146103 | 285 |
| 201 | 3300005842 | Ga0068858_100156333 | Ga0068858_1001563332 | 285 |
| 202 | 3300005843 | Ga0068860_100020848 | Ga0068860_1000208484 | 285 |
| 203 | 3300005843 | Ga0068860_100068417 | Ga0068860_1000684173 | 285 |
| 204 | 3300005843 | Ga0068860_100350084 | Ga0068860_1003500842 | 285 |
| 205 | 3300005985 | Ga0081539_10047752 | Ga0081539_100477522 | 285 |
| 206 | 3300006195 | Ga0075366_10049791 | Ga0075366_100497912 | 285 |
| 207 | 3300006358 | Ga0068871_100156147 | Ga0068871_1001561472 | 285 |
| 208 | 3300006358 | Ga0068871_100320111 | Ga0068871_1003201111 | 285 |
| 209 | 3300006844 | Ga0075428_100035534 | Ga0075428_1000355342 | 285 |
| 210 | 3300006846 | Ga0075430_100008274 | Ga0075430_10000827411 | 285 |
| 211 | 3300006847 | Ga0075431_100001819 | Ga0075431_1000018198 | 285 |
| 212 | 3300006847 | Ga0075431_100042240 | Ga0075431_1000422402 | 285 |
| 213 | 3300006847 | Ga0075431_100056175 | Ga0075431_1000561755 | 285 |
| 214 | 3300006880 | Ga0075429_100007759 | Ga0075429_1000077598 | 285 |
| 215 | 3300006880 | Ga0075429_100009788 | Ga0075429_1000097884 | 285 |
| 216 | 3300006880 | Ga0075429_100023082 | Ga0075429_1000230822 | 285 |
| 217 | 3300006931 | Ga0097620_100022848 | Ga0097620_1000228481 | 285 |
| 218 | 3300006931 | Ga0097620_100032409 | Ga0097620_1000324096 | 285 |
| 219 | 3300006931 | Ga0097620_100135583 | Ga0097620_1001355832 | 285 |
| 220 | 3300006931 | Ga0097620_100326190 | Ga0097620_1003261902 | 285 |
| 221 | 3300006931 | Ga0097620_100378104 | Ga0097620_1003781042 | 285 |
| 222 | 3300006931 | Ga0097620_100711878 | Ga0097620_1007118781 | 285 |
| 223 | 3300009093 | Ga0105240_10000106 | Ga0105240_1000010659 | 285 |
| 224 | 3300009093 | Ga0105240_10316322 | Ga0105240_103163222 | 285 |
| 225 | 3300009094 | Ga0111539_10082947 | Ga0111539_100829474 | 285 |
| 226 | 3300009098 | Ga0105245_10046668 | Ga0105245_100466681 | 285 |
| 227 | 3300009101 | Ga0105247_10014858 | Ga0105247_100148585 | 285 |
| 228 | 3300009147 | Ga0114129_10004788 | Ga0114129_1000478812 | 285 |
| 229 | 3300009174 | Ga0105241_10000333 | Ga0105241_100003335 | 285 |
| 230 | 3300009174 | Ga0105241_10001117 | Ga0105241_100011179 | 285 |
| 231 | 3300009174 | Ga0105241_10042451 | Ga0105241_100424512 | 285 |
| 232 | 3300009176 | Ga0105242_10123866 | Ga0105242_101238662 | 285 |
| 233 | 3300009176 | Ga0105242_10492099 | Ga0105242_104920992 | 285 |
| 234 | 3300009176 | Ga0105242_10507288 | Ga0105242_105072881 | 285 |
| 235 | 3300009177 | Ga0105248_10432377 | Ga0105248_104323772 | 285 |
| 236 | 3300009545 | Ga0105237_10002380 | Ga0105237_1000238010 | 285 |
| 237 | 3300009545 | Ga0105237_10005940 | Ga0105237_1000594014 | 285 |
| 238 | 3300009545 | Ga0105237_10014958 | Ga0105237_100149587 | 285 |
| 239 | 3300009545 | Ga0105237_10018678 | Ga0105237_100186789 | 285 |
| 240 | 3300009545 | Ga0105237_10173365 | Ga0105237_101733652 | 285 |
| 241 | 3300009551 | Ga0105238_10103405 | Ga0105238_101034052 | 285 |
| 242 | 3300009551 | Ga0105238_10273999 | Ga0105238_102739992 | 285 |
| 243 | 3300009553 | Ga0105249_10001813 | Ga0105249_1000181315 | 285 |
| 244 | 3300009553 | Ga0105249_10112821 | Ga0105249_101128214 | 285 |
| 245 | 3300009553 | Ga0105249_10782085 | Ga0105249_107820851 | 285 |
