F459879

General Info

Members Datasets Scaffolds Average Seq Length
529 234 528 297

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0012065|Ga0500646_0012065_839_1747
Length 302
Sequence MQQEVVTKSSSFKLADKLRDYMMLVKFSLTTMVVFSAVVSFLLVPGNHFNGKMMLLLFIAGFLVTGSANTINQVVEKDTDALMKRTAKRPVASGRMSTSEGYAFAIITGVLGVLMLWHFFNFTSAALAAFSLFLYAFIYTPLKKLNSISVLVGAVPGALPCLIGWTAGFYSDTVSWGGGWVLFGIQFFWQFPHFWAIAWLAHKDYSNAGFRLLPSVEGPTKYSAIQSIIYSLLLIPVGLLPYFTGMSGQVSLIIVLIANIFMIWQSVRLYREMEPKAARRVMFSSYIYLPIVLLALLMDKIG

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
160 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
207 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 0.76
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000706 3300000545 Bacteria 2171
2 rootH1_10041265 3300003323 Bacteria 2808
3 rootH1_10369669 3300003323 Bacteria 1562
4 Ga0065704_10095532 3300005289 Bacteria 2483
5 Ga0065712_10001960 3300005290 Bacteria 13513
6 Ga0065712_10089166 3300005290 Bacteria 2483
7 Ga0065715_10097208 3300005293 Bacteria 3745
8 Ga0065715_10124554 3300005293 Bacteria 2142
9 Ga0065707_10002043 3300005295 Bacteria 6348
10 Ga0065707_10119468 3300005295 Bacteria 2159
11 Ga0070658_10020785 3300005327 Bacteria 5260
12 Ga0070658_10345393 3300005327 Bacteria 1273
13 Ga0070676_10014319 3300005328 Bacteria 4359
14 Ga0070676_10247992 3300005328 Bacteria 1187
15 Ga0070683_100191390 3300005329 Bacteria 1942
16 Ga0070690_100096016 3300005330 Bacteria 1958
17 Ga0070670_100038566 3300005331 Bacteria 4109
18 Ga0070670_100317742 3300005331 Bacteria 1364
19 Ga0070670_100455286 3300005331 Bacteria 1134
20 Ga0070677_10057641 3300005333 Bacteria 1592
21 Ga0070677_10126152 3300005333 Bacteria 1162
22 Ga0068869_100015272 3300005334 Bacteria 5147
23 Ga0068869_100016680 3300005334 Bacteria 4954
24 Ga0068869_100027016 3300005334 Bacteria 3999
25 Ga0068869_100074258 3300005334 Bacteria 2523
26 Ga0068869_100103944 3300005334 Bacteria 2153
27 Ga0070666_10002756 3300005335 Bacteria 10618
28 Ga0070666_10058363 3300005335 Bacteria 2609
29 Ga0068868_100007171 3300005338 Bacteria 7920
30 Ga0068868_100008105 3300005338 Bacteria 7514
31 Ga0068868_100013885 3300005338 Bacteria 5920
32 Ga0068868_100093805 3300005338 Bacteria 2420
33 Ga0068868_100244249 3300005338 Bacteria 1509
34 Ga0070689_100018288 3300005340 Bacteria 5161
35 Ga0070689_100138505 3300005340 Bacteria 1955
36 Ga0070687_100015995 3300005343 Bacteria 3407
37 Ga0070661_100019264 3300005344 Bacteria 4862
38 Ga0070661_100058296 3300005344 Bacteria 2830
39 Ga0070661_100070753 3300005344 Bacteria 2566
40 Ga0070668_100009928 3300005347 Bacteria 7051
41 Ga0070668_100027115 3300005347 Bacteria 4348
42 Ga0070669_100006130 3300005353 Bacteria 8681
43 Ga0070669_100037400 3300005353 Bacteria 3521
44 Ga0070669_100340325 3300005353 Unclassified 1215
45 Ga0070669_100511574 3300005353 Bacteria 997
46 Ga0070675_100008867 3300005354 Bacteria 7819
47 Ga0070675_100022703 3300005354 Bacteria 5013
48 Ga0070675_100046846 3300005354 Bacteria 3542
49 Ga0070675_100048483 3300005354 Bacteria 3483
50 Ga0070675_100055342 3300005354 Bacteria 3265
51 Ga0070675_100063944 3300005354 Bacteria 3042
52 Ga0070675_100243738 3300005354 Bacteria 1571
53 Ga0070671_100045722 3300005355 Bacteria 3639
54 Ga0070671_100153881 3300005355 Unclassified 1942
55 Ga0070671_100374770 3300005355 Bacteria 1216
56 Ga0070671_100407822 3300005355 Bacteria 1163
57 Ga0070674_100049306 3300005356 Bacteria 2894
58 Ga0070673_100004569 3300005364 Bacteria 8773
59 Ga0070673_100007203 3300005364 Bacteria 7314
60 Ga0070673_100025956 3300005364 Bacteria 4320
61 Ga0070673_100111691 3300005364 Bacteria 2268
62 Ga0070688_100012159 3300005365 Bacteria 4813
63 Ga0070688_100029947 3300005365 Bacteria 3263
64 Ga0070688_100031379 3300005365 Bacteria 3196
65 Ga0070688_100076558 3300005365 Bacteria 2153
66 Ga0070688_100228082 3300005365 Bacteria 1316
67 Ga0070659_100075000 3300005366 Bacteria 2696
68 Ga0070667_100001797 3300005367 Bacteria 19092
69 Ga0070667_100039008 3300005367 Bacteria 3982
70 Ga0070667_100071668 3300005367 Bacteria 2951
71 Ga0070667_100074788 3300005367 Bacteria 2890
72 Ga0070667_100151519 3300005367 Bacteria 2037
73 Ga0070667_100245029 3300005367 Bacteria 1601
74 Ga0070701_10214139 3300005438 Bacteria 1145
75 Ga0070663_100202543 3300005455 Bacteria 1550
76 Ga0070678_100043720 3300005456 Bacteria 3194
77 Ga0070678_100046095 3300005456 Bacteria 3123
78 Ga0070678_100046738 3300005456 Bacteria 3106
79 Ga0070662_100010103 3300005457 Bacteria 6184
80 Ga0070662_100011969 3300005457 Bacteria 5738
81 Ga0070662_100013705 3300005457 Bacteria 5400
82 Ga0070662_100254106 3300005457 Bacteria 1414
83 Ga0068867_100055002 3300005459 Bacteria 2941
84 Ga0070685_10003854 3300005466 Bacteria 7589
85 Ga0070685_10024747 3300005466 Bacteria 3300
86 Ga0070685_10304188 3300005466 Bacteria 1075
87 Ga0070685_10313348 3300005466 Bacteria 1061
88 Ga0070698_100289902 3300005471 Bacteria 1568
89 Ga0070684_100012518 3300005535 Bacteria 6803
90 Ga0070684_100021281 3300005535 Bacteria 5394
91 Ga0070684_100190517 3300005535 Bacteria 1866
92 Ga0070684_100521868 3300005535 Unclassified 1101
93 Ga0068853_100026519 3300005539 Bacteria 4866
94 Ga0068853_100172361 3300005539 Bacteria 1958
95 Ga0070672_100005202 3300005543 Bacteria 8607
96 Ga0070672_100056859 3300005543 Bacteria 3069
97 Ga0070686_100288168 3300005544 Unclassified 1213
98 Ga0068855_100001990 3300005563 Bacteria 25375
99 Ga0068855_100127618 3300005563 Bacteria 2907
100 Ga0068855_100199390 3300005563 Bacteria 2254
101 Ga0068855_100358101 3300005563 Bacteria 1606
102 Ga0070664_100002665 3300005564 Bacteria 14400
103 Ga0070664_100090677 3300005564 Bacteria 2645
104 Ga0070664_100166405 3300005564 Bacteria 1954
105 Ga0068857_100002147 3300005577 Bacteria 16027
106 Ga0068857_100011198 3300005577 Bacteria 7801
107 Ga0068857_100021713 3300005577 Bacteria 5648
108 Ga0068854_100023210 3300005578 Bacteria 4235
109 Ga0068854_100047100 3300005578 Bacteria 3072
110 Ga0068854_100150145 3300005578 Bacteria 1796
111 Ga0068856_100028452 3300005614 Bacteria 5458
112 Ga0068856_100056543 3300005614 Bacteria 3871
113 Ga0068852_100012296 3300005616 Bacteria 6492
114 Ga0068852_100031270 3300005616 Bacteria 4391
115 Ga0068852_100133886 3300005616 Unclassified 2286
116 Ga0068852_100165662 3300005616 Bacteria 2068
117 Ga0068859_100002273 3300005617 Bacteria 19500
118 Ga0068859_100022848 3300005617 Bacteria 6271
119 Ga0068859_100032409 3300005617 Bacteria 5250
120 Ga0068859_100135588 3300005617 Bacteria 2534
121 Ga0068859_100258939 3300005617 Bacteria 1831
122 Ga0068859_100326181 3300005617 Bacteria 1629
123 Ga0068859_100378117 3300005617 Unclassified 1512
124 Ga0068859_100711870 3300005617 Bacteria 1094
125 Ga0068864_100033309 3300005618 Bacteria 4380
126 Ga0068864_100058674 3300005618 Bacteria 3327
127 Ga0068866_10040342 3300005718 Bacteria 2310
128 Ga0068866_10068080 3300005718 Bacteria 1871
129 Ga0068861_100006143 3300005719 Bacteria 8170
130 Ga0068861_100023330 3300005719 Bacteria 4462
131 Ga0068870_10001114 3300005840 Bacteria 10708
132 Ga0068870_10042382 3300005840 Bacteria 2370
133 Ga0068863_100078523 3300005841 Bacteria 3126
134 Ga0068863_100129113 3300005841 Bacteria 2413
135 Ga0068863_100328153 3300005841 Bacteria 1487
136 Ga0068858_100114610 3300005842 Bacteria 2518
137 Ga0068858_100156333 3300005842 Bacteria 2146
138 Ga0068860_100020848 3300005843 Bacteria 6350
139 Ga0068860_100068417 3300005843 Bacteria 3374