| 246 | 3300010375 | Ga0105239_10007405 | Ga0105239_100074052 | 285 |
| 247 | 3300010375 | Ga0105239_10009676 | Ga0105239_100096762 | 285 |
| 248 | 3300010375 | Ga0105239_10015390 | Ga0105239_100153907 | 285 |
| 249 | 3300010375 | Ga0105239_10170872 | Ga0105239_101708723 | 285 |
| 250 | 3300011119 | Ga0105246_10079360 | Ga0105246_100793603 | 285 |
| 251 | 3300011119 | Ga0105246_10162624 | Ga0105246_101626242 | 285 |
| 252 | 3300011119 | Ga0105246_10186876 | Ga0105246_101868763 | 285 |
| 253 | 3300013296 | Ga0157374_10002752 | Ga0157374_1000275211 | 285 |
| 254 | 3300013296 | Ga0157374_10038728 | Ga0157374_100387282 | 285 |
| 255 | 3300013296 | Ga0157374_10073936 | Ga0157374_100739363 | 285 |
| 256 | 3300013296 | Ga0157374_10215386 | Ga0157374_102153862 | 285 |
| 257 | 3300013297 | Ga0157378_10112642 | Ga0157378_101126421 | 285 |
| 258 | 3300013297 | Ga0157378_10121749 | Ga0157378_101217491 | 285 |
| 259 | 3300013297 | Ga0157378_10183188 | Ga0157378_101831882 | 285 |
| 260 | 3300013297 | Ga0157378_10206522 | Ga0157378_102065222 | 285 |
| 261 | 3300013306 | Ga0163162_10000612 | Ga0163162_100006122 | 285 |
| 262 | 3300013306 | Ga0163162_10001367 | Ga0163162_100013675 | 285 |
| 263 | 3300013306 | Ga0163162_10001786 | Ga0163162_100017869 | 285 |
| 264 | 3300013306 | Ga0163162_10165389 | Ga0163162_101653892 | 285 |
| 265 | 3300013306 | Ga0163162_10171057 | Ga0163162_101710572 | 285 |
| 266 | 3300013306 | Ga0163162_10199989 | Ga0163162_101999893 | 285 |
| 267 | 3300013306 | Ga0163162_10599510 | Ga0163162_105995102 | 285 |
| 268 | 3300013306 | Ga0163162_10632511 | Ga0163162_106325112 | 285 |
| 269 | 3300013307 | Ga0157372_10181378 | Ga0157372_101813782 | 285 |
| 270 | 3300013307 | Ga0157372_10462248 | Ga0157372_104622482 | 285 |
| 271 | 3300013307 | Ga0157372_10554323 | Ga0157372_105543231 | 285 |
| 272 | 3300013308 | Ga0157375_10009867 | Ga0157375_100098674 | 285 |
| 273 | 3300013308 | Ga0157375_10035566 | Ga0157375_100355666 | 285 |
| 274 | 3300013308 | Ga0157375_10121739 | Ga0157375_101217392 | 285 |
| 275 | 3300013308 | Ga0157375_10161888 | Ga0157375_101618882 | 285 |
| 276 | 3300013308 | Ga0157375_10181663 | Ga0157375_101816632 | 285 |
| 277 | 3300014325 | Ga0163163_10001998 | Ga0163163_100019983 | 285 |
| 278 | 3300014325 | Ga0163163_10141344 | Ga0163163_101413441 | 285 |
| 279 | 3300014325 | Ga0163163_10339595 | Ga0163163_103395952 | 285 |
| 280 | 3300014326 | Ga0157380_10304165 | Ga0157380_103041651 | 285 |
| 281 | 3300014745 | Ga0157377_10023386 | Ga0157377_100233863 | 285 |
| 282 | 3300014745 | Ga0157377_10050702 | Ga0157377_100507022 | 285 |
| 283 | 3300014968 | Ga0157379_10037393 | Ga0157379_100373935 | 285 |
| 284 | 3300014968 | Ga0157379_10081389 | Ga0157379_100813892 | 285 |
| 285 | 3300014968 | Ga0157379_10422469 | Ga0157379_104224692 | 285 |
| 286 | 3300014969 | Ga0157376_10007329 | Ga0157376_100073294 | 285 |
| 287 | 3300014969 | Ga0157376_10026592 | Ga0157376_100265925 | 285 |
| 288 | 3300014969 | Ga0157376_10133097 | Ga0157376_101330972 | 285 |
| 289 | 3300014969 | Ga0157376_10184917 | Ga0157376_101849172 | 285 |
| 290 | 3300014969 | Ga0157376_10212783 | Ga0157376_102127831 | 285 |
| 291 | 3300017792 | Ga0163161_10024623 | Ga0163161_100246232 | 285 |
| 292 | 3300017792 | Ga0163161_10070335 | Ga0163161_100703352 | 285 |
| 293 | 3300017792 | Ga0163161_10073748 | Ga0163161_100737482 | 285 |
| 294 | 3300025246 | Ga0209646_1001248 | Ga0209646_10012482 | 285 |
| 295 | 3300025315 | Ga0207697_10042943 | Ga0207697_100429432 | 285 |
| 296 | 3300025315 | Ga0207697_10054196 | Ga0207697_100541962 | 285 |
| 297 | 3300025321 | Ga0207656_10020010 | Ga0207656_100200103 | 285 |
| 298 | 3300025899 | Ga0207642_10004323 | Ga0207642_100043235 | 285 |
| 299 | 3300025903 | Ga0207680_10079798 | Ga0207680_100797984 | 285 |
| 300 | 3300025907 | Ga0207645_10005892 | Ga0207645_100058922 | 285 |
| 301 | 3300025908 | Ga0207643_10017667 | Ga0207643_100176672 | 285 |
| 302 | 3300025910 | Ga0207684_10498792 | Ga0207684_104987922 | 285 |
| 303 | 3300025911 | Ga0207654_10000620 | Ga0207654_1000062011 | 285 |
| 304 | 3300025911 | Ga0207654_10024091 | Ga0207654_100240912 | 285 |
| 305 | 3300025911 | Ga0207654_10078538 | Ga0207654_100785382 | 285 |
| 306 | 3300025913 | Ga0207695_10003167 | Ga0207695_1000316712 | 285 |
| 307 | 3300025913 | Ga0207695_10018118 | Ga0207695_100181185 | 285 |
| 308 | 3300025913 | Ga0207695_10029606 | Ga0207695_100296067 | 285 |
| 309 | 3300025914 | Ga0207671_10002324 | Ga0207671_1000232413 | 285 |
| 310 | 3300025914 | Ga0207671_10002511 | Ga0207671_100025116 | 285 |
| 311 | 3300025914 | Ga0207671_10008910 | Ga0207671_100089109 | 285 |
| 312 | 3300025918 | Ga0207662_10046491 | Ga0207662_100464912 | 285 |
| 313 | 3300025920 | Ga0207649_10068425 | Ga0207649_100684252 | 285 |
| 314 | 3300025920 | Ga0207649_10284569 | Ga0207649_102845691 | 285 |
| 315 | 3300025923 | Ga0207681_10173295 | Ga0207681_101732952 | 285 |
| 316 | 3300025923 | Ga0207681_10397603 | Ga0207681_103976031 | 285 |
| 317 | 3300025924 | Ga0207694_10102112 | Ga0207694_101021122 | 285 |
| 318 | 3300025925 | Ga0207650_10022618 | Ga0207650_100226183 | 285 |
| 319 | 3300025925 | Ga0207650_10031707 | Ga0207650_100317074 | 285 |
| 320 | 3300025925 | Ga0207650_10182120 | Ga0207650_101821202 | 285 |
| 321 | 3300025925 | Ga0207650_10203713 | Ga0207650_102037132 | 285 |
| 322 | 3300025925 | Ga0207650_10374720 | Ga0207650_103747202 | 285 |
| 323 | 3300025926 | Ga0207659_10015767 | Ga0207659_100157672 | 285 |
| 324 | 3300025926 | Ga0207659_10045946 | Ga0207659_100459463 | 285 |
| 325 | 3300025926 | Ga0207659_10096159 | Ga0207659_100961591 | 285 |
| 326 | 3300025926 | Ga0207659_10108763 | Ga0207659_101087632 | 285 |
| 327 | 3300025931 | Ga0207644_10250003 | Ga0207644_102500033 | 285 |
| 328 | 3300025933 | Ga0207706_10004710 | Ga0207706_1000471011 | 285 |
| 329 | 3300025933 | Ga0207706_10015998 | Ga0207706_100159988 | 285 |
| 330 | 3300025933 | Ga0207706_10258254 | Ga0207706_102582541 | 285 |
| 331 | 3300025933 | Ga0207706_10347699 | Ga0207706_103476992 | 285 |
| 332 | 3300025934 | Ga0207686_10090156 | Ga0207686_100901563 | 285 |
| 333 | 3300025934 | Ga0207686_10178682 | Ga0207686_101786822 | 285 |
| 334 | 3300025934 | Ga0207686_10264597 | Ga0207686_102645971 | 285 |
| 335 | 3300025936 | Ga0207670_10016254 | Ga0207670_100162542 | 285 |