140 Ga0068860_100350084 3300005843 Bacteria 1454
141 Ga0068862_100002954 3300005844 Bacteria 14850
142 Ga0068862_100499200 3300005844 Bacteria 1155
143 Ga0081539_10047752 3300005985 Bacteria 2441
144 Ga0075366_10049791 3300006195 Bacteria 2487
145 Ga0075366_10090574 3300006195 Bacteria 1832
146 Ga0097621_100018519 3300006237 Bacteria 5323
147 Ga0068871_100053443 3300006358 Bacteria 3274
148 Ga0068871_100156147 3300006358 Unclassified 1948
149 Ga0068871_100320111 3300006358 Bacteria 1365
150 Ga0075428_100035534 3300006844 Bacteria 5493
151 Ga0075430_100008274 3300006846 Bacteria 8783
152 Ga0075431_100001819 3300006847 Bacteria 20141
153 Ga0075431_100042240 3300006847 Bacteria 4701
154 Ga0075431_100056175 3300006847 Bacteria 4061
155 Ga0075429_100007759 3300006880 Bacteria 9319
156 Ga0075429_100009788 3300006880 Bacteria 8312
157 Ga0075429_100023082 3300006880 Bacteria 5394
158 Ga0068865_100006196 3300006881 Bacteria 7291
159 Ga0097620_100002273 3300006931 Bacteria 19500
160 Ga0097620_100022848 3300006931 Bacteria 6271
161 Ga0097620_100032409 3300006931 Bacteria 5250
162 Ga0097620_100135583 3300006931 Bacteria 2534
163 Ga0097620_100258957 3300006931 Bacteria 1831
164 Ga0097620_100326190 3300006931 Bacteria 1629
165 Ga0097620_100378104 3300006931 Unclassified 1512
166 Ga0097620_100711878 3300006931 Bacteria 1094
167 Ga0105240_10000106 3300009093 Bacteria 171825
168 Ga0105240_10316322 3300009093 Bacteria 1781
169 Ga0105240_10323724 3300009093 Bacteria 1756
170 Ga0111539_10016779 3300009094 Bacteria 9073
171 Ga0111539_10082947 3300009094 Bacteria 3770
172 Ga0105245_10046668 3300009098 Bacteria 3871
173 Ga0105247_10014858 3300009101 Bacteria 4667
174 Ga0114129_10004788 3300009147 Bacteria 19131
175 Ga0105241_10000333 3300009174 Bacteria 35848
176 Ga0105241_10001117 3300009174 Bacteria 20448
177 Ga0105241_10042451 3300009174 Bacteria 3441
178 Ga0105241_10062358 3300009174 Bacteria 2874
179 Ga0105241_10093641 3300009174 Bacteria 2374
180 Ga0105242_10012927 3300009176 Bacteria 6435
181 Ga0105242_10123866 3300009176 Unclassified 2222
182 Ga0105242_10216925 3300009176 Bacteria 1708
183 Ga0105242_10376769 3300009176 Bacteria 1318
184 Ga0105242_10492099 3300009176 Bacteria 1165
185 Ga0105242_10507288 3300009176 Bacteria 1148
186 Ga0105248_10432377 3300009177 Bacteria 1482
187 Ga0105237_10002380 3300009545 Bacteria 23342
188 Ga0105237_10005940 3300009545 Bacteria 13687
189 Ga0105237_10014958 3300009545 Bacteria 8089
190 Ga0105237_10018678 3300009545 Bacteria 7168
191 Ga0105237_10173365 3300009545 Bacteria 2157
192 Ga0105238_10017549 3300009551 Bacteria 7278
193 Ga0105238_10103405 3300009551 Bacteria 2830
194 Ga0105238_10273999 3300009551 Bacteria 1668
195 Ga0105249_10001813 3300009553 Bacteria 18581
196 Ga0105249_10078154 3300009553 Bacteria 3070
197 Ga0105249_10112821 3300009553 Bacteria 2571
198 Ga0105249_10124897 3300009553 Bacteria 2449
199 Ga0105249_10782085 3300009553 Bacteria 1018
200 Ga0105239_10007405 3300010375 Bacteria 12592
201 Ga0105239_10009676 3300010375 Bacteria 10839
202 Ga0105239_10015390 3300010375 Bacteria 8475
203 Ga0105239_10170872 3300010375 Bacteria 2431
204 Ga0105246_10001264 3300011119 Bacteria 14839
205 Ga0105246_10079360 3300011119 Bacteria 2334
206 Ga0105246_10162624 3300011119 Bacteria 1702
207 Ga0105246_10186876 3300011119 Bacteria 1600
208 Ga0157370_10004229 3300013104 Bacteria 16610
209 Ga0157374_10002752 3300013296 Bacteria 14766
210 Ga0157374_10038728 3300013296 Unclassified 4383
211 Ga0157374_10073936 3300013296 Bacteria 3217
212 Ga0157374_10135901 3300013296 Bacteria 2383
213 Ga0157374_10215386 3300013296 Bacteria 1884
214 Ga0157378_10112642 3300013297 Bacteria 2496
215 Ga0157378_10121749 3300013297 Bacteria 2405
216 Ga0157378_10183188 3300013297 Unclassified 1971
217 Ga0157378_10206522 3300013297 Bacteria 1860
218 Ga0157378_10208462 3300013297 Unclassified 1852
219 Ga0157378_10298636 3300013297 Bacteria 1558
220 Ga0163162_10000612 3300013306 Bacteria 33144
221 Ga0163162_10001367 3300013306 Bacteria 22697
222 Ga0163162_10001786 3300013306 Bacteria 20177
223 Ga0163162_10165389 3300013306 Unclassified 2335
224 Ga0163162_10171057 3300013306 Bacteria 2297
225 Ga0163162_10197494 3300013306 Bacteria 2141
226 Ga0163162_10199989 3300013306 Bacteria 2127
227 Ga0163162_10475840 3300013306 Bacteria 1380
228 Ga0163162_10599510 3300013306 Bacteria 1228
229 Ga0163162_10632511 3300013306 Bacteria 1195
230 Ga0157372_10000463 3300013307 Bacteria 44664
231 Ga0157372_10181378 3300013307 Bacteria 2437
232 Ga0157372_10462248 3300013307 Unclassified 1479
233 Ga0157372_10554323 3300013307 Bacteria 1340
234 Ga0157375_10009867 3300013308 Bacteria 8397
235 Ga0157375_10020099 3300013308 Bacteria 6095
236 Ga0157375_10035566 3300013308 Bacteria 4756
237 Ga0157375_10055142 3300013308 Bacteria 3918
238 Ga0157375_10121739 3300013308 Bacteria 2719
239 Ga0157375_10161888 3300013308 Bacteria 2380
240 Ga0157375_10181663 3300013308 Bacteria 2255
241 Ga0163163_10001998 3300014325 Bacteria 17228
242 Ga0163163_10141344 3300014325 Bacteria 2450
243 Ga0163163_10339595 3300014325 Bacteria 1557
244 Ga0157380_10000255 3300014326 Bacteria 31852
245 Ga0157380_10304165 3300014326 Bacteria 1470
246 Ga0157377_10000877 3300014745 Bacteria 12514
247 Ga0157377_10023386 3300014745 Bacteria 3274
248 Ga0157377_10050702 3300014745 Bacteria 2338
249 Ga0157379_10037393 3300014968 Bacteria 4328
250 Ga0157379_10081389 3300014968 Bacteria 2901
251 Ga0157379_10422469 3300014968 Bacteria 1228
252 Ga0157376_10007329 3300014969 Bacteria 7862
253 Ga0157376_10026592 3300014969 Bacteria 4575
254 Ga0157376_10133097 3300014969 Unclassified 2222
255 Ga0157376_10184917 3300014969 Bacteria 1907
256 Ga0157376_10212783 3300014969 Bacteria 1786
257 Ga0163161_10024623 3300017792 Bacteria 4253
258 Ga0163161_10070335 3300017792 Bacteria 2559
259 Ga0163161_10073748 3300017792 Bacteria 2501
260 Ga0209646_1001248 3300025246 Bacteria 7215
261 Ga0207666_1006123 3300025271 Bacteria 1553
262 Ga0207697_10042943 3300025315 Bacteria 1858
263 Ga0207697_10054196 3300025315 Bacteria 1662
264 Ga0207656_10020010 3300025321 Bacteria 2654
265 Ga0207682_10015835 3300025893 Bacteria 2939
266 Ga0207642_10004323 3300025899 Bacteria 4579
267 Ga0207642_10041665 3300025899 Bacteria 2012
268 Ga0207710_10001781 3300025900 Bacteria 10400
269 Ga0207688_10003300 3300025901 Bacteria 8816
270 Ga0207680_10007538 3300025903 Bacteria 5315
271 Ga0207680_10079798 3300025903 Bacteria 2053
272 Ga0207647_10004599 3300025904 Bacteria 10219
273 Ga0207645_10003291 3300025907 Bacteria 12324
274 Ga0207645_10005892 3300025907 Bacteria 8831
275 Ga0207643_10017667 3300025908 Bacteria 3903
276 Ga0207643_10069206 3300025908 Bacteria 2028
277 Ga0207705_10114161 3300025909 Bacteria 1998
278 Ga0207705_10281595 3300025909 Bacteria 1273
279 Ga0207684_10498792 3300025910 Bacteria 1043
280 Ga0207654_10000620 3300025911 Bacteria 20025
281 Ga0207654_10024091 3300025911 Bacteria 3268
282 Ga0207654_10026063 3300025911 Bacteria 3162
283 Ga0207654_10078538 3300025911 Bacteria 1980
284 Ga0207695_10003167 3300025913 Bacteria 23458
285 Ga0207695_10018118 3300025913 Bacteria 8149
286 Ga0207695_10029606 3300025913 Bacteria 6043
287 Ga0207671_10002324 3300025914 Bacteria 20513
288 Ga0207671_10002511 3300025914 Bacteria 19577
289 Ga0207671_10008910 3300025914 Bacteria 8449
290 Ga0207662_10046491 3300025918 Bacteria 2568
291 Ga0207649_10068425 3300025920 Bacteria 2257
292 Ga0207649_10284569 3300025920 Bacteria 1203