| 336 | 3300025936 | Ga0207670_10076046 | Ga0207670_100760463 | 285 |
| 337 | 3300025936 | Ga0207670_10180626 | Ga0207670_101806262 | 285 |
| 338 | 3300025940 | Ga0207691_10039933 | Ga0207691_100399336 | 285 |
| 339 | 3300025940 | Ga0207691_10042959 | Ga0207691_100429593 | 285 |
| 340 | 3300025941 | Ga0207711_10338106 | Ga0207711_103381062 | 285 |
| 341 | 3300025942 | Ga0207689_10010413 | Ga0207689_100104136 | 285 |
| 342 | 3300025942 | Ga0207689_10023916 | Ga0207689_100239165 | 285 |
| 343 | 3300025942 | Ga0207689_10037971 | Ga0207689_100379713 | 285 |
| 344 | 3300025942 | Ga0207689_10067436 | Ga0207689_100674362 | 285 |
| 345 | 3300025942 | Ga0207689_10168893 | Ga0207689_101688932 | 285 |
| 346 | 3300025944 | Ga0207661_10053129 | Ga0207661_100531292 | 285 |
| 347 | 3300025944 | Ga0207661_10072945 | Ga0207661_100729452 | 285 |
| 348 | 3300025945 | Ga0207679_10001622 | Ga0207679_100016228 | 285 |
| 349 | 3300025945 | Ga0207679_10058749 | Ga0207679_100587491 | 285 |
| 350 | 3300025945 | Ga0207679_10070163 | Ga0207679_100701633 | 285 |
| 351 | 3300025945 | Ga0207679_10239284 | Ga0207679_102392841 | 285 |
| 352 | 3300025949 | Ga0207667_10018750 | Ga0207667_100187503 | 285 |
| 353 | 3300025949 | Ga0207667_10020034 | Ga0207667_100200344 | 285 |
| 354 | 3300025960 | Ga0207651_10047510 | Ga0207651_100475102 | 285 |
| 355 | 3300025960 | Ga0207651_10344345 | Ga0207651_103443452 | 285 |
| 356 | 3300025961 | Ga0207712_10015278 | Ga0207712_100152782 | 285 |
| 357 | 3300025981 | Ga0207640_10032118 | Ga0207640_100321181 | 285 |
| 358 | 3300025986 | Ga0207658_10022996 | Ga0207658_100229966 | 285 |
| 359 | 3300025986 | Ga0207658_10209613 | Ga0207658_102096132 | 285 |
| 360 | 3300025986 | Ga0207658_10424517 | Ga0207658_104245172 | 285 |
| 361 | 3300026023 | Ga0207677_10007320 | Ga0207677_100073205 | 285 |
| 362 | 3300026023 | Ga0207677_10198727 | Ga0207677_101987272 | 285 |
| 363 | 3300026023 | Ga0207677_10252854 | Ga0207677_102528542 | 285 |
| 364 | 3300026023 | Ga0207677_10295960 | Ga0207677_102959601 | 285 |
| 365 | 3300026041 | Ga0207639_10127747 | Ga0207639_101277472 | 285 |
| 366 | 3300026041 | Ga0207639_10183532 | Ga0207639_101835321 | 285 |
| 367 | 3300026067 | Ga0207678_10119695 | Ga0207678_101196953 | 285 |
| 368 | 3300026078 | Ga0207702_10084238 | Ga0207702_100842383 | 285 |
| 369 | 3300026088 | Ga0207641_10000318 | Ga0207641_1000031849 | 285 |
| 370 | 3300026088 | Ga0207641_10100939 | Ga0207641_101009394 | 285 |
| 371 | 3300026088 | Ga0207641_10116934 | Ga0207641_101169342 | 285 |
| 372 | 3300026089 | Ga0207648_10006356 | Ga0207648_100063566 | 285 |
| 373 | 3300026089 | Ga0207648_10182328 | Ga0207648_101823282 | 285 |
| 374 | 3300026095 | Ga0207676_10265047 | Ga0207676_102650472 | 285 |
| 375 | 3300026116 | Ga0207674_10037607 | Ga0207674_100376074 | 285 |
| 376 | 3300026116 | Ga0207674_10296688 | Ga0207674_102966882 | 285 |
| 377 | 3300026118 | Ga0207675_100012049 | Ga0207675_1000120497 | 285 |
| 378 | 3300026121 | Ga0207683_10003845 | Ga0207683_100038454 | 285 |
| 379 | 3300026121 | Ga0207683_10017665 | Ga0207683_100176652 | 285 |
| 380 | 3300026142 | Ga0207698_10018924 | Ga0207698_100189243 | 285 |
| 381 | 3300026142 | Ga0207698_10022200 | Ga0207698_100222002 | 285 |
| 382 | 3300026142 | Ga0207698_10089065 | Ga0207698_100890652 | 285 |
| 383 | 3300028379 | Ga0268266_10000048 | Ga0268266_10000048165 | 285 |
| 384 | 3300028379 | Ga0268266_10146482 | Ga0268266_101464823 | 285 |
| 385 | 3300028381 | Ga0268264_10000028 | Ga0268264_10000028321 | 285 |
| 386 | 3300028381 | Ga0268264_10014694 | Ga0268264_100146941 | 285 |
| 387 | 3300028381 | Ga0268264_10014908 | Ga0268264_100149084 | 285 |
| 388 | 3300028794 | Ga0307515_10004954 | Ga0307515_1000495414 | 285 |
| 389 | 3300031456 | Ga0307513_10246855 | Ga0307513_102468552 | 285 |
| 390 | 3300031507 | Ga0307509_10073328 | Ga0307509_100733282 | 285 |
| 391 | 3300031901 | Ga0307406_10136073 | Ga0307406_101360731 | 285 |
| 392 | 3300031911 | Ga0307412_10140120 | Ga0307412_101401202 | 285 |
| 393 | 3300032002 | Ga0307416_100281525 | Ga0307416_1002815251 | 285 |
| 394 | 3300032004 | Ga0307414_10143496 | Ga0307414_101434962 | 285 |
| 395 | 3300032126 | Ga0307415_100057989 | Ga0307415_1000579892 | 285 |
| 396 | 3300035695 | Ga0373927_0024799 | Ga0373927_0024799_2378_3280 | 285 |
| 397 | 3300035724 | Ga0373933_0119857 | Ga0373933_0119857_18_920 | 285 |
| 398 | 3300036401 | Ga0373937_0019641 | Ga0373937_0019641_877_1779 | 285 |
| 399 | 3300037068 | Ga0373925_0543544 | Ga0373925_0543544_40_942 | 285 |
| 400 | 3300041404 | Ga0439436_0000372 | Ga0439436_0000372_9126_10028 | 285 |
| 401 | 3300041505 | Ga0451849_0713589 | Ga0451849_0713589_435_1337 | 285 |
| 402 | 3300042001 | Ga0439441_001208 | Ga0439441_001208_1265_2167 | 285 |
| 403 | 3300042014 | Ga0439457_000079 | Ga0439457_000079_5321_6223 | 285 |
| 404 | 3300042014 | Ga0439457_008871 | Ga0439457_008871_308_1201 | 285 |
| 405 | 3300042125 | Ga0450923_003226 | Ga0450923_003226_1175_2077 | 285 |
| 406 | 3300042437 | Ga0439444_0018094 | Ga0439444_0018094_295_1197 | 285 |
| 407 | 3300042876 | Ga0451577_0186842 | Ga0451577_0186842_952_1854 | 285 |
| 408 | 3300044656 | Ga0466969_0000869 | Ga0466969_0000869_4288_5190 | 285 |
| 409 | 3300044658 | Ga0466972_0000049 | Ga0466972_0000049_116460_117359 | 285 |
| 410 | 3300044658 | Ga0466972_0000640 | Ga0466972_0000640_4083_5000 | 285 |
| 411 | 3300044684 | Ga0466966_0000096 | Ga0466966_0000096_9524_10426 | 285 |
| 412 | 3300044735 | Ga0466968_0006651 | Ga0466968_0006651_1563_2480 | 285 |
| 413 | 3300044842 | Ga0466957_0006774 | Ga0466957_0006774_2756_3658 | 285 |
| 414 | 3300044901 | Ga0466960_0025224 | Ga0466960_0025224_1685_2596 | 285 |
| 415 | 3300045049 | Ga0466959_0000014 | Ga0466959_0000014_13722_14624 | 285 |
| 416 | 3300046460 | Ga0495638_0031164 | Ga0495638_0031164_2132_3019 | 285 |
| 417 | 3300046460 | Ga0495638_0080380 | Ga0495638_0080380_279_1181 | 285 |
| 418 | 3300046463 | Ga0495653_0250432 | Ga0495653_0250432_234_1136 | 285 |
| 419 | 3300046499 | Ga0495594_0133025 | Ga0495594_0133025_222_1124 | 285 |
| 420 | 3300046514 | Ga0495618_0179204 | Ga0495618_0179204_224_1126 | 285 |
| 421 | 3300046516 | Ga0495628_0115970 | Ga0495628_0115970_372_1274 | 285 |
| 422 | 3300046524 | Ga0495648_0001979 | Ga0495648_0001979_3198_4085 | 285 |
| 423 | 3300046537 | Ga0495598_0052181 | Ga0495598_0052181_32_934 | 285 |