293 Ga0207681_10016574 3300025923 Bacteria 4611
294 Ga0207681_10173295 3300025923 Unclassified 1637
295 Ga0207681_10397603 3300025923 Bacteria 1112
296 Ga0207694_10005398 3300025924 Bacteria 9836
297 Ga0207694_10102112 3300025924 Bacteria 2273
298 Ga0207650_10022618 3300025925 Bacteria 4450
299 Ga0207650_10031707 3300025925 Bacteria 3818
300 Ga0207650_10182120 3300025925 Bacteria 1674
301 Ga0207650_10203713 3300025925 Bacteria 1586
302 Ga0207650_10374720 3300025925 Bacteria 1174
303 Ga0207659_10015767 3300025926 Bacteria 4906
304 Ga0207659_10021826 3300025926 Bacteria 4257
305 Ga0207659_10045946 3300025926 Bacteria 3081
306 Ga0207659_10096159 3300025926 Bacteria 2223
307 Ga0207659_10108763 3300025926 Bacteria 2103
308 Ga0207644_10250003 3300025931 Unclassified 1414
309 Ga0207690_10262676 3300025932 Bacteria 1338
310 Ga0207706_10004710 3300025933 Bacteria 12777
311 Ga0207706_10015998 3300025933 Bacteria 6778
312 Ga0207706_10019841 3300025933 Bacteria 6042
313 Ga0207706_10054002 3300025933 Bacteria 3546
314 Ga0207706_10258254 3300025933 Bacteria 1521
315 Ga0207706_10347699 3300025933 Bacteria 1289
316 Ga0207686_10029678 3300025934 Bacteria 3229
317 Ga0207686_10090156 3300025934 Unclassified 2022
318 Ga0207686_10178682 3300025934 Bacteria 1503
319 Ga0207686_10264597 3300025934 Bacteria 1262
320 Ga0207670_10016254 3300025936 Bacteria 4467
321 Ga0207670_10076046 3300025936 Bacteria 2336
322 Ga0207670_10180626 3300025936 Bacteria 1589
323 Ga0207670_10263269 3300025936 Bacteria 1337
324 Ga0207669_10037332 3300025937 Bacteria 2786
325 Ga0207704_10038307 3300025938 Bacteria 2779
326 Ga0207704_10090436 3300025938 Bacteria 2009
327 Ga0207704_10165799 3300025938 Bacteria 1578
328 Ga0207691_10031370 3300025940 Bacteria 4960
329 Ga0207691_10039933 3300025940 Bacteria 4340
330 Ga0207691_10042959 3300025940 Bacteria 4167
331 Ga0207691_10065407 3300025940 Bacteria 3291
332 Ga0207711_10338106 3300025941 Bacteria 1393
333 Ga0207689_10001049 3300025942 Bacteria 26546
334 Ga0207689_10010413 3300025942 Bacteria 8005
335 Ga0207689_10012954 3300025942 Bacteria 7122
336 Ga0207689_10023916 3300025942 Bacteria 5125
337 Ga0207689_10031493 3300025942 Bacteria 4414
338 Ga0207689_10037971 3300025942 Bacteria 3991
339 Ga0207689_10067436 3300025942 Bacteria 2941
340 Ga0207689_10168893 3300025942 Bacteria 1803
341 Ga0207661_10053129 3300025944 Bacteria 3240
342 Ga0207661_10072945 3300025944 Bacteria 2810
343 Ga0207679_10001622 3300025945 Bacteria 14023
344 Ga0207679_10058749 3300025945 Bacteria 2851
345 Ga0207679_10070163 3300025945 Bacteria 2640
346 Ga0207679_10239284 3300025945 Bacteria 1537
347 Ga0207667_10001242 3300025949 Bacteria 31953
348 Ga0207667_10018750 3300025949 Bacteria 7750
349 Ga0207667_10020034 3300025949 Bacteria 7449
350 Ga0207651_10005729 3300025960 Bacteria 6415
351 Ga0207651_10047510 3300025960 Bacteria 2895
352 Ga0207651_10107640 3300025960 Bacteria 2084
353 Ga0207651_10344345 3300025960 Bacteria 1253
354 Ga0207712_10015278 3300025961 Bacteria 4949
355 Ga0207712_10047061 3300025961 Bacteria 2993
356 Ga0207712_10102733 3300025961 Bacteria 2128
357 Ga0207712_10133284 3300025961 Bacteria 1896
358 Ga0207668_10048032 3300025972 Bacteria 2926
359 Ga0207668_10158163 3300025972 Bacteria 1762
360 Ga0207640_10032118 3300025981 Bacteria 3253
361 Ga0207640_10248329 3300025981 Bacteria 1379
362 Ga0207658_10022996 3300025986 Bacteria 4345
363 Ga0207658_10068969 3300025986 Bacteria 2670
364 Ga0207658_10209613 3300025986 Bacteria 1632
365 Ga0207658_10424517 3300025986 Bacteria 1173
366 Ga0207677_10007320 3300026023 Bacteria 6096
367 Ga0207677_10044906 3300026023 Bacteria 2947
368 Ga0207677_10198727 3300026023 Bacteria 1592
369 Ga0207677_10252854 3300026023 Unclassified 1432
370 Ga0207677_10295960 3300026023 Bacteria 1335
371 Ga0207703_10175097 3300026035 Bacteria 1890
372 Ga0207639_10021393 3300026041 Bacteria 4645
373 Ga0207639_10127747 3300026041 Bacteria 2099
374 Ga0207639_10183532 3300026041 Bacteria 1781
375 Ga0207678_10119695 3300026067 Bacteria 2247
376 Ga0207702_10050648 3300026078 Bacteria 3506
377 Ga0207702_10084238 3300026078 Bacteria 2768
378 Ga0207641_10000318 3300026088 Bacteria 59432
379 Ga0207641_10100939 3300026088 Unclassified 2542
380 Ga0207641_10116934 3300026088 Bacteria 2373
381 Ga0207648_10005292 3300026089 Bacteria 13021
382 Ga0207648_10006356 3300026089 Bacteria 11747
383 Ga0207648_10182328 3300026089 Bacteria 1858
384 Ga0207676_10265047 3300026095 Bacteria 1553
385 Ga0207674_10000453 3300026116 Bacteria 53589
386 Ga0207674_10002491 3300026116 Bacteria 23220
387 Ga0207674_10037607 3300026116 Bacteria 5032
388 Ga0207674_10296688 3300026116 Bacteria 1565
389 Ga0207675_100000282 3300026118 Bacteria 48883
390 Ga0207675_100012049 3300026118 Bacteria 8077
391 Ga0207683_10000957 3300026121 Bacteria 26469
392 Ga0207683_10003845 3300026121 Bacteria 13020
393 Ga0207683_10017665 3300026121 Bacteria 6082
394 Ga0207698_10018771 3300026142 Bacteria 4720
395 Ga0207698_10018924 3300026142 Bacteria 4703
396 Ga0207698_10022200 3300026142 Bacteria 4405
397 Ga0207698_10089065 3300026142 Bacteria 2519
398 Ga0268266_10000048 3300028379 Bacteria 310336
399 Ga0268266_10022104 3300028379 Bacteria 5422
400 Ga0268266_10146482 3300028379 Bacteria 2124
401 Ga0268265_10029729 3300028380 Bacteria 3927
402 Ga0268265_10331563 3300028380 Bacteria 1382
403 Ga0268264_10000028 3300028381 Bacteria 426662
404 Ga0268264_10014694 3300028381 Bacteria 6433
405 Ga0268264_10014908 3300028381 Bacteria 6385
406 Ga0268264_10051437 3300028381 Bacteria 3433
407 Ga0307515_10004954 3300028794 Bacteria 27162
408 Ga0307513_10118555 3300031456 Bacteria 2621
409 Ga0307513_10246855 3300031456 Bacteria 1585
410 Ga0307509_10073328 3300031507 Bacteria 3564
411 Ga0307406_10136073 3300031901 Bacteria 1732
412 Ga0307412_10140120 3300031911 Bacteria 1770
413 Ga0307416_100281525 3300032002 Bacteria 1640
414 Ga0307414_10143496 3300032004 Bacteria 1873
415 Ga0307414_10363021 3300032004 Bacteria 1247
416 Ga0307415_100057989 3300032126 Bacteria 2664
417 Ga0373927_0024799 3300035695 Bacteria 3919
418 Ga0373933_0119857 3300035724 Unclassified 1647
419 Ga0373937_0019641 3300036401 Bacteria 6049
420 Ga0373925_0543544 3300037068 Bacteria 955
421 Ga0439436_0000372 3300041404 Bacteria 11185
422 Ga0451849_0713589 3300041505 Bacteria 2131
423 Ga0439441_001208 3300042001 Bacteria 3289
424 Ga0439457_000079 3300042014 Bacteria 21395
425 Ga0439457_008871 3300042014 Bacteria 2358
426 Ga0450923_003226 3300042125 Bacteria 2437
427 Ga0450897_002901 3300042128 Bacteria 1332
428 Ga0439444_0018094 3300042437 Bacteria 1217
429 Ga0451577_0186842 3300042876 Bacteria 1869
430 Ga0466969_0000869 3300044656 Bacteria 16375
431 Ga0466972_0000049 3300044658 Bacteria 118829
432 Ga0466972_0000640 3300044658 Bacteria 16947
433 Ga0466966_0000096 3300044684 Bacteria 54307
434 Ga0466968_0006651 3300044735 Bacteria 4366
435 Ga0466957_0006774 3300044842 Bacteria 6474
436 Ga0466960_0025224 3300044901 Bacteria 2689
437 Ga0466959_0000014 3300045049 Bacteria 150962
438 Ga0495638_0031164 3300046460 Bacteria 3428
439 Ga0495638_0080380 3300046460 Bacteria 1981
440 Ga0495653_0250432 3300046463 Bacteria 1176
441 Ga0495594_0133025 3300046499 Bacteria 1409
442 Ga0495618_0179204 3300046514 Unclassified 1347
443 Ga0495628_0115970 3300046516 Bacteria 2057
444 Ga0495643_0017227 3300046522 Bacteria 4227
445 Ga0495648_0001979 3300046524 Bacteria 19467
446 Ga0495598_0052181 3300046537 Bacteria 1235