| 424 | 3300046539 | Ga0495621_0007054 | Ga0495621_0007054_936_1838 | 285 |
| 425 | 3300046616 | Ga0495668_0002514 | Ga0495668_0002514_11223_12125 | 285 |
| 426 | 3300046642 | Ga0495634_0038674 | Ga0495634_0038674_36_938 | 285 |
| 427 | 3300046648 | Ga0495611_0124335 | Ga0495611_0124335_212_1099 | 285 |
| 428 | 3300047319 | Ga0495674_0207469 | Ga0495674_0207469_418_1320 | 285 |
| 429 | 3300048907 | Ga0496104_0269251 | Ga0496104_0269251_285_1187 | 285 |
| 430 | 3300048913 | Ga0496110_0464666 | Ga0496110_0464666_181_1083 | 285 |
| 431 | 3300048914 | Ga0496111_0197353 | Ga0496111_0197353_575_1477 | 285 |
| 432 | 3300048914 | Ga0496111_0227246 | Ga0496111_0227246_237_1139 | 285 |
| 433 | 3300049513 | Ga0501290_000624 | Ga0501290_000624_4387_5295 | 285 |
| 434 | 3300049568 | Ga0501031_0016589 | Ga0501031_0016589_940_1797 | 285 |
| 435 | 3300049569 | Ga0501032_0002853 | Ga0501032_0002853_7597_8517 | 285 |
| 436 | 3300049571 | Ga0501034_0227450 | Ga0501034_0227450_49_954 | 285 |
| 437 | 3300049572 | Ga0501036_0039650 | Ga0501036_0039650_693_1550 | 285 |
| 438 | 3300049574 | Ga0501038_0002256 | Ga0501038_0002256_2015_2872 | 285 |
| 439 | 3300049579 | Ga0501043_0012846 | Ga0501043_0012846_1380_2237 | 285 |
| 440 | 3300049579 | Ga0501043_0324773 | Ga0501043_0324773_43_948 | 285 |
| 441 | 3300049581 | Ga0501047_0015552 | Ga0501047_0015552_381_1286 | 285 |
| 442 | 3300049582 | Ga0501048_0109238 | Ga0501048_0109238_747_1652 | 285 |
| 443 | 3300049588 | Ga0501072_0084708 | Ga0501072_0084708_746_1603 | 285 |
| 444 | 3300049651 | Ga0501201_000509 | Ga0501201_000509_2559_3467 | 285 |
| 445 | 3300049651 | Ga0501201_003224 | Ga0501201_003224_94_990 | 285 |
| 446 | 3300049652 | Ga0501202_000030 | Ga0501202_000030_6295_7203 | 285 |
| 447 | 3300049652 | Ga0501202_007110 | Ga0501202_007110_311_1258 | 285 |
| 448 | 3300049652 | Ga0501202_011460 | Ga0501202_011460_683_1579 | 285 |
| 449 | 3300049654 | Ga0501207_000663 | Ga0501207_000663_337_1227 | 285 |
| 450 | 3300049663 | Ga0501223_001644 | Ga0501223_001644_4103_4993 | 285 |
| 451 | 3300049663 | Ga0501223_007789 | Ga0501223_007789_732_1628 | 285 |
| 452 | 3300049664 | Ga0501224_000870 | Ga0501224_000870_462_1370 | 285 |
| 453 | 3300049668 | Ga0501233_001309 | Ga0501233_001309_2876_3766 | 285 |
| 454 | 3300049668 | Ga0501233_027344 | Ga0501233_027344_41_988 | 285 |
| 455 | 3300049669 | Ga0501235_000549 | Ga0501235_000549_5040_5930 | 285 |
| 456 | 3300049674 | Ga0501242_005821 | Ga0501242_005821_186_1094 | 285 |
| 457 | 3300049686 | Ga0501257_018887 | Ga0501257_018887_46_1017 | 285 |
| 458 | 3300049688 | Ga0501259_000179 | Ga0501259_000179_5850_6740 | 285 |
| 459 | 3300049704 | Ga0501221_000643 | Ga0501221_000643_4222_5112 | 285 |
| 460 | 3300049704 | Ga0501221_018127 | Ga0501221_018127_338_1285 | 285 |
| 461 | 3300049705 | Ga0501225_0000262 | Ga0501225_0000262_6208_7110 | 285 |
| 462 | 3300049705 | Ga0501225_0002072 | Ga0501225_0002072_462_1352 | 285 |
| 463 | 3300049707 | Ga0501234_000856 | Ga0501234_000856_112_1002 | 285 |
| 464 | 3300049742 | Ga0501080_0488231 | Ga0501080_0488231_153_1010 | 285 |
| 465 | 3300049775 | Ga0501279_002155 | Ga0501279_002155_23_913 | 285 |
| 466 | 3300049822 | Ga0501035_0009144 | Ga0501035_0009144_6756_7676 | 285 |