447 Ga0495621_0007054 3300046539 Bacteria 3310
448 Ga0495668_0002514 3300046616 Bacteria 14989
449 Ga0495634_0038674 3300046642 Bacteria 3252
450 Ga0495611_0124335 3300046648 Bacteria 1203
451 Ga0495674_0207469 3300047319 Unclassified 1624
452 Ga0496104_0269251 3300048907 Bacteria 1616
453 Ga0496110_0464666 3300048913 Bacteria 1153
454 Ga0496111_0197353 3300048914 Bacteria 1496
455 Ga0496111_0227246 3300048914 Bacteria 1386
456 Ga0501290_000624 3300049513 Bacteria 5309
457 Ga0501031_0016589 3300049568 Bacteria 4782
458 Ga0501032_0002853 3300049569 Bacteria 13437
459 Ga0501032_0035240 3300049569 Bacteria 3423
460 Ga0501034_0003412 3300049571 Bacteria 18136
461 Ga0501034_0227450 3300049571 Bacteria 1816
462 Ga0501034_0380490 3300049571 Bacteria 1336
463 Ga0501034_0434594 3300049571 Bacteria 1232
464 Ga0501036_0039650 3300049572 Bacteria 3985
465 Ga0501036_0046770 3300049572 Bacteria 3664
466 Ga0501036_0168788 3300049572 Bacteria 1844
467 Ga0501037_0053750 3300049573 Bacteria 2946
468 Ga0501037_0143368 3300049573 Bacteria 1709
469 Ga0501038_0002256 3300049574 Bacteria 17927
470 Ga0501043_0012846 3300049579 Bacteria 6545
471 Ga0501043_0074642 3300049579 Bacteria 2664
472 Ga0501043_0088724 3300049579 Bacteria 2430
473 Ga0501043_0283147 3300049579 Bacteria 1270
474 Ga0501043_0324773 3300049579 Bacteria 1173
475 Ga0501047_0015552 3300049581 Bacteria 7250
476 Ga0501047_0089002 3300049581 Bacteria 2964
477 Ga0501048_0109238 3300049582 Bacteria 1953
478 Ga0501072_0084708 3300049588 Bacteria 2514
479 Ga0501201_000509 3300049651 Bacteria 3595
480 Ga0501201_003224 3300049651 Bacteria 1495
481 Ga0501202_000030 3300049652 Bacteria 14265
482 Ga0501202_007110 3300049652 Bacteria 2018
483 Ga0501202_011460 3300049652 Bacteria 1661
484 Ga0501207_000663 3300049654 Bacteria 4009
485 Ga0501223_001644 3300049663 Bacteria 5126
486 Ga0501223_007789 3300049663 Bacteria 2187
487 Ga0501224_000870 3300049664 Bacteria 3879
488 Ga0501233_001309 3300049668 Bacteria 4254
489 Ga0501233_027344 3300049668 Bacteria 1266
490 Ga0501235_000549 3300049669 Bacteria 7508
491 Ga0501242_005821 3300049674 Bacteria 1396
492 Ga0501257_018887 3300049686 Bacteria 1611
493 Ga0501259_000179 3300049688 Bacteria 9653
494 Ga0501221_000643 3300049704 Bacteria 5600
495 Ga0501221_018127 3300049704 Bacteria 1352
496 Ga0501225_0000262 3300049705 Bacteria 16611
497 Ga0501225_0002072 3300049705 Bacteria 6235
498 Ga0501234_000856 3300049707 Bacteria 4788
499 Ga0501080_0488231 3300049742 Unclassified 1101
500 Ga0501279_002155 3300049775 Bacteria 2606
501 Ga0501035_0009144 3300049822 Bacteria 9215
502 Ga0501035_0016465 3300049822 Bacteria 6818
503 Ga0501035_0167748 3300049822 Bacteria 1898
504 Ga0501044_0001096 3300049823 Bacteria 32262
505 Ga0501044_0026464 3300049823 Bacteria 6139
506 Ga0501284_00934 3300050005 Bacteria 1521
507 nmdc:mga0k408_10915_c1 3300050493 Bacteria 4927
508 nmdc:mga0k408_77710_c1 3300050493 Bacteria 1941
509 nmdc:mga05p37_13282_c1 3300050507 Bacteria 9860
510 nmdc:mga09592_55522_c1 3300050508 Bacteria 3347
511 nmdc:mga0qj67_25048_c1 3300050509 Bacteria 4606
512 nmdc:mga06r32_145250_c1 3300050510 Bacteria 2350
513 nmdc:mga06r32_146168_c1 3300050510 Bacteria 2341
514 nmdc:mga08y16_33392_c1 3300050511 Bacteria 5404
515 Ga0495619_0060746 3300053085 Bacteria 2513
516 Ga0500578_0000325 3300053086 Bacteria 58251
517 Ga0500646_0012065 3300053090 Bacteria 2229
518 Ga0500646_0034595 3300053090 Bacteria 1401
519 Ga0500583_0000001 3300053092 Bacteria 241642
520 Ga0500583_0000568 3300053092 Bacteria 11176
521 Ga0500583_0117748 3300053092 Bacteria 1312
522 Ga0500641_0019019 3300053096 Bacteria 2592
523 Ga0500642_0028245 3300053130 Bacteria 2312
524 Ga0500652_047039 3300053131 Bacteria 1752
525 Ga0500559_0037090 3300053136 Bacteria 2112
526 Ga0500622_0025163 3300053156 Bacteria 3147
527 Ga0500637_0156285 3300053178 Bacteria 1316
528 Ga0500611_000003 3300053727 Bacteria 333431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10119468 Ga0065707_101194682 268
2 3300049569 Ga0501032_0035240 Ga0501032_0035240_1816_2727 270
3 3300049571 Ga0501034_0380490 Ga0501034_0380490_53_964 270
4 3300049572 Ga0501036_0168788 Ga0501036_0168788_451_1362 270
5 3300049573 Ga0501037_0143368 Ga0501037_0143368_36_947 270
6 3300049579 Ga0501043_0283147 Ga0501043_0283147_177_1088 270
7 3300049822 Ga0501035_0167748 Ga0501035_0167748_481_1392 270
8 3300031456 Ga0307513_10118555 Ga0307513_101185552 271
9 3300005340 Ga0070689_100018288 Ga0070689_1000182882 274
10 3300005365 Ga0070688_100031379 Ga0070688_1000313792 274
11 3300009094 Ga0111539_10016779 Ga0111539_100167796 274
12 3300009553 Ga0105249_10078154 Ga0105249_100781543 274
13 3300013306 Ga0163162_10475840 Ga0163162_104758401 274
14 3300013308 Ga0157375_10020099 Ga0157375_100200992 274
15 3300014326 Ga0157380_10000255 Ga0157380_100002559 274
16 3300014745 Ga0157377_10000877 Ga0157377_100008775 274
17 3300025923 Ga0207681_10016574 Ga0207681_100165743 274
18 3300025972 Ga0207668_10158163 Ga0207668_101581632 274
19 3300050511 nmdc:mga08y16_33392_c1 nmdc:mga08y16_33392_c1_2166_3014 274
20 3300005578 Ga0068854_100150145 Ga0068854_1001501452 275
21 3300049571 Ga0501034_0003412 Ga0501034_0003412_1105_1944 278
22 3300049572 Ga0501036_0046770 Ga0501036_0046770_1775_2614 278
23 3300049573 Ga0501037_0053750 Ga0501037_0053750_269_1108 278
24 3300049579 Ga0501043_0074642 Ga0501043_0074642_1747_2586 278
25 3300049579 Ga0501043_0088724 Ga0501043_0088724_524_1363 278
26 3300049581 Ga0501047_0089002 Ga0501047_0089002_1820_2659 278
27 3300049823 Ga0501044_0001096 Ga0501044_0001096_20439_21278 278
28 3300050005 Ga0501284_00934 Ga0501284_00934_93_980 281
29 3300005366 Ga0070659_100075000 Ga0070659_1000750002 282
30 3300005563 Ga0068855_100127618 Ga0068855_1001276182 282
31 3300005577 Ga0068857_100002147 Ga0068857_1000021479 282
32 3300005614 Ga0068856_100056543 Ga0068856_1000565435 282
33 3300005616 Ga0068852_100012296 Ga0068852_1000122962 282
34 3300009093 Ga0105240_10323724 Ga0105240_103237242 282
35 3300009174 Ga0105241_10062358 Ga0105241_100623582 282
36 3300009551 Ga0105238_10017549 Ga0105238_100175492 282
37 3300013307 Ga0157372_10000463 Ga0157372_1000046331 282
38 3300025904 Ga0207647_10004599 Ga0207647_100045995 282
39 3300025911 Ga0207654_10026063 Ga0207654_100260634 282
40 3300025924 Ga0207694_10005398 Ga0207694_100053989 282
41 3300025932 Ga0207690_10262676 Ga0207690_102626762 282
42 3300025949 Ga0207667_10001242 Ga0207667_1000124215 282
43 3300026078 Ga0207702_10050648 Ga0207702_100506484 282
44 3300026116 Ga0207674_10000453 Ga0207674_1000045318 282
45 3300026142 Ga0207698_10018771 Ga0207698_100187712 282
46 3300005327 Ga0070658_10020785 Ga0070658_100207852 283
47 3300005327 Ga0070658_10345393 Ga0070658_103453931 283
48 3300005563 Ga0068855_100358101 Ga0068855_1003581011 283
49 3300013297 Ga0157378_10208462 Ga0157378_102084622 283
50 3300025903 Ga0207680_10007538 Ga0207680_100075383 283
51 3300025909 Ga0207705_10114161 Ga0207705_101141612 283
52 3300025909 Ga0207705_10281595 Ga0207705_102815952 283
53 3300005328 Ga0070676_10014319 Ga0070676_100143193 284
54 3300005333 Ga0070677_10057641 Ga0070677_100576412 284
55 3300005334 Ga0068869_100074258 Ga0068869_1000742583 284
56 3300005334 Ga0068869_100103944 Ga0068869_1001039442 284
57 3300005335 Ga0070666_10002756 Ga0070666_100027566 284
58 3300005338 Ga0068868_100013885 Ga0068868_1000138855 284
59 3300005347 Ga0070668_100009928 Ga0070668_1000099283 284
60 3300005353 Ga0070669_100037400 Ga0070669_1000374002 284
61 3300005355 Ga0070671_100374770 Ga0070671_1003747701 284
62 3300005356 Ga0070674_100049306 Ga0070674_1000493063 284
63 3300005364 Ga0070673_100025956 Ga0070673_1000259563 284
64 3300005367 Ga0070667_100071668 Ga0070667_1000716683 284
65 3300005367 Ga0070667_100245029 Ga0070667_1002450292 284
66 3300005456 Ga0070678_100046738 Ga0070678_1000467382 284
67 3300005457 Ga0070662_100254106 Ga0070662_1002541061 284
68 3300005459 Ga0068867_100055002 Ga0068867_1000550022 284
69 3300005543 Ga0070672_100005202 Ga0070672_1000052027 284
70 3300005564 Ga0070664_100166405 Ga0070664_1001664052 284
71 3300005578 Ga0068854_100023210 Ga0068854_1000232101 284
72 3300005617 Ga0068859_100002273 Ga0068859_10000227310 284
73 3300005718 Ga0068866_10068080 Ga0068866_100680802 284
74 3300005841 Ga0068863_100328153 Ga0068863_1003281532 284
75 3300005844 Ga0068862_100499200 Ga0068862_1004992001 284
76 3300006195 Ga0075366_10090574 Ga0075366_100905743 284
77 3300006237 Ga0097621_100018519 Ga0097621_1000185194 284
78 3300006358 Ga0068871_100053443 Ga0068871_1000534433 284
79 3300006881 Ga0068865_100006196 Ga0068865_1000061963 284
80 3300006931 Ga0097620_100002273 Ga0097620_10000227310 284
81 3300009174 Ga0105241_10093641 Ga0105241_100936413 284
82 3300009176 Ga0105242_10012927 Ga0105242_100129273 284
83 3300009176 Ga0105242_10216925 Ga0105242_102169252 284
84 3300009176 Ga0105242_10376769 Ga0105242_103767691 284
85 3300009553 Ga0105249_10124897 Ga0105249_101248972 284
86 3300011119 Ga0105246_10001264 Ga0105246_1000126410 284
87 3300013296 Ga0157374_10135901 Ga0157374_101359012 284
88 3300013297 Ga0157378_10298636 Ga0157378_102986362 284
89 3300013306 Ga0163162_10197494 Ga0163162_101974941 284
90 3300013308 Ga0157375_10055142 Ga0157375_100551422 284
91 3300025893 Ga0207682_10015835 Ga0207682_100158352 284
92 3300025899 Ga0207642_10041665 Ga0207642_100416652 284
93 3300025901 Ga0207688_10003300 Ga0207688_100033004 284
94 3300025907 Ga0207645_10003291 Ga0207645_1000329111 284
95 3300025933 Ga0207706_10054002 Ga0207706_100540025 284
96 3300025934 Ga0207686_10029678 Ga0207686_100296783 284
97 3300025937 Ga0207669_10037332 Ga0207669_100373323 284
98 3300025938 Ga0207704_10038307 Ga0207704_100383072 284
99 3300025938 Ga0207704_10090436 Ga0207704_100904362 284
100 3300025940 Ga0207691_10031370 Ga0207691_100313703 284
101 3300025942 Ga0207689_10001049 Ga0207689_1000104910 284
102 3300025942 Ga0207689_10012954 Ga0207689_100129543 284
103 3300025960 Ga0207651_10107640 Ga0207651_101076402 284
104 3300025961 Ga0207712_10047061 Ga0207712_100470613 284
105 3300025961 Ga0207712_10102733 Ga0207712_101027332 284
106 3300025972 Ga0207668_10048032 Ga0207668_100480322 284
107 3300025981 Ga0207640_10248329 Ga0207640_102483292 284
108 3300025986 Ga0207658_10068969 Ga0207658_100689693 284
109 3300026023 Ga0207677_10044906 Ga0207677_100449062 284
110 3300026035 Ga0207703_10175097 Ga0207703_101750972 284
111 3300026089 Ga0207648_10005292 Ga0207648_1000529210 284
112 3300026121 Ga0207683_10000957 Ga0207683_1000095720 284
113 3300028379 Ga0268266_10022104 Ga0268266_100221043 284
114 3300028380 Ga0268265_10331563 Ga0268265_103315632 284
115 3300053090 Ga0500646_0012065 Ga0500646_0012065_839_1747 284
116 3300003323 rootH1_10041265 rootH1_100412653 285
117 3300003323 rootH1_10369669 rootH1_103696692 285
118 3300005289 Ga0065704_10095532 Ga0065704_100955322 285
119 3300005290 Ga0065712_10089166 Ga0065712_100891663 285
120 3300005293 Ga0065715_10124554 Ga0065715_101245542 285
121 3300005329 Ga0070683_100191390 Ga0070683_1001913902 285
122 3300005330 Ga0070690_100096016 Ga0070690_1000960162 285
123 3300005331 Ga0070670_100038566 Ga0070670_1000385662 285
124 3300005331 Ga0070670_100317742 Ga0070670_1003177421 285
125 3300005331 Ga0070670_100455286 Ga0070670_1004552862 285
126 3300005333 Ga0070677_10126152 Ga0070677_101261521 285
127 3300005334 Ga0068869_100015272 Ga0068869_1000152726 285
128 3300005334 Ga0068869_100016680 Ga0068869_1000166804 285
129 3300005334 Ga0068869_100027016 Ga0068869_1000270165 285
130 3300005335 Ga0070666_10058363 Ga0070666_100583632 285
131 3300005338 Ga0068868_100007171 Ga0068868_1000071714 285
132 3300005338 Ga0068868_100008105 Ga0068868_1000081057 285
133 3300005338 Ga0068868_100093805 Ga0068868_1000938053 285
134 3300005338 Ga0068868_100244249 Ga0068868_1002442492 285
135 3300005340 Ga0070689_100138505 Ga0070689_1001385052 285
136 3300005343 Ga0070687_100015995 Ga0070687_1000159953 285
137 3300005344 Ga0070661_100019264 Ga0070661_1000192646 285
138 3300005344 Ga0070661_100058296 Ga0070661_1000582962 285
139 3300005344 Ga0070661_100070753 Ga0070661_1000707532 285
140 3300005353 Ga0070669_100340325 Ga0070669_1003403251 285
141 3300005354 Ga0070675_100008867 Ga0070675_1000088677 285
142 3300005354 Ga0070675_100022703 Ga0070675_1000227035 285
143 3300005354 Ga0070675_100046846 Ga0070675_1000468464 285
144 3300005354 Ga0070675_100048483 Ga0070675_1000484834 285
145 3300005354 Ga0070675_100063944 Ga0070675_1000639441 285
146 3300005354 Ga0070675_100243738 Ga0070675_1002437381 285
147 3300005355 Ga0070671_100045722 Ga0070671_1000457222 285
148 3300005355 Ga0070671_100153881 Ga0070671_1001538812 285
149 3300005355 Ga0070671_100407822 Ga0070671_1004078221 285
150 3300005364 Ga0070673_100007203 Ga0070673_1000072039 285
151 3300005364 Ga0070673_100111691 Ga0070673_1001116912 285
152 3300005365 Ga0070688_100012159 Ga0070688_1000121592 285
153 3300005365 Ga0070688_100029947 Ga0070688_1000299473 285
154 3300005365 Ga0070688_100076558 Ga0070688_1000765582 285
155 3300005365 Ga0070688_100228082 Ga0070688_1002280822 285
156 3300005367 Ga0070667_100001797 Ga0070667_10000179711 285
157 3300005367 Ga0070667_100039008 Ga0070667_1000390082 285
158 3300005367 Ga0070667_100074788 Ga0070667_1000747882 285
159 3300005367 Ga0070667_100151519 Ga0070667_1001515193 285
160 3300005455 Ga0070663_100202543 Ga0070663_1002025433 285
161 3300005456 Ga0070678_100043720 Ga0070678_1000437203 285
162 3300005456 Ga0070678_100046095 Ga0070678_1000460953 285
163 3300005457 Ga0070662_100011969 Ga0070662_1000119696 285
164 3300005457 Ga0070662_100013705 Ga0070662_1000137052 285
165 3300005466 Ga0070685_10003854 Ga0070685_100038544 285
166 3300005466 Ga0070685_10024747 Ga0070685_100247475 285
167 3300005466 Ga0070685_10304188 Ga0070685_103041881 285
168 3300005466 Ga0070685_10313348 Ga0070685_103133481 285
169 3300005471 Ga0070698_100289902 Ga0070698_1002899021 285
170 3300005535 Ga0070684_100012518 Ga0070684_1000125186 285
171 3300005535 Ga0070684_100021281 Ga0070684_1000212812 285
172 3300005535 Ga0070684_100190517 Ga0070684_1001905172 285
173 3300005535 Ga0070684_100521868 Ga0070684_1005218682 285
174 3300005539 Ga0068853_100026519 Ga0068853_1000265192 285
175 3300005539 Ga0068853_100172361 Ga0068853_1001723612 285
176 3300005544 Ga0070686_100288168 Ga0070686_1002881681 285
177 3300005563 Ga0068855_100001990 Ga0068855_10000199021 285
178 3300005563 Ga0068855_100199390 Ga0068855_1001993902 285
179 3300005564 Ga0070664_100002665 Ga0070664_10000266510 285
180 3300005564 Ga0070664_100090677 Ga0070664_1000906772 285
181 3300005577 Ga0068857_100021713 Ga0068857_1000217132 285
182 3300005578 Ga0068854_100047100 Ga0068854_1000471003 285
183 3300005614 Ga0068856_100028452 Ga0068856_1000284523 285
184 3300005616 Ga0068852_100031270 Ga0068852_1000312703 285
185 3300005616 Ga0068852_100133886 Ga0068852_1001338862 285
186 3300005616 Ga0068852_100165662 Ga0068852_1001656622 285
187 3300005617 Ga0068859_100022848 Ga0068859_1000228481 285
188 3300005617 Ga0068859_100032409 Ga0068859_1000324096 285
189 3300005617 Ga0068859_100135588 Ga0068859_1001355882 285
190 3300005617 Ga0068859_100326181 Ga0068859_1003261812 285
191 3300005617 Ga0068859_100378117 Ga0068859_1003781172 285
192 3300005617 Ga0068859_100711870 Ga0068859_1007118701 285
193 3300005618 Ga0068864_100033309 Ga0068864_1000333092 285
194 3300005618 Ga0068864_100058674 Ga0068864_1000586744 285
195 3300005718 Ga0068866_10040342 Ga0068866_100403423 285
196 3300005719 Ga0068861_100006143 Ga0068861_1000061433 285
197 3300005840 Ga0068870_10042382 Ga0068870_100423822 285
198 3300005841 Ga0068863_100078523 Ga0068863_1000785232 285
199 3300005841 Ga0068863_100129113 Ga0068863_1001291133 285
200 3300005842 Ga0068858_100114610 Ga0068858_1001146103 285
201 3300005842 Ga0068858_100156333 Ga0068858_1001563332 285
202 3300005843 Ga0068860_100020848 Ga0068860_1000208484 285
203 3300005843 Ga0068860_100068417 Ga0068860_1000684173 285
204 3300005843 Ga0068860_100350084 Ga0068860_1003500842 285
205 3300005985 Ga0081539_10047752 Ga0081539_100477522 285
206 3300006195 Ga0075366_10049791 Ga0075366_100497912 285
207 3300006358 Ga0068871_100156147 Ga0068871_1001561472 285
208 3300006358 Ga0068871_100320111 Ga0068871_1003201111 285
209 3300006844 Ga0075428_100035534 Ga0075428_1000355342 285
210 3300006846 Ga0075430_100008274 Ga0075430_10000827411 285
211 3300006847 Ga0075431_100001819 Ga0075431_1000018198 285
212 3300006847 Ga0075431_100042240 Ga0075431_1000422402 285
213 3300006847 Ga0075431_100056175 Ga0075431_1000561755 285
214 3300006880 Ga0075429_100007759 Ga0075429_1000077598 285
215 3300006880 Ga0075429_100009788 Ga0075429_1000097884 285
216 3300006880 Ga0075429_100023082 Ga0075429_1000230822 285
217 3300006931 Ga0097620_100022848 Ga0097620_1000228481 285
218 3300006931 Ga0097620_100032409 Ga0097620_1000324096 285
219 3300006931 Ga0097620_100135583 Ga0097620_1001355832 285
220 3300006931 Ga0097620_100326190 Ga0097620_1003261902 285
221 3300006931 Ga0097620_100378104 Ga0097620_1003781042 285
222 3300006931 Ga0097620_100711878 Ga0097620_1007118781 285
223 3300009093 Ga0105240_10000106 Ga0105240_1000010659 285
224 3300009093 Ga0105240_10316322 Ga0105240_103163222 285
225 3300009094 Ga0111539_10082947 Ga0111539_100829474 285
226 3300009098 Ga0105245_10046668 Ga0105245_100466681 285
227 3300009101 Ga0105247_10014858 Ga0105247_100148585 285
228 3300009147 Ga0114129_10004788 Ga0114129_1000478812 285
229 3300009174 Ga0105241_10000333 Ga0105241_100003335 285
230 3300009174 Ga0105241_10001117 Ga0105241_100011179 285
231 3300009174 Ga0105241_10042451 Ga0105241_100424512 285
232 3300009176 Ga0105242_10123866 Ga0105242_101238662 285
233 3300009176 Ga0105242_10492099 Ga0105242_104920992 285
234 3300009176 Ga0105242_10507288 Ga0105242_105072881 285
235 3300009177 Ga0105248_10432377 Ga0105248_104323772 285
236 3300009545 Ga0105237_10002380 Ga0105237_1000238010 285
237 3300009545 Ga0105237_10005940 Ga0105237_1000594014 285
238 3300009545 Ga0105237_10014958 Ga0105237_100149587 285
239 3300009545 Ga0105237_10018678 Ga0105237_100186789 285
240 3300009545 Ga0105237_10173365 Ga0105237_101733652 285
241 3300009551 Ga0105238_10103405 Ga0105238_101034052 285
242 3300009551 Ga0105238_10273999 Ga0105238_102739992 285
243 3300009553 Ga0105249_10001813 Ga0105249_1000181315 285
244 3300009553 Ga0105249_10112821 Ga0105249_101128214 285
245 3300009553 Ga0105249_10782085 Ga0105249_107820851 285
246 3300010375 Ga0105239_10007405 Ga0105239_100074052 285
247 3300010375 Ga0105239_10009676 Ga0105239_100096762 285
248 3300010375 Ga0105239_10015390 Ga0105239_100153907 285
249 3300010375 Ga0105239_10170872 Ga0105239_101708723 285
250 3300011119 Ga0105246_10079360 Ga0105246_100793603 285
251 3300011119 Ga0105246_10162624 Ga0105246_101626242 285
252 3300011119 Ga0105246_10186876 Ga0105246_101868763 285
253 3300013296 Ga0157374_10002752 Ga0157374_1000275211 285
254 3300013296 Ga0157374_10038728 Ga0157374_100387282 285
255 3300013296 Ga0157374_10073936 Ga0157374_100739363 285
256 3300013296 Ga0157374_10215386 Ga0157374_102153862 285
257 3300013297 Ga0157378_10112642 Ga0157378_101126421 285
258 3300013297 Ga0157378_10121749 Ga0157378_101217491 285
259 3300013297 Ga0157378_10183188 Ga0157378_101831882 285
260 3300013297 Ga0157378_10206522 Ga0157378_102065222 285
261 3300013306 Ga0163162_10000612 Ga0163162_100006122 285
262 3300013306 Ga0163162_10001367 Ga0163162_100013675 285
263 3300013306 Ga0163162_10001786 Ga0163162_100017869 285
264 3300013306 Ga0163162_10165389 Ga0163162_101653892 285
265 3300013306 Ga0163162_10171057 Ga0163162_101710572 285
266 3300013306 Ga0163162_10199989 Ga0163162_101999893 285
267 3300013306 Ga0163162_10599510 Ga0163162_105995102 285
268 3300013306 Ga0163162_10632511 Ga0163162_106325112 285
269 3300013307 Ga0157372_10181378 Ga0157372_101813782 285
270 3300013307 Ga0157372_10462248 Ga0157372_104622482 285
271 3300013307 Ga0157372_10554323 Ga0157372_105543231 285
272 3300013308 Ga0157375_10009867 Ga0157375_100098674 285
273 3300013308 Ga0157375_10035566 Ga0157375_100355666 285
274 3300013308 Ga0157375_10121739 Ga0157375_101217392 285
275 3300013308 Ga0157375_10161888 Ga0157375_101618882 285
276 3300013308 Ga0157375_10181663 Ga0157375_101816632 285
277 3300014325 Ga0163163_10001998 Ga0163163_100019983 285
278 3300014325 Ga0163163_10141344 Ga0163163_101413441 285
279 3300014325 Ga0163163_10339595 Ga0163163_103395952 285
280 3300014326 Ga0157380_10304165 Ga0157380_103041651 285
281 3300014745 Ga0157377_10023386 Ga0157377_100233863 285
282 3300014745 Ga0157377_10050702 Ga0157377_100507022 285
283 3300014968 Ga0157379_10037393 Ga0157379_100373935 285
284 3300014968 Ga0157379_10081389 Ga0157379_100813892 285
285 3300014968 Ga0157379_10422469 Ga0157379_104224692 285
286 3300014969 Ga0157376_10007329 Ga0157376_100073294 285
287 3300014969 Ga0157376_10026592 Ga0157376_100265925 285
288 3300014969 Ga0157376_10133097 Ga0157376_101330972 285
289 3300014969 Ga0157376_10184917 Ga0157376_101849172 285
290 3300014969 Ga0157376_10212783 Ga0157376_102127831 285
291 3300017792 Ga0163161_10024623 Ga0163161_100246232 285
292 3300017792 Ga0163161_10070335 Ga0163161_100703352 285
293 3300017792 Ga0163161_10073748 Ga0163161_100737482 285
294 3300025246 Ga0209646_1001248 Ga0209646_10012482 285
295 3300025315 Ga0207697_10042943 Ga0207697_100429432 285
296 3300025315 Ga0207697_10054196 Ga0207697_100541962 285
297 3300025321 Ga0207656_10020010 Ga0207656_100200103 285
298 3300025899 Ga0207642_10004323 Ga0207642_100043235 285
299 3300025903 Ga0207680_10079798 Ga0207680_100797984 285
300 3300025907 Ga0207645_10005892 Ga0207645_100058922 285
301 3300025908 Ga0207643_10017667 Ga0207643_100176672 285
302 3300025910 Ga0207684_10498792 Ga0207684_104987922 285
303 3300025911 Ga0207654_10000620 Ga0207654_1000062011 285
304 3300025911 Ga0207654_10024091 Ga0207654_100240912 285
305 3300025911 Ga0207654_10078538 Ga0207654_100785382 285
306 3300025913 Ga0207695_10003167 Ga0207695_1000316712 285
307 3300025913 Ga0207695_10018118 Ga0207695_100181185 285
308 3300025913 Ga0207695_10029606 Ga0207695_100296067 285
309 3300025914 Ga0207671_10002324 Ga0207671_1000232413 285
310 3300025914 Ga0207671_10002511 Ga0207671_100025116 285
311 3300025914 Ga0207671_10008910 Ga0207671_100089109 285
312 3300025918 Ga0207662_10046491 Ga0207662_100464912 285
313 3300025920 Ga0207649_10068425 Ga0207649_100684252 285
314 3300025920 Ga0207649_10284569 Ga0207649_102845691 285
315 3300025923 Ga0207681_10173295 Ga0207681_101732952 285
316 3300025923 Ga0207681_10397603 Ga0207681_103976031 285
317 3300025924 Ga0207694_10102112 Ga0207694_101021122 285
318 3300025925 Ga0207650_10022618 Ga0207650_100226183 285
319 3300025925 Ga0207650_10031707 Ga0207650_100317074 285
320 3300025925 Ga0207650_10182120 Ga0207650_101821202 285
321 3300025925 Ga0207650_10203713 Ga0207650_102037132 285
322 3300025925 Ga0207650_10374720 Ga0207650_103747202 285
323 3300025926 Ga0207659_10015767 Ga0207659_100157672 285
324 3300025926 Ga0207659_10045946 Ga0207659_100459463 285
325 3300025926 Ga0207659_10096159 Ga0207659_100961591 285
326 3300025926 Ga0207659_10108763 Ga0207659_101087632 285
327 3300025931 Ga0207644_10250003 Ga0207644_102500033 285
328 3300025933 Ga0207706_10004710 Ga0207706_1000471011 285
329 3300025933 Ga0207706_10015998 Ga0207706_100159988 285
330 3300025933 Ga0207706_10258254 Ga0207706_102582541 285
331 3300025933 Ga0207706_10347699 Ga0207706_103476992 285
332 3300025934 Ga0207686_10090156 Ga0207686_100901563 285
333 3300025934 Ga0207686_10178682 Ga0207686_101786822 285
334 3300025934 Ga0207686_10264597 Ga0207686_102645971 285
335 3300025936 Ga0207670_10016254 Ga0207670_100162542 285
336 3300025936 Ga0207670_10076046 Ga0207670_100760463 285
337 3300025936 Ga0207670_10180626 Ga0207670_101806262 285
338 3300025940 Ga0207691_10039933 Ga0207691_100399336 285
339 3300025940 Ga0207691_10042959 Ga0207691_100429593 285
340 3300025941 Ga0207711_10338106 Ga0207711_103381062 285
341 3300025942 Ga0207689_10010413 Ga0207689_100104136 285
342 3300025942 Ga0207689_10023916 Ga0207689_100239165 285
343 3300025942 Ga0207689_10037971 Ga0207689_100379713 285
344 3300025942 Ga0207689_10067436 Ga0207689_100674362 285
345 3300025942 Ga0207689_10168893 Ga0207689_101688932 285
346 3300025944 Ga0207661_10053129 Ga0207661_100531292 285
347 3300025944 Ga0207661_10072945 Ga0207661_100729452 285
348 3300025945 Ga0207679_10001622 Ga0207679_100016228 285
349 3300025945 Ga0207679_10058749 Ga0207679_100587491 285
350 3300025945 Ga0207679_10070163 Ga0207679_100701633 285
351 3300025945 Ga0207679_10239284 Ga0207679_102392841 285
352 3300025949 Ga0207667_10018750 Ga0207667_100187503 285
353 3300025949 Ga0207667_10020034 Ga0207667_100200344 285
354 3300025960 Ga0207651_10047510 Ga0207651_100475102 285
355 3300025960 Ga0207651_10344345 Ga0207651_103443452 285
356 3300025961 Ga0207712_10015278 Ga0207712_100152782 285
357 3300025981 Ga0207640_10032118 Ga0207640_100321181 285
358 3300025986 Ga0207658_10022996 Ga0207658_100229966 285
359 3300025986 Ga0207658_10209613 Ga0207658_102096132 285
360 3300025986 Ga0207658_10424517 Ga0207658_104245172 285
361 3300026023 Ga0207677_10007320 Ga0207677_100073205 285
362 3300026023 Ga0207677_10198727 Ga0207677_101987272 285
363 3300026023 Ga0207677_10252854 Ga0207677_102528542 285
364 3300026023 Ga0207677_10295960 Ga0207677_102959601 285
365 3300026041 Ga0207639_10127747 Ga0207639_101277472 285
366 3300026041 Ga0207639_10183532 Ga0207639_101835321 285
367 3300026067 Ga0207678_10119695 Ga0207678_101196953 285
368 3300026078 Ga0207702_10084238 Ga0207702_100842383 285
369 3300026088 Ga0207641_10000318 Ga0207641_1000031849 285
370 3300026088 Ga0207641_10100939 Ga0207641_101009394 285
371 3300026088 Ga0207641_10116934 Ga0207641_101169342 285
372 3300026089 Ga0207648_10006356 Ga0207648_100063566 285
373 3300026089 Ga0207648_10182328 Ga0207648_101823282 285
374 3300026095 Ga0207676_10265047 Ga0207676_102650472 285
375 3300026116 Ga0207674_10037607 Ga0207674_100376074 285
376 3300026116 Ga0207674_10296688 Ga0207674_102966882 285
377 3300026118 Ga0207675_100012049 Ga0207675_1000120497 285
378 3300026121 Ga0207683_10003845 Ga0207683_100038454 285
379 3300026121 Ga0207683_10017665 Ga0207683_100176652 285
380 3300026142 Ga0207698_10018924 Ga0207698_100189243 285
381 3300026142 Ga0207698_10022200 Ga0207698_100222002 285
382 3300026142 Ga0207698_10089065 Ga0207698_100890652 285
383 3300028379 Ga0268266_10000048 Ga0268266_10000048165 285
384 3300028379 Ga0268266_10146482 Ga0268266_101464823 285
385 3300028381 Ga0268264_10000028 Ga0268264_10000028321 285
386 3300028381 Ga0268264_10014694 Ga0268264_100146941 285
387 3300028381 Ga0268264_10014908 Ga0268264_100149084 285
388 3300028794 Ga0307515_10004954 Ga0307515_1000495414 285
389 3300031456 Ga0307513_10246855 Ga0307513_102468552 285
390 3300031507 Ga0307509_10073328 Ga0307509_100733282 285
391 3300031901 Ga0307406_10136073 Ga0307406_101360731 285
392 3300031911 Ga0307412_10140120 Ga0307412_101401202 285
393 3300032002 Ga0307416_100281525 Ga0307416_1002815251 285
394 3300032004 Ga0307414_10143496 Ga0307414_101434962 285
395 3300032126 Ga0307415_100057989 Ga0307415_1000579892 285
396 3300035695 Ga0373927_0024799 Ga0373927_0024799_2378_3280 285
397 3300035724 Ga0373933_0119857 Ga0373933_0119857_18_920 285
398 3300036401 Ga0373937_0019641 Ga0373937_0019641_877_1779 285
399 3300037068 Ga0373925_0543544 Ga0373925_0543544_40_942 285
400 3300041404 Ga0439436_0000372 Ga0439436_0000372_9126_10028 285
401 3300041505 Ga0451849_0713589 Ga0451849_0713589_435_1337 285
402 3300042001 Ga0439441_001208 Ga0439441_001208_1265_2167 285
403 3300042014 Ga0439457_000079 Ga0439457_000079_5321_6223 285
404 3300042014 Ga0439457_008871 Ga0439457_008871_308_1201 285
405 3300042125 Ga0450923_003226 Ga0450923_003226_1175_2077 285
406 3300042437 Ga0439444_0018094 Ga0439444_0018094_295_1197 285
407 3300042876 Ga0451577_0186842 Ga0451577_0186842_952_1854 285
408 3300044656 Ga0466969_0000869 Ga0466969_0000869_4288_5190 285
409 3300044658 Ga0466972_0000049 Ga0466972_0000049_116460_117359 285
410 3300044658 Ga0466972_0000640 Ga0466972_0000640_4083_5000 285
411 3300044684 Ga0466966_0000096 Ga0466966_0000096_9524_10426 285
412 3300044735 Ga0466968_0006651 Ga0466968_0006651_1563_2480 285
413 3300044842 Ga0466957_0006774 Ga0466957_0006774_2756_3658 285
414 3300044901 Ga0466960_0025224 Ga0466960_0025224_1685_2596 285
415 3300045049 Ga0466959_0000014 Ga0466959_0000014_13722_14624 285
416 3300046460 Ga0495638_0031164 Ga0495638_0031164_2132_3019 285
417 3300046460 Ga0495638_0080380 Ga0495638_0080380_279_1181 285
418 3300046463 Ga0495653_0250432 Ga0495653_0250432_234_1136 285
419 3300046499 Ga0495594_0133025 Ga0495594_0133025_222_1124 285
420 3300046514 Ga0495618_0179204 Ga0495618_0179204_224_1126 285
421 3300046516 Ga0495628_0115970 Ga0495628_0115970_372_1274 285
422 3300046524 Ga0495648_0001979 Ga0495648_0001979_3198_4085 285
423 3300046537 Ga0495598_0052181 Ga0495598_0052181_32_934 285
424 3300046539 Ga0495621_0007054 Ga0495621_0007054_936_1838 285
425 3300046616 Ga0495668_0002514 Ga0495668_0002514_11223_12125 285
426 3300046642 Ga0495634_0038674 Ga0495634_0038674_36_938 285
427 3300046648 Ga0495611_0124335 Ga0495611_0124335_212_1099 285
428 3300047319 Ga0495674_0207469 Ga0495674_0207469_418_1320 285
429 3300048907 Ga0496104_0269251 Ga0496104_0269251_285_1187 285
430 3300048913 Ga0496110_0464666 Ga0496110_0464666_181_1083 285
431 3300048914 Ga0496111_0197353 Ga0496111_0197353_575_1477 285
432 3300048914 Ga0496111_0227246 Ga0496111_0227246_237_1139 285
433 3300049513 Ga0501290_000624 Ga0501290_000624_4387_5295 285
434 3300049568 Ga0501031_0016589 Ga0501031_0016589_940_1797 285
435 3300049569 Ga0501032_0002853 Ga0501032_0002853_7597_8517 285
436 3300049571 Ga0501034_0227450 Ga0501034_0227450_49_954 285
437 3300049572 Ga0501036_0039650 Ga0501036_0039650_693_1550 285
438 3300049574 Ga0501038_0002256 Ga0501038_0002256_2015_2872 285
439 3300049579 Ga0501043_0012846 Ga0501043_0012846_1380_2237 285
440 3300049579 Ga0501043_0324773 Ga0501043_0324773_43_948 285
441 3300049581 Ga0501047_0015552 Ga0501047_0015552_381_1286 285
442 3300049582 Ga0501048_0109238 Ga0501048_0109238_747_1652 285
443 3300049588 Ga0501072_0084708 Ga0501072_0084708_746_1603 285
444 3300049651 Ga0501201_000509 Ga0501201_000509_2559_3467 285
445 3300049651 Ga0501201_003224 Ga0501201_003224_94_990 285
446 3300049652 Ga0501202_000030 Ga0501202_000030_6295_7203 285
447 3300049652 Ga0501202_007110 Ga0501202_007110_311_1258 285
448 3300049652 Ga0501202_011460 Ga0501202_011460_683_1579 285
449 3300049654 Ga0501207_000663 Ga0501207_000663_337_1227 285
450 3300049663 Ga0501223_001644 Ga0501223_001644_4103_4993 285
451 3300049663 Ga0501223_007789 Ga0501223_007789_732_1628 285
452 3300049664 Ga0501224_000870 Ga0501224_000870_462_1370 285
453 3300049668 Ga0501233_001309 Ga0501233_001309_2876_3766 285
454 3300049668 Ga0501233_027344 Ga0501233_027344_41_988 285
455 3300049669 Ga0501235_000549 Ga0501235_000549_5040_5930 285
456 3300049674 Ga0501242_005821 Ga0501242_005821_186_1094 285
457 3300049686 Ga0501257_018887 Ga0501257_018887_46_1017 285
458 3300049688 Ga0501259_000179 Ga0501259_000179_5850_6740 285
459 3300049704 Ga0501221_000643 Ga0501221_000643_4222_5112 285
460 3300049704 Ga0501221_018127 Ga0501221_018127_338_1285 285
461 3300049705 Ga0501225_0000262 Ga0501225_0000262_6208_7110 285
462 3300049705 Ga0501225_0002072 Ga0501225_0002072_462_1352 285
463 3300049707 Ga0501234_000856 Ga0501234_000856_112_1002 285
464 3300049742 Ga0501080_0488231 Ga0501080_0488231_153_1010 285
465 3300049775 Ga0501279_002155 Ga0501279_002155_23_913 285
466 3300049822 Ga0501035_0009144 Ga0501035_0009144_6756_7676 285
467 3300049822 Ga0501035_0016465 Ga0501035_0016465_150_1007 285
468 3300049823 Ga0501044_0026464 Ga0501044_0026464_1271_2128 285
469 3300050493 nmdc:mga0k408_10915_c1 nmdc:mga0k408_10915_c1_2870_3769 285
470 3300050493 nmdc:mga0k408_77710_c1 nmdc:mga0k408_77710_c1_129_1031 285
471 3300050507 nmdc:mga05p37_13282_c1 nmdc:mga05p37_13282_c1_5443_6342 285
472 3300050508 nmdc:mga09592_55522_c1 nmdc:mga09592_55522_c1_850_1827 285
473 3300050509 nmdc:mga0qj67_25048_c1 nmdc:mga0qj67_25048_c1_2087_2989 285
474 3300050510 nmdc:mga06r32_145250_c1 nmdc:mga06r32_145250_c1_436_1371 285
475 3300050510 nmdc:mga06r32_146168_c1 nmdc:mga06r32_146168_c1_901_1806 285
476 3300053085 Ga0495619_0060746 Ga0495619_0060746_879_1781 285
477 3300053086 Ga0500578_0000325 Ga0500578_0000325_56687_57586 285
478 3300053090 Ga0500646_0034595 Ga0500646_0034595_270_1169 285
479 3300053092 Ga0500583_0000001 Ga0500583_0000001_2547_3449 285
480 3300053092 Ga0500583_0000568 Ga0500583_0000568_1677_2564 285
481 3300053092 Ga0500583_0117748 Ga0500583_0117748_118_1017 285
482 3300053130 Ga0500642_0028245 Ga0500642_0028245_982_1869 285
483 3300053131 Ga0500652_047039 Ga0500652_047039_378_1280 285
484 3300053136 Ga0500559_0037090 Ga0500559_0037090_511_1419 285
485 3300053156 Ga0500622_0025163 Ga0500622_0025163_1947_2834 285
486 3300053178 Ga0500637_0156285 Ga0500637_0156285_367_1266 285
487 iso_pu_bacteria 2738541278 2738725483 285
488 3300000545 CNXas_1000706 CNXas_10007062 291
489 3300005290 Ga0065712_10001960 Ga0065712_100019607 291
490 3300005293 Ga0065715_10097208 Ga0065715_100972082 291
491 3300005295 Ga0065707_10002043 Ga0065707_100020434 291
492 3300005328 Ga0070676_10247992 Ga0070676_102479922 291
493 3300005347 Ga0070668_100027115 Ga0070668_1000271153 291
494 3300005353 Ga0070669_100006130 Ga0070669_1000061306 291
495 3300005353 Ga0070669_100511574 Ga0070669_1005115741 291
496 3300005354 Ga0070675_100055342 Ga0070675_1000553422 291
497 3300005364 Ga0070673_100004569 Ga0070673_1000045697 291
498 3300005438 Ga0070701_10214139 Ga0070701_102141391 291
499 3300005457 Ga0070662_100010103 Ga0070662_1000101033 291
500 3300005543 Ga0070672_100056859 Ga0070672_1000568593 291
501 3300005577 Ga0068857_100011198 Ga0068857_10001119812 291
502 3300005617 Ga0068859_100258939 Ga0068859_1002589392 291
503 3300005719 Ga0068861_100023330 Ga0068861_1000233304 291
504 3300005840 Ga0068870_10001114 Ga0068870_100011147 291
505 3300005844 Ga0068862_100002954 Ga0068862_10000295410 291
506 3300006931 Ga0097620_100258957 Ga0097620_1002589572 291
507 3300013104 Ga0157370_10004229 Ga0157370_100042293 291
508 3300025271 Ga0207666_1006123 Ga0207666_10061232 291
509 3300025900 Ga0207710_10001781 Ga0207710_1000178111 291
510 3300025908 Ga0207643_10069206 Ga0207643_100692063 291
511 3300025926 Ga0207659_10021826 Ga0207659_100218263 291
512 3300025933 Ga0207706_10019841 Ga0207706_100198416 291
513 3300025936 Ga0207670_10263269 Ga0207670_102632692 291
514 3300025938 Ga0207704_10165799 Ga0207704_101657992 291
515 3300025940 Ga0207691_10065407 Ga0207691_100654072 291
516 3300025942 Ga0207689_10031493 Ga0207689_100314934 291
517 3300025960 Ga0207651_10005729 Ga0207651_100057297 291
518 3300025961 Ga0207712_10133284 Ga0207712_101332843 291
519 3300026041 Ga0207639_10021393 Ga0207639_100213934 291
520 3300026116 Ga0207674_10002491 Ga0207674_1000249113 291
521 3300026118 Ga0207675_100000282 Ga0207675_10000028238 291
522 3300028380 Ga0268265_10029729 Ga0268265_100297294 291
523 3300028381 Ga0268264_10051437 Ga0268264_100514372 291
524 3300032004 Ga0307414_10363021 Ga0307414_103630211 291
525 3300042128 Ga0450897_002901 Ga0450897_002901_119_1003 291
526 3300046522 Ga0495643_0017227 Ga0495643_0017227_2596_3480 291
527 3300049571 Ga0501034_0434594 Ga0501034_0434594_261_1142 291
528 3300053096 Ga0500641_0019019 Ga0500641_0019019_571_1500 291
529 3300053727 Ga0500611_000003 Ga0500611_000003_227716_228594 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

33

288

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.8053 1 290
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7952 1 290
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7149 16 281
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7016 6 286
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.6998 6 286
ID Description Score Start End Superfamily
af_I1NJ83_69_223_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9689 11 163 1.10.357.140
af_Q12887_160_330_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9661 11 181 1.10.357.140
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9611 11 160 1.10.357.140
af_P21592_152_300_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9604 11 156 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9597 14 160 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A257WHV2-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9943 2 174 GO:0006784
GO:0008495
GO:0016020
AF-A0A537I1Q0-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9829 1 291 GO:0005886
GO:0006784
GO:0008495
GO:0048034
AF-A0A4Q5RVW0-F1-model_v4 Heme o synthase (EC 2.5.1.141) 0.9816 45 291 GO:0005886
GO:0006783
GO:0008495
AF-A0A562TD60-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9813 2 291 GO:0005886
GO:0006784
GO:0008495
GO:0048034
AF-A0A537I1Q0-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9796 1 291 GO:0005886
GO:0006784
GO:0008495
GO:0048034

Feature Viewer

pLDDT pTM Quality
92.13 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map