| 467 | 3300049822 | Ga0501035_0016465 | Ga0501035_0016465_150_1007 | 285 |
| 468 | 3300049823 | Ga0501044_0026464 | Ga0501044_0026464_1271_2128 | 285 |
| 469 | 3300050493 | nmdc:mga0k408_10915_c1 | nmdc:mga0k408_10915_c1_2870_3769 | 285 |
| 470 | 3300050493 | nmdc:mga0k408_77710_c1 | nmdc:mga0k408_77710_c1_129_1031 | 285 |
| 471 | 3300050507 | nmdc:mga05p37_13282_c1 | nmdc:mga05p37_13282_c1_5443_6342 | 285 |
| 472 | 3300050508 | nmdc:mga09592_55522_c1 | nmdc:mga09592_55522_c1_850_1827 | 285 |
| 473 | 3300050509 | nmdc:mga0qj67_25048_c1 | nmdc:mga0qj67_25048_c1_2087_2989 | 285 |
| 474 | 3300050510 | nmdc:mga06r32_145250_c1 | nmdc:mga06r32_145250_c1_436_1371 | 285 |
| 475 | 3300050510 | nmdc:mga06r32_146168_c1 | nmdc:mga06r32_146168_c1_901_1806 | 285 |
| 476 | 3300053085 | Ga0495619_0060746 | Ga0495619_0060746_879_1781 | 285 |
| 477 | 3300053086 | Ga0500578_0000325 | Ga0500578_0000325_56687_57586 | 285 |
| 478 | 3300053090 | Ga0500646_0034595 | Ga0500646_0034595_270_1169 | 285 |
| 479 | 3300053092 | Ga0500583_0000001 | Ga0500583_0000001_2547_3449 | 285 |
| 480 | 3300053092 | Ga0500583_0000568 | Ga0500583_0000568_1677_2564 | 285 |
| 481 | 3300053092 | Ga0500583_0117748 | Ga0500583_0117748_118_1017 | 285 |
| 482 | 3300053130 | Ga0500642_0028245 | Ga0500642_0028245_982_1869 | 285 |
| 483 | 3300053131 | Ga0500652_047039 | Ga0500652_047039_378_1280 | 285 |
| 484 | 3300053136 | Ga0500559_0037090 | Ga0500559_0037090_511_1419 | 285 |
| 485 | 3300053156 | Ga0500622_0025163 | Ga0500622_0025163_1947_2834 | 285 |
| 486 | 3300053178 | Ga0500637_0156285 | Ga0500637_0156285_367_1266 | 285 |
| 487 | iso_pu_bacteria | 2738541278 | 2738725483 | 285 |
| 488 | 3300000545 | CNXas_1000706 | CNXas_10007062 | 291 |
| 489 | 3300005290 | Ga0065712_10001960 | Ga0065712_100019607 | 291 |
| 490 | 3300005293 | Ga0065715_10097208 | Ga0065715_100972082 | 291 |
| 491 | 3300005295 | Ga0065707_10002043 | Ga0065707_100020434 | 291 |
| 492 | 3300005328 | Ga0070676_10247992 | Ga0070676_102479922 | 291 |
| 493 | 3300005347 | Ga0070668_100027115 | Ga0070668_1000271153 | 291 |
| 494 | 3300005353 | Ga0070669_100006130 | Ga0070669_1000061306 | 291 |
| 495 | 3300005353 | Ga0070669_100511574 | Ga0070669_1005115741 | 291 |
| 496 | 3300005354 | Ga0070675_100055342 | Ga0070675_1000553422 | 291 |
| 497 | 3300005364 | Ga0070673_100004569 | Ga0070673_1000045697 | 291 |
| 498 | 3300005438 | Ga0070701_10214139 | Ga0070701_102141391 | 291 |
| 499 | 3300005457 | Ga0070662_100010103 | Ga0070662_1000101033 | 291 |
| 500 | 3300005543 | Ga0070672_100056859 | Ga0070672_1000568593 | 291 |
| 501 | 3300005577 | Ga0068857_100011198 | Ga0068857_10001119812 | 291 |
| 502 | 3300005617 | Ga0068859_100258939 | Ga0068859_1002589392 | 291 |
| 503 | 3300005719 | Ga0068861_100023330 | Ga0068861_1000233304 | 291 |
| 504 | 3300005840 | Ga0068870_10001114 | Ga0068870_100011147 | 291 |
| 505 | 3300005844 | Ga0068862_100002954 | Ga0068862_10000295410 | 291 |
| 506 | 3300006931 | Ga0097620_100258957 | Ga0097620_1002589572 | 291 |
| 507 | 3300013104 | Ga0157370_10004229 | Ga0157370_100042293 | 291 |
| 508 | 3300025271 | Ga0207666_1006123 | Ga0207666_10061232 | 291 |
| 509 | 3300025900 | Ga0207710_10001781 | Ga0207710_1000178111 | 291 |
| 510 | 3300025908 | Ga0207643_10069206 | Ga0207643_100692063 | 291 |
| 511 | 3300025926 | Ga0207659_10021826 | Ga0207659_100218263 | 291 |
| 512 | 3300025933 | Ga0207706_10019841 | Ga0207706_100198416 | 291 |
| 513 | 3300025936 | Ga0207670_10263269 | Ga0207670_102632692 | 291 |
| 514 | 3300025938 | Ga0207704_10165799 | Ga0207704_101657992 | 291 |
| 515 | 3300025940 | Ga0207691_10065407 | Ga0207691_100654072 | 291 |
| 516 | 3300025942 | Ga0207689_10031493 | Ga0207689_100314934 | 291 |
| 517 | 3300025960 | Ga0207651_10005729 | Ga0207651_100057297 | 291 |
| 518 | 3300025961 | Ga0207712_10133284 | Ga0207712_101332843 | 291 |
| 519 | 3300026041 | Ga0207639_10021393 | Ga0207639_100213934 | 291 |
| 520 | 3300026116 | Ga0207674_10002491 | Ga0207674_1000249113 | 291 |
| 521 | 3300026118 | Ga0207675_100000282 | Ga0207675_10000028238 | 291 |
| 522 | 3300028380 | Ga0268265_10029729 | Ga0268265_100297294 | 291 |
| 523 | 3300028381 | Ga0268264_10051437 | Ga0268264_100514372 | 291 |
| 524 | 3300032004 | Ga0307414_10363021 | Ga0307414_103630211 | 291 |
| 525 | 3300042128 | Ga0450897_002901 | Ga0450897_002901_119_1003 | 291 |
| 526 | 3300046522 | Ga0495643_0017227 | Ga0495643_0017227_2596_3480 | 291 |
| 527 | 3300049571 | Ga0501034_0434594 | Ga0501034_0434594_261_1142 | 291 |
| 528 | 3300053096 | Ga0500641_0019019 | Ga0500641_0019019_571_1500 | 291 |
| 529 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_227716_228594 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.8053 | 1 | 290 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.7952 | 1 | 290 |
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7149 | 16 | 281 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7016 | 6 | 286 |
| 4tq4-assembly3.cif.gz_C | structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ | 0.6998 | 6 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1NJ83_69_223_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9689 | 11 | 163 | 1.10.357.140 |
| af_Q12887_160_330_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9661 | 11 | 181 | 1.10.357.140 |
| af_F1LVF4_158_307_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9611 | 11 | 160 | 1.10.357.140 |
| af_P21592_152_300_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9604 | 11 | 156 | 1.10.357.140 |
| af_A4I0M3_131_276_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9597 | 14 | 160 | 1.10.357.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257WHV2-F1-model_v4 | heme o synthase (EC 2.5.1.141) | 0.9943 | 2 | 174 |
GO:0006784
GO:0008495 GO:0016020 |
| AF-A0A537I1Q0-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9829 | 1 | 291 |
GO:0005886
GO:0006784 GO:0008495 GO:0048034 |
| AF-A0A4Q5RVW0-F1-model_v4 | Heme o synthase (EC 2.5.1.141) | 0.9816 | 45 | 291 |
GO:0005886
GO:0006783 GO:0008495 |
| AF-A0A562TD60-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9813 | 2 | 291 |
GO:0005886
GO:0006784 GO:0008495 GO:0048034 |
| AF-A0A537I1Q0-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9796 | 1 | 291 |
GO:0005886
GO:0006784 GO:0008495 GO:0048034 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar