F459885

General Info

Members Datasets Scaffolds Average Seq Length
529 424 1058 173

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221595|2643983784
Length 196
Sequence SGNRFSEKIMVKQEDRAPSRSHRDESGSLYDFRPVTEKDLPMIAGWLAEPHVAEWWDDPETEIAGIRQHIDSISVEPLIVELDGKPIAYLQSYDPHLEDDHPYADQPFGTLGIDLSIGRPELVGLGHGSAIVRQFVEQLFEEGVPRVIIDPNPANGRAIRAYEKAGFTPIDRRQSIYGDVVLMAVDAEASDAEEGK

Samples

Sample ID Description Type Environment
1 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
78 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
87 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
136 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
141 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
142 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
145 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
146 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
147 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
148 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
149 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
150 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
151 2512875024
152 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
153 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
154 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
155 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
156 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
157 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
158 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
159 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
160 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
161 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
162 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
163 2643221599 Rhizobium sp. Root708 Isolate Unclassified
164 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
165 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
166 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
167 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
168 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
169 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
170 2738543024 Aminobacter sp. AP02 Isolate Unclassified
171 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
172 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
173 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
174 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
175 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
176 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
177 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
178 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
179 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
180 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
181 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
182 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
183 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
184 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
185 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
186 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
187 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
188 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
189 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
190 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
191 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
192 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
193 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
194 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
195 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
196 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
197 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
198 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
199 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
200 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
201 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
202 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
203 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
204 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
205 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
206 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
207 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
208 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
209 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
210 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
211 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
212 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
213 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
214 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
215 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
216 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
217 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
218 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
219 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
220 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
221 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
222 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
223 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
224 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
225 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
226 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
227 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
228 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
229 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
230 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
231 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
232 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
233 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
234 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
235 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
236 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
237 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
238 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
239 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
240 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
241 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
242 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
243 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
244 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
245 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
246 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
247 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
248 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
249 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
250 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
251 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
252 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
253 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
254 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
255 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
256 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
257 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
258 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
259 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
260 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
261 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
262 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
263 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
264 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
265 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
266 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
267 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
268 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
269 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
270 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
271 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
272 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
273 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
274 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
275 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
276 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
277 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
278 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
279 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
280 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
281 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
282 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
283 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
284 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
285 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
286 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
287 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
288 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
289 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
290 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
291 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
292 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
293 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
294 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
295 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
296 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
297 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
298 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
299 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
300 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
301 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
302 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
303 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
304 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
305 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
306 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
307 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
308 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
309 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
310 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
311 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
312 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
313 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
314 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
315 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
316 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
317 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
318 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
319 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
320 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
321 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
322 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
323 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
324 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
325 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
326 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
327 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
328 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
329 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
330 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
331 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
332 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
333 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
334 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
335 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
336 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
337 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
338 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
339 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
340 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
341 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
342 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
343 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
344 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
345 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
346 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
347 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
348 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
349 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
350 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
351 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
352 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
353 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
354 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
355 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
356 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
357 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
358 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
359 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
360 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
361 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
362 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
363 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
364 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
365 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
366 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
367 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
368 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
369 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
370 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
371 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
372 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
373 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
374 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
375 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
376 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
377 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
378 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
379 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
380 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
381 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
382 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
383 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
384 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
385 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
386 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
387 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
388 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
389 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
390 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
391 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
392 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
393 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
394 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
395 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
396 3004167301 Mesorhizobium loti 582 Isolate Unclassified
397 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
398 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
399 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
400 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
401 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
402 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
403 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
404 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
405 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
406 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
407 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
408 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
409 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
410 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
411 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
412 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
413 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
414 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
415 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
416 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
417 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
418 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
419 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
420 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
421 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
422 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
423 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
424 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.31
Metatranscriptomes 0.19
Isolates 53.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.34
Nodule 43.86
Rhizoplane 2.65
Rhizosphere 33.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1001109 3300002741 Bacteria 11987
2 JGI25406J46586_10002027 3300003203 Bacteria 9561
3 Ga0006562J51391_1012942 3300003578 Bacteria 2178
4 Ga0055542_1001659 3300003762 Bacteria 9937
5 Ga0070658_10093603 3300005327 Bacteria 2478
6 Ga0070676_10885423 3300005328 Bacteria 664
7 Ga0070682_100411754 3300005337 Bacteria 1025
8 Ga0070660_100124342 3300005339 Bacteria 2060
9 Ga0070661_100417837 3300005344 Bacteria 1063
10 Ga0068853_100009868 3300005539 Bacteria 7707
11 Ga0070665_100094201 3300005548 Bacteria 3000
12 Ga0070665_100187281 3300005548 Bacteria 2070
13 Ga0070665_100190530 3300005548 Bacteria 2052
14 Ga0070665_100331382 3300005548 Bacteria 1527
15 Ga0070665_100338344 3300005548 Bacteria 1509
16 Ga0068855_100874849 3300005563 Bacteria 951
17 Ga0068857_100345148 3300005577 Bacteria 1378
18 Ga0068854_100150791 3300005578 Bacteria 1792
19 Ga0068856_100340690 3300005614 Bacteria 1517
20 Ga0068852_100295012 3300005616 Bacteria 1567
21 Ga0068861_100778015 3300005719 Bacteria 896
22 Ga0068851_10131100 3300005834 Bacteria 1356
23 Ga0081455_10144391 3300005937 Bacteria 1843
24 Ga0081539_10000690 3300005985 Bacteria 67656
25 Ga0075365_10017204 3300006038 Bacteria 4417
26 Ga0075365_10090313 3300006038 Bacteria 2086
27 Ga0075365_10100659 3300006038 Bacteria 1978
28 Ga0075365_10112597 3300006038 Bacteria 1871
29 Ga0075365_10172656 3300006038 Bacteria 1509
30 Ga0075365_10210740 3300006038 Bacteria 1362
31 Ga0075365_10253682 3300006038 Bacteria 1236
32 Ga0075368_10020693 3300006042 Bacteria 2493
33 Ga0075368_10275272 3300006042 Bacteria 722
34 Ga0075363_100007089 3300006048 Bacteria 5127
35 Ga0075363_100036738 3300006048 Bacteria 2570
36 Ga0075363_100529089 3300006048 Bacteria 702
37 Ga0075364_10013328 3300006051 Bacteria 5049
38 Ga0075364_10098859 3300006051 Bacteria 1941
39 Ga0075364_10705174 3300006051 Bacteria 689
40 Ga0075364_10876570 3300006051 Bacteria 611
41 Ga0075362_10103374 3300006177 Bacteria 1334
42 Ga0075362_10104089 3300006177 Bacteria 1330
43 Ga0075367_10029717 3300006178 Bacteria 3129
44 Ga0075369_10028208 3300006186 Bacteria 2352
45 Ga0075369_10062112 3300006186 Bacteria 1631
46 Ga0075369_10138790 3300006186 Bacteria 1107
47 Ga0075370_10015036 3300006353 Bacteria 4136
48 Ga0075370_10139404 3300006353 Bacteria 1417
49 Ga0105240_10314108 3300009093 Bacteria 1788
50 Ga0105240_10998556 3300009093 Bacteria 895
51 Ga0105245_10964555 3300009098 Bacteria 896
52 Ga0105247_10122008 3300009101 Bacteria 1690
53 Ga0105243_10449022 3300009148 Bacteria 1209
54 Ga0105241_10710961 3300009174 Bacteria 918
55 Ga0105237_10283361 3300009545 Bacteria 1660
56 Ga0105237_10490314 3300009545 Bacteria 1235
57 Ga0105237_10594557 3300009545 Bacteria 1113
58 Ga0105238_10013898 3300009551 Bacteria 8141
59 Ga0105239_10026792 3300010375 Bacteria 6344
60 Ga0105239_10598166 3300010375 Bacteria 1258
61 Ga0105239_10669748 3300010375 Bacteria 1186
62 Ga0105239_11820813 3300010375 Bacteria 705
63 Ga0105239_12203551 3300010375 Bacteria 641
64 Ga0105239_12402824 3300010375 Bacteria 614
65 Ga0105246_10999243 3300011119 Bacteria 757
66 Ga0157370_10512740 3300013104 Bacteria 1101
67 Ga0157370_11103334 3300013104 Bacteria 717
68 Ga0157369_10252244 3300013105 Bacteria 1841
69 Ga0157369_10264617 3300013105 Bacteria 1793
70 Ga0157374_10351557 3300013296 Bacteria 1464
71 Ga0157372_10363803 3300013307 Bacteria 1686
72 Ga0157380_12385840 3300014326 Bacteria 594
73 Ga0182006_1088136 3300015261 Bacteria 1120
74 Ga0182007_10112169 3300015262 Bacteria 908
75 Ga0209026_1000151 3300025250 Bacteria 110338
76 Ga0209148_1000032 3300025254 Bacteria 557660
77 Ga0209148_1011875 3300025254 Bacteria 1607
78 Ga0209759_1000076 3300025256 Bacteria 175911
79 Ga0209233_1000150 3300025261 Bacteria 179401
80 Ga0209455_1000085 3300025272 Bacteria 247601
81 Ga0207647_10083167 3300025904 Bacteria 1917
82 Ga0207647_10142751 3300025904 Bacteria 1403
83 Ga0207645_10105341 3300025907 Bacteria 1822
84 Ga0207695_10392888 3300025913 Bacteria 1272
85 Ga0207671_10153385 3300025914 Bacteria 1781
86 Ga0207671_10262765 3300025914 Bacteria 1359
87 Ga0207657_10035564 3300025919 Bacteria 4465
88 Ga0207694_10019222 3300025924 Bacteria 5164
89 Ga0207687_10930804 3300025927 Bacteria 744
90 Ga0207706_10778354 3300025933 Bacteria 814
91 Ga0207667_10495383 3300025949 Bacteria 1240
92 Ga0207667_11500964 3300025949 Bacteria 645
93 Ga0207712_10340704 3300025961 Bacteria 1243
94 Ga0207640_10288267 3300025981 Bacteria 1293
95 Ga0207639_10562161 3300026041 Bacteria 1048
96 Ga0207678_10071129 3300026067 Bacteria 2983
97 Ga0207678_10197273 3300026067 Bacteria 1720
98 Ga0207678_10768959 3300026067 Bacteria 850
99 Ga0207702_10320352 3300026078 Bacteria 1476
100 Ga0207702_11098068 3300026078 Bacteria 789
101 Ga0207648_10107493 3300026089 Bacteria 2449
102 Ga0207674_10092667 3300026116 Bacteria 3011
103 Ga0207683_10361548 3300026121 Bacteria 1333
104 Ga0207698_10239267 3300026142 Bacteria 1653
105 Ga0209813_10024583 3300027866 Bacteria 1724
106 Ga0209813_10064390 3300027866 Bacteria 1178
107 Ga0268266_10073701 3300028379 Bacteria 2963
108 Ga0268266_10107790 3300028379 Bacteria 2464
109 Ga0268266_10108353 3300028379 Bacteria 2458
110 Ga0268266_10437373 3300028379 Bacteria 1242
111 Ga0268266_10840350 3300028379 Bacteria 887
112 Ga0268266_11081872 3300028379 Bacteria 776
113 Ga0307412_10026474 3300031911 Bacteria 3605
114 Ga0307409_100287095 3300031995 Bacteria 1524
115 Ga0373941_0383281 3300035115 Bacteria 578
116 Ga0395900_0382482 3300037418 Bacteria 1375
117 Ga0395900_0541015 3300037418 Bacteria 1110
118 Ga0395905_0117406 3300037471 Bacteria 2500
119 Ga0395905_0700286 3300037471 Bacteria 915
120 Ga0395901_0173316 3300038443 Bacteria 2263
121 Ga0395901_1185154 3300038443 Bacteria 730
122 Ga0439465_0051483 3300041413 Bacteria 1349
123 Ga0451807_1719084 3300041486 Bacteria 674
124 Ga0439458_0004421 3300042157 Bacteria 3228
125 Ga0466972_0082228 3300044658 Bacteria 1532
126 Ga0466972_0115632 3300044658 Bacteria 1266
127 Ga0466960_0026231 3300044901 Bacteria 2645
128 Ga0495638_0011346 3300046460 Bacteria 6139
129 Ga0495597_0016024 3300046542 Bacteria 3544
130 Ga0495668_0243787 3300046616 Bacteria 984
131 Ga0495625_0014886 3300046660 Bacteria 6186
132 Ga0495671_0514327 3300046692 Bacteria 571
133 Ga0495660_0205360 3300046810 Bacteria 938
134 Ga0495687_067458 3300047443 Bacteria 1448
135 Ga0495686_0190214 3300047472 Bacteria 1184
136 Ga0495626_0268653 3300048091 Bacteria 680
137 Ga0496102_0305947 3300048905 Bacteria 1498
138 Ga0496103_0199126 3300048906 Bacteria 1288
139 Ga0496108_0990898 3300048911 Bacteria 718
140 Ga0496109_1472442 3300048912 Bacteria 616
141 Ga0496110_0579347 3300048913 Bacteria 1019
142 Ga0496112_0057684 3300048915 Bacteria 3823
143 Ga0496113_0149011 3300048916 Bacteria 1845
144 Ga0496114_0238145 3300048917 Bacteria 1600
145 Ga0496114_0650722 3300048917 Bacteria 927
146 Ga0496115_0534211 3300048918 Bacteria 939
147 Ga0496117_0126364 3300048920 Bacteria 1560
148 Ga0496118_0095186 3300048921 Bacteria 2034
149 Ga0496120_0035525 3300048923 Bacteria 2976
150 Ga0496122_0195034 3300048925 Bacteria 1191
151 Ga0501031_0000002 3300049568 Bacteria 217588
152 Ga0501031_0109393 3300049568 Bacteria 1804
153 Ga0501031_0308822 3300049568 Bacteria 1025
154 Ga0501032_0000004 3300049569 Bacteria 310855
155 Ga0501032_0219093 3300049569 Bacteria 1239
156 Ga0501032_0251736 3300049569 Bacteria 1146
157 Ga0501032_0418211 3300049569 Bacteria 860
158 Ga0501033_0000016 3300049570 Bacteria 217458
159 Ga0501033_0007579 3300049570 Bacteria 8444
160 Ga0501033_0040622 3300049570 Bacteria 3472
161 Ga0501033_0042912 3300049570 Bacteria 3370
162 Ga0501033_0103810 3300049570 Bacteria 2072
163 Ga0501033_0276456 3300049570 Bacteria 1186
164 Ga0501034_0000011 3300049571 Bacteria 310855
165 Ga0501034_0039528 3300049571 Bacteria 4778
166 Ga0501034_0061156 3300049571 Bacteria 3783
167 Ga0501034_0065628 3300049571 Bacteria 3642
168 Ga0501034_0082903 3300049571 Bacteria 3208
169 Ga0501034_0237155 3300049571 Bacteria 1771
170 Ga0501034_1062074 3300049571 Bacteria 692
171 Ga0501036_0000001 3300049572 Bacteria 310855
172 Ga0501036_0054499 3300049572 Bacteria 3387
173 Ga0501037_0000006 3300049573 Bacteria 217461
174 Ga0501037_0035122 3300049573 Bacteria 3697
175 Ga0501037_0105654 3300049573 Bacteria 2029
176 Ga0501037_0451541 3300049573 Bacteria 877
177 Ga0501038_0000003 3300049574 Bacteria 310855
178 Ga0501038_0035117 3300049574 Bacteria 4403
179 Ga0501038_0843295 3300049574 Bacteria 679
180 Ga0501039_0000004 3300049575 Bacteria 310855
181 Ga0501040_0010669 3300049576 Bacteria 6009
182 Ga0501042_0304455 3300049578 Bacteria 1151
183 Ga0501043_0000765 3300049579 Bacteria 28587
184 Ga0501043_0047718 3300049579 Bacteria 3366
185 Ga0501043_0112610 3300049579 Bacteria 2136
186 Ga0501043_0165634 3300049579 Bacteria 1726
187 Ga0501043_0599112 3300049579 Bacteria 814
188 Ga0501046_0044329 3300049580 Bacteria 3537
189 Ga0501046_0081983 3300049580 Bacteria 2491
190 Ga0501046_0175888 3300049580 Bacteria 1603
191 Ga0501047_0008050 3300049581 Bacteria 9947
192 Ga0501047_0020546 3300049581 Bacteria 6339
193 Ga0501047_0024548 3300049581 Bacteria 5785
194 Ga0501047_0410051 3300049581 Bacteria 1187
195 Ga0501048_0090726 3300049582 Bacteria 2155
196 Ga0501068_0290324 3300049584 Bacteria 1046
197 Ga0501070_0060827 3300049586 Bacteria 3130
198 Ga0501070_0191203 3300049586 Bacteria 1682
199 Ga0501071_0331715 3300049587 Bacteria 1156
200 Ga0501073_0185571 3300049589 Bacteria 1439
201 Ga0501074_0016429 3300049590 Bacteria 5375
202 Ga0501080_0041938 3300049742 Bacteria 4263
203 Ga0501083_0047172 3300049744 Bacteria 2912
204 Ga0501035_0000009 3300049822 Bacteria 310827
205 Ga0501035_0066313 3300049822 Bacteria 3203
206 Ga0501035_0104592 3300049822 Bacteria 2482
207 Ga0501035_0204768 3300049822 Bacteria 1690
208 Ga0501035_0259795 3300049822 Bacteria 1472
209 Ga0501044_0000005 3300049823 Bacteria 310855
210 Ga0501044_0040258 3300049823 Bacteria 4870
211 Ga0501044_0115070 3300049823 Bacteria 2694
212 Ga0501044_0290819 3300049823 Bacteria 1565
213 Ga0501044_0465227 3300049823 Bacteria 1169
214 Ga0501044_1106310 3300049823 Bacteria 661
215 Ga0501045_0071045 3300049824 Bacteria 2562
216 Ga0501045_0117771 3300049824 Bacteria 1971
217 nmdc:mga03683_84800_c1 3300050489 Bacteria 1373
218 nmdc:mga03n38_74296_c1 3300050490 Bacteria 1581
219 nmdc:mga03n38_82695_c1 3300050490 Bacteria 1512
220 nmdc:mga00v17_28808_c1 3300050491 Bacteria 3255
221 nmdc:mga00v17_605210_c1 3300050491 Bacteria 706
222 nmdc:mga00v17_62750_c1 3300050491 Bacteria 2287
223 nmdc:mga0yw44_123640_c1 3300050492 Bacteria 1669
224 nmdc:mga0yw44_194869_c1 3300050492 Bacteria 1337
225 nmdc:mga0yw44_210965_c1 3300050492 Bacteria 1285
226 nmdc:mga0yw44_733378_c1 3300050492 Bacteria 671
227 nmdc:mga06z11_291967_c1 3300050494 Bacteria 968
228 nmdc:mga04h51_76201_c1 3300050495 Bacteria 1182
229 nmdc:mga04h51_80110_c1 3300050495 Bacteria 1157
230 nmdc:mga07m45_23216_c1 3300050496 Bacteria 2785
231 nmdc:mga07m45_456287_c1 3300050496 Bacteria 741
232 nmdc:mga0sz30_123846_c1 3300050516 Bacteria 1137
233 Ga0500592_010556 3300053116 Bacteria 1473
234 Ga0500658_0089828 3300053134 Bacteria 1327
235 Ga0500568_0000010 3300053139 Bacteria 249043
236 Ga0500568_0063417 3300053139 Bacteria 1426
237 Ga0500604_0207580 3300053151 Bacteria 674
238 Ga0500616_0047136 3300053153 Bacteria 2289
239 Ga0500616_0200876 3300053153 Bacteria 883
240 Ga0500620_078522 3300053155 Bacteria 1141
241 Ga0500627_0051905 3300053158 Bacteria 1789
242 Ga0500627_0070368 3300053158 Bacteria 1549
243 Ga0500627_0090312 3300053158 Bacteria 1371
244 Ga0500627_0278014 3300053158 Bacteria 735
245 Ga0500611_032507 3300053727 Bacteria 1092
246 Ga0501082_1123892 3300060353 Bacteria 687
247 2643983784 2643221595 Bacteria 6565519
248 2503198468 2503198000 Bacteria 6884444
249 2509114041 2508501123 Bacteria 6283661
250 2509393545 2509276022 Bacteria 6200534
251 2510314816 2510065059 Bacteria 6847884
252 2511391896 2511231027 Bacteria 5013807
253 2512934066 2512875016 Bacteria 6529530
254 2512962355 2512875024 Bacteria 7195110
255 2513610651 2513237090 Bacteria 7096802
256 2514038684 2513237164 Bacteria 7563725
257 2514418229 2513237305 Bacteria 7293571
258 2514586540 2513237351 Bacteria 6968952
259 2588520206 2588253730 Bacteria 6881675
260 2597810404 2597489875 Bacteria 7010078
261 2599935250 2599185301 Bacteria 6161860
262 2643773377 2643221550 Bacteria 4619371
263 2643777577 2643221551 Bacteria 3750538
264 2643796025 2643221555 Bacteria 3749717
265 2643839491 2643221564 Bacteria 4193379
266 2644002698 2643221599 Bacteria 6292121
267 2644133966 2643221623 Bacteria 5239945
268 2644155917 2643221627 Bacteria 6761570
269 2688595790 2687453392 Bacteria 6880454
270 2694627966 2693429783 Bacteria 7019804
271 2694636216 2693429784 Bacteria 7241525
272 2723573062 2721755686 Bacteria 7343952
273 2739310288 2738543024 Bacteria 5603683
274 2756674861 2756170246 Bacteria 7451806
275 2765465784 2765235802 Bacteria 5618596
276 2770199100 2767802442 Bacteria 5747986
277 2776269504 2775506902 Bacteria 6208009
278 2776282434 2775506904 Bacteria 5954060
279 2792746978 2791355123 Bacteria 8049106
280 2839993426 2839993093 Bacteria 5512535
281 2840766436 2840764183 Bacteria 6358399
282 2841736211 2841734538 Bacteria 6784580
283 2842874048 2842871566 Bacteria 4827117
284 2844003662 2844002411 Bacteria 7168230
285 2844010595 2844009547 Bacteria 6728125
286 2847673371 2847670302 Bacteria 6165597
287 2847689881 2847686936 Bacteria 6278406
288 2856319160 2856314179 Bacteria 6477897
289 2856322217 2856320880 Bacteria 7263508
290 2856332724 2856328259 Bacteria 6528202
291 2856340711 2856334872 Bacteria 7037011
292 2856342831 2856342000 Bacteria 7176905
293 2856353154 2856349417 Bacteria 6230045
294 2856357030 2856356410 Bacteria 6297484
295 2856369962 2856364286 Bacteria 6939991
296 2857352840 2857349434 Bacteria 7926032
297 2857369268 2857367948 Bacteria 6965560
298 2869165330 2869162929 Bacteria 6399702
299 2869235296 2869234852 Bacteria 6654993
300 2869251662 2869249662 Bacteria 6868783
301 2869257085 2869256925 Bacteria 6981691
302 2869269878 2869264136 Bacteria 6880765
303 2869277342 2869271264 Bacteria 6908218
304 2869284688 2869278585 Bacteria 7077053
305 2869290769 2869285874 Bacteria 6901219
306 2871433051 2871429161 Bacteria 6547891
307 2871440692 2871435913 Bacteria 6880295
308 2871447989 2871444079 Bacteria 6423508
309 2871452944 2871451962 Bacteria 7336357
310 2871465932 2871459585 Bacteria 6866887
311 2871472951 2871466892 Bacteria 6923287
312 2871489663 2871488783 Bacteria 6929816
313 2871502308 2871495908 Bacteria 6935695
314 2874104845 2874102143 Bacteria 6342645
315 2874116478 2874109183 Bacteria 6517025
316 2874122040 2874116593 Bacteria 6674494
317 2874138700 2874131515 Bacteria 6820270
318 2874142992 2874139085 Bacteria 7021506
319 2874153788 2874146452 Bacteria 7533118
320 2874161053 2874155637 Bacteria 6724144
321 2874168346 2874162495 Bacteria 6174670
322 2874172202 2874168670 Bacteria 8062617
323 2876363676 2876363079 Bacteria 6544991
324 2876374752 2876369609 Bacteria 6807521
325 2876381371 2876377896 Bacteria 6565995
326 2876386527 2876386047 Bacteria 6698674
327 2876397127 2876392853 Bacteria 6660880
328 2876406078 2876399893 Bacteria 6927900
329 2876408530 2876406927 Bacteria 6191900
330 2876419093 2876413966 Bacteria 6831344
331 2876424504 2876420981 Bacteria 6687741
332 2878039549 2878035449 Bacteria 6555736
333 2878731349 2878730984 Bacteria 6380721
334 2878740939 2878738818 Bacteria 7136951
335 2878750664 2878745973 Bacteria 6867388
336 2878754301 2878753008 Bacteria 6922523
337 2878766199 2878760144 Bacteria 6823465
338 2878773400 2878767105 Bacteria 6898628
339 2878775266 2878774303 Bacteria 6108671
340 2878791359 2878788777 Bacteria 6567085
341 2881148218 2881147464 Bacteria 7779814
342 2881159199 2881155292 Bacteria 6461656
343 2881164895 2881161766 Bacteria 7127907
344 2881847072 2881845957 Bacteria 6611900
345 2881858407 2881853255 Bacteria 6698367
346 2881865994 2881861095 Bacteria 7128710
347 2882634572 2882632389 Bacteria 8154593
348 2882913273 2882912400 Bacteria 6801539
349 2885314334 2885312484 Bacteria 6415165
350 2885323602 2885318864 Bacteria 6729568
351 2885327927 2885326080 Bacteria 7134805
352 2885344614 2885342637 Bacteria 7011821
353 2885353825 2885350715 Bacteria 6787678
354 2888344168 2888343758 Bacteria 6611049
355 2888353070 2888350351 Bacteria 7372807
356 2889014816 2889010040 Bacteria 6749192
357 2889020101 2889016732 Bacteria 6700763
358 2894653701 2894652903 Bacteria 4587256
359 2903454239 2903448605 Bacteria 7357801
360 2903496271 2903492973 Bacteria 13473544
361 2903497384 2903492973 Bacteria 13473544
362 2903523263 2903521522 Bacteria 6525694
363 2903529302 2903528002 Bacteria 6586099
364 2903547245 2903540706 Bacteria 7062119
365 2904579923 2904578770 Bacteria 5302906
366 2904663881 2904659560 Bacteria 6685615
367 2906313589 2906308376 Bacteria 6841989
368 2906326298 2906321335 Bacteria 6579571
369 2906334257 2906328253 Bacteria 6585166
370 2906357635 2906354277 Bacteria 6991324
371 2906367230 2906363423 Bacteria 6856682
372 2906372825 2906370794 Bacteria 6881062
373 2906385871 2906378014 Bacteria 6911440
374 2906391477 2906386501 Bacteria 5977019
375 2906395040 2906393657 Bacteria 6790866
376 2906407335 2906401398 Bacteria 6693206
377 2906409449 2906408224 Bacteria 6162342
378 2906419232 2906414383 Bacteria 6580790
379 2906434438 2906427513 Bacteria 6375796
380 2919120405 2919119836 Bacteria 5208557
381 2922135570 2922130491 Bacteria 7173936
382 2922151880 2922151315 Bacteria 6902399
383 2922160890 2922158528 Bacteria 6573167
384 2922174398 2922172374 Bacteria 6167644
385 2922181044 2922178524 Bacteria 6025201
386 2922189897 2922185730 Bacteria 7113964
387 2924716938 2924710171 Bacteria 6752351
388 2924722712 2924718760 Bacteria 6331356
389 2924728938 2924726620 Bacteria 6271473
390 2924736521 2924733363 Bacteria 7574837
391 2924741092 2924741084 Bacteria 6661321
392 2924748642 2924748358 Bacteria 6154725
393 2924757942 2924754689 Bacteria 6774424
394 2924765590 2924762789 Bacteria 6561353
395 2924778540 2924776078 Bacteria 7492003
396 2924784989 2924784321 Bacteria 7416538
397 2928522690 2928521798 Bacteria 4960112
398 2937820106 2937813078 Bacteria 7783518
399 2937826510 2937822353 Bacteria 7290551
400 2937840582 2937836603 Bacteria 6811263
401 2937849582 2937848649 Bacteria 6983481
402 2937866120 2937861824 Bacteria 6660327
403 2937876094 2937868953 Bacteria 6639878
404 2937878826 2937877337 Bacteria 7246526
405 2937897234 2937891427 Bacteria 6357007
406 2937974393 2937972304 Bacteria 7532020
407 2937982382 2937980651 Bacteria 6517427
408 2938001108 2937994558 Bacteria 7036190
409 2938017687 2938014810 Bacteria 6700592
410 2954013929 2954011201 Bacteria 4762601
411 2958041457 2958034702 Bacteria 6989922
412 2958042431 2958041894 Bacteria 13082850
413 2958052074 2958041894 Bacteria 13082850
414 2958065283 2958064165 Bacteria 7158582
415 2958077173 2958071322 Bacteria 6815895
416 2958085977 2958084443 Bacteria 7312792
417 2958097654 2958092219 Bacteria 6861151
418 2958101952 2958100919 Bacteria 6800575
419 2958109036 2958108152 Bacteria 6681128
420 2958119238 2958115193 Bacteria 6923548
421 2958123262 2958122699 Bacteria 7280457
422 2958135169 2958130278 Bacteria 6897202
423 2958140364 2958137437 Bacteria 6050276
424 2958148063 2958144490 Bacteria 6677056
425 2958160363 2958158011 Bacteria 6058449
426 2958171374 2958165035 Bacteria 6906348
427 2958173400 2958172287 Bacteria 6716688
428 2958184198 2958179912 Bacteria 6874908
429 2961082253 2961077736 Bacteria 7079850
430 2961118979 2961114664 Bacteria 6680456
431 2961135594 2961127735 Bacteria 7196641
432 2961140520 2961136820 Bacteria 6775228
433 2961169815 2961163497 Bacteria 6901077
434 2961176358 2961170736 Bacteria 7072258
435 2961184400 2961183825 Bacteria 6688536
436 2963645136 2963644680 Bacteria 6530403
437 2965024575 2965018300 Bacteria 6883036
438 2965030173 2965025482 Bacteria 6532201
439 2965036932 2965032056 Bacteria 6887443
440 2965040887 2965040258 Bacteria 6855979
441 2965049013 2965047637 Bacteria 6623551
442 2965062346 2965062239 Bacteria 7412989
443 2965096613 2965089291 Bacteria 6866420
444 2965114551 2965110997 Bacteria 6693150
445 2965120673 2965119406 Bacteria 6956431
446 2967996727 2967996073 Bacteria 6787468
447 2968004789 2968003550 Bacteria 6929263
448 2968022977 2968016561 Bacteria 7022047
449 2968089965 2968083720 Bacteria 7351627
450 2968093669 2968091066 Bacteria 6052692
451 2968098499 2968097103 Bacteria 6107094
452 2968115020 2968110612 Bacteria 6814636
453 2968122755 2968117919 Bacteria 6536078
454 2968133898 2968128360 Bacteria 6270294
455 2968144380 2968138860 Bacteria 6605449
456 2968178207 2968171901 Bacteria 6894245
457 2970475562 2970469710 Bacteria 6969209
458 2970490026 2970489779 Bacteria 6517260
459 2970509029 2970503327 Bacteria 7099517
460 2970517560 2970510686 Bacteria 7006402
461 2970525880 2970524798 Bacteria 6840927
462 2970535524 2970532167 Bacteria 6553173
463 2970544460 2970540015 Bacteria 6977556
464 2970554370 2970547951 Bacteria 6931819
465 2970561053 2970554993 Bacteria 6814252
466 2970599299 2970593180 Bacteria 7073582
467 2970619872 2970619444 Bacteria 6986144
468 2970630203 2970627176 Bacteria 6680862
469 2977823515 2977821940 Bacteria 6906439
470 2977830937 2977828996 Bacteria 7007971
471 2977850350 2977843712 Bacteria 6753583
472 2977855253 2977851361 Bacteria 6694324
473 2977859830 2977858184 Bacteria 6215359
474 2977879652 2977872689 Bacteria 7270173
475 2977909177 2977907340 Bacteria 6577984
476 2977921269 2977915119 Bacteria 6829656
477 2977925736 2977922695 Bacteria 6956781
478 2977940940 2977935797 Bacteria 6252826
479 2977943439 2977942078 Bacteria 7570577
480 2977950902 2977950692 Bacteria 6893264
481 2977988140 2977986579 Bacteria 6581278
482 2979714295 2979710463 Bacteria 6785254
483 2979747362 2979742915 Bacteria 7301278
484 2979768474 2979764755 Bacteria 6610066
485 2979772717 2979772303 Bacteria 6618277
486 2979781809 2979779861 Bacteria 6219781
487 2979798075 2979793036 Bacteria 6808957
488 2979813708 2979808191 Bacteria 7179355
489 2987641432 2987636660 Bacteria 8088555
490 2987651449 2987645492 Bacteria 6117018
491 2987656421 2987652177 Bacteria 6969023
492 2987666039 2987659509 Bacteria 6966464
493 2987669335 2987666974 Bacteria 6509233
494 2987675273 2987673487 Bacteria 6884027
495 2996311608 2996310559 Bacteria 6357320
496 2996342420 2996341866 Bacteria 6643098
497 2996355828 2996348954 Bacteria 7239054
498 2996387523 2996386984 Bacteria 6978667
499 3000137159 3000135777 Bacteria 6891109
500 3002141768 3002141150 Bacteria 5254435
501 3004173021 3004167301 Bacteria 8330599
502 3004195062 3004188549 Bacteria 6952365
503 3004199902 3004195979 Bacteria 6776956
504 3004210241 3004203850 Bacteria 7307914
505 3004217274 3004211236 Bacteria 7417683
506 3004220460 3004218560 Bacteria 7421728
507 3004233581 3004232784 Bacteria 6662140
508 3004245650 3004239961 Bacteria 6892290
509 3004252870 3004248173 Bacteria 6563236
510 3004282254 3004275668 Bacteria 7114440
511 3004294630 3004289098 Bacteria 6135450
512 3004337600 3004334049 Bacteria 8449246
513 637077216 637000159 Bacteria 7596297
514 649870357 649633066 Bacteria 6690028
515 8002286368 8002285264 Bacteria 6717907
516 8004304438 8004300914 Bacteria 6132239
517 8004316563 8004312739 Bacteria 7444653
518 8004366243 8004361976 Bacteria 6858373
519 8004375877 8004374579 Bacteria 6898112
520 8004393058 8004387939 Bacteria 7049250
521 8004400653 8004395343 Bacteria 6620908
522 8004450325 8004445564 Bacteria 6322258
523 8004639999 8004633249 Bacteria 6723080
524 8004641546 8004640170 Bacteria 6723001
525 8004703445 8004695233 Bacteria 6731676
526 8004706822 8004703790 Bacteria 8006957
527 8004719845 8004714634 Bacteria 6776161
528 8004729848 8004727605 Bacteria 6643904
529 8055617696 8055617313 Bacteria 7548464
530 JGI25157J39369_1001109
531 JGI25406J46586_10002027
532 Ga0006562J51391_1012942
533 Ga0055542_1001659
534 Ga0070658_10093603
535 Ga0070676_10885423
536 Ga0070682_100411754
537 Ga0070660_100124342
538 Ga0070661_100417837
539 Ga0068853_100009868
540 Ga0070665_100094201
541 Ga0070665_100187281
542 Ga0070665_100190530
543 Ga0070665_100331382
544 Ga0070665_100338344
545 Ga0068855_100874849
546 Ga0068857_100345148
547 Ga0068854_100150791
548 Ga0068856_100340690
549 Ga0068852_100295012
550 Ga0068861_100778015
551 Ga0068851_10131100
552 Ga0081455_10144391
553 Ga0081539_10000690
554 Ga0075365_10017204
555 Ga0075365_10090313
556 Ga0075365_10100659
557 Ga0075365_10112597
558 Ga0075365_10172656
559 Ga0075365_10210740
560 Ga0075365_10253682
561 Ga0075368_10020693
562 Ga0075368_10275272
563 Ga0075363_100007089
564 Ga0075363_100036738
565 Ga0075363_100529089
566 Ga0075364_10013328
567 Ga0075364_10098859
568 Ga0075364_10705174
569 Ga0075364_10876570
570 Ga0075362_10103374
571 Ga0075362_10104089
572 Ga0075367_10029717
573 Ga0075369_10028208
574 Ga0075369_10062112
575 Ga0075369_10138790
576 Ga0075370_10015036
577 Ga0075370_10139404
578 Ga0105240_10314108
579 Ga0105240_10998556
580 Ga0105245_10964555
581 Ga0105247_10122008
582 Ga0105243_10449022
583 Ga0105241_10710961
584 Ga0105237_10283361
585 Ga0105237_10490314
586 Ga0105237_10594557
587 Ga0105238_10013898
588 Ga0105239_10026792
589 Ga0105239_10598166
590 Ga0105239_10669748
591 Ga0105239_11820813
592 Ga0105239_12203551
593 Ga0105239_12402824
594 Ga0105246_10999243
595 Ga0157370_10512740
596 Ga0157370_11103334
597 Ga0157369_10252244
598 Ga0157369_10264617
599 Ga0157374_10351557
600 Ga0157372_10363803
601 Ga0157380_12385840
602 Ga0182006_1088136
603 Ga0182007_10112169
604 Ga0209026_1000151
605 Ga0209148_1000032
606 Ga0209148_1011875
607 Ga0209759_1000076
608 Ga0209233_1000150
609 Ga0209455_1000085
610 Ga0207647_10083167
611 Ga0207647_10142751
612 Ga0207645_10105341
613 Ga0207695_10392888
614 Ga0207671_10153385
615 Ga0207671_10262765
616 Ga0207657_10035564
617 Ga0207694_10019222
618 Ga0207687_10930804
619 Ga0207706_10778354
620 Ga0207667_10495383
621 Ga0207667_11500964
622 Ga0207712_10340704
623 Ga0207640_10288267
624 Ga0207639_10562161
625 Ga0207678_10071129
626 Ga0207678_10197273
627 Ga0207678_10768959
628 Ga0207702_10320352
629 Ga0207702_11098068
630 Ga0207648_10107493
631 Ga0207674_10092667
632 Ga0207683_10361548
633 Ga0207698_10239267
634 Ga0209813_10024583
635 Ga0209813_10064390
636 Ga0268266_10073701
637 Ga0268266_10107790
638 Ga0268266_10108353
639 Ga0268266_10437373
640 Ga0268266_10840350
641 Ga0268266_11081872
642 Ga0307412_10026474
643 Ga0307409_100287095
644 Ga0373941_0383281
645 Ga0395900_0382482
646 Ga0395900_0541015
647 Ga0395905_0117406
648 Ga0395905_0700286
649 Ga0395901_0173316
650 Ga0395901_1185154
651 Ga0439465_0051483
652 Ga0451807_1719084
653 Ga0439458_0004421
654 Ga0466972_0082228
655 Ga0466972_0115632
656 Ga0466960_0026231
657 Ga0495638_0011346
658 Ga0495597_0016024
659 Ga0495668_0243787
660 Ga0495625_0014886
661 Ga0495671_0514327
662 Ga0495660_0205360
663 Ga0495687_067458
664 Ga0495686_0190214
665 Ga0495626_0268653
666 Ga0496102_0305947
667 Ga0496103_0199126
668 Ga0496108_0990898
669 Ga0496109_1472442
670 Ga0496110_0579347
671 Ga0496112_0057684
672 Ga0496113_0149011
673 Ga0496114_0238145
674 Ga0496114_0650722
675 Ga0496115_0534211
676 Ga0496117_0126364
677 Ga0496118_0095186
678 Ga0496120_0035525
679 Ga0496122_0195034
680 Ga0501031_0000002
681 Ga0501031_0109393
682 Ga0501031_0308822
683 Ga0501032_0000004
684 Ga0501032_0219093
685 Ga0501032_0251736
686 Ga0501032_0418211
687 Ga0501033_0000016
688 Ga0501033_0007579
689 Ga0501033_0040622
690 Ga0501033_0042912
691 Ga0501033_0103810
692 Ga0501033_0276456
693 Ga0501034_0000011
694 Ga0501034_0039528
695 Ga0501034_0061156
696 Ga0501034_0065628
697 Ga0501034_0082903
698 Ga0501034_0237155
699 Ga0501034_1062074
700 Ga0501036_0000001
701 Ga0501036_0054499
702 Ga0501037_0000006
703 Ga0501037_0035122
704 Ga0501037_0105654
705 Ga0501037_0451541
706 Ga0501038_0000003
707 Ga0501038_0035117
708 Ga0501038_0843295
709 Ga0501039_0000004
710 Ga0501040_0010669
711 Ga0501042_0304455
712 Ga0501043_0000765
713 Ga0501043_0047718
714 Ga0501043_0112610
715 Ga0501043_0165634
716 Ga0501043_0599112
717 Ga0501046_0044329
718 Ga0501046_0081983
719 Ga0501046_0175888
720 Ga0501047_0008050
721 Ga0501047_0020546
722 Ga0501047_0024548
723 Ga0501047_0410051
724 Ga0501048_0090726
725 Ga0501068_0290324
726 Ga0501070_0060827
727 Ga0501070_0191203
728 Ga0501071_0331715
729 Ga0501073_0185571
730 Ga0501074_0016429
731 Ga0501080_0041938
732 Ga0501083_0047172
733 Ga0501035_0000009
734 Ga0501035_0066313
735 Ga0501035_0104592
736 Ga0501035_0204768
737 Ga0501035_0259795
738 Ga0501044_0000005
739 Ga0501044_0040258
740 Ga0501044_0115070
741 Ga0501044_0290819
742 Ga0501044_0465227
743 Ga0501044_1106310
744 Ga0501045_0071045
745 Ga0501045_0117771
746 nmdc:mga03683_84800_c1
747 nmdc:mga03n38_74296_c1
748 nmdc:mga03n38_82695_c1
749 nmdc:mga00v17_28808_c1
750 nmdc:mga00v17_605210_c1
751 nmdc:mga00v17_62750_c1
752 nmdc:mga0yw44_123640_c1
753 nmdc:mga0yw44_194869_c1
754 nmdc:mga0yw44_210965_c1
755 nmdc:mga0yw44_733378_c1
756 nmdc:mga06z11_291967_c1
757 nmdc:mga04h51_76201_c1
758 nmdc:mga04h51_80110_c1
759 nmdc:mga07m45_23216_c1
760 nmdc:mga07m45_456287_c1
761 nmdc:mga0sz30_123846_c1
762 Ga0500592_010556
763 Ga0500658_0089828
764 Ga0500568_0000010
765 Ga0500568_0063417
766 Ga0500604_0207580
767 Ga0500616_0047136
768 Ga0500616_0200876
769 Ga0500620_078522
770 Ga0500627_0051905
771 Ga0500627_0070368
772 Ga0500627_0090312
773 Ga0500627_0278014
774 Ga0500611_032507
775 Ga0501082_1123892
776 2643983784
777 2503198468
778 2509114041
779 2509393545
780 2510314816
781 2511391896
782 2512934066
783 2512962355
784 2513610651
785 2514038684
786 2514418229
787 2514586540
788 2588520206
789 2597810404
790 2599935250
791 2643773377
792 2643777577
793 2643796025
794 2643839491
795 2644002698
796 2644133966
797 2644155917
798 2688595790
799 2694627966
800 2694636216
801 2723573062
802 2739310288
803 2756674861
804 2765465784
805 2770199100
806 2776269504
807 2776282434
808 2792746978
809 2839993426
810 2840766436
811 2841736211
812 2842874048
813 2844003662
814 2844010595
815 2847673371
816 2847689881
817 2856319160
818 2856322217
819 2856332724
820 2856340711
821 2856342831
822 2856353154
823 2856357030
824 2856369962
825 2857352840
826 2857369268
827 2869165330
828 2869235296
829 2869251662
830 2869257085
831 2869269878
832 2869277342
833 2869284688
834 2869290769
835 2871433051
836 2871440692
837 2871447989
838 2871452944
839 2871465932
840 2871472951
841 2871489663
842 2871502308
843 2874104845
844 2874116478
845 2874122040
846 2874138700
847 2874142992
848 2874153788
849 2874161053
850 2874168346
851 2874172202
852 2876363676
853 2876374752
854 2876381371
855 2876386527
856 2876397127
857 2876406078
858 2876408530
859 2876419093
860 2876424504
861 2878039549
862 2878731349
863 2878740939
864 2878750664
865 2878754301
866 2878766199
867 2878773400
868 2878775266
869 2878791359
870 2881148218
871 2881159199
872 2881164895
873 2881847072
874 2881858407
875 2881865994
876 2882634572
877 2882913273
878 2885314334
879 2885323602
880 2885327927
881 2885344614
882 2885353825
883 2888344168
884 2888353070
885 2889014816
886 2889020101
887 2894653701
888 2903454239
889 2903496271
890 2903497384
891 2903523263
892 2903529302
893 2903547245
894 2904579923
895 2904663881
896 2906313589
897 2906326298
898 2906334257
899 2906357635
900 2906367230
901 2906372825
902 2906385871
903 2906391477
904 2906395040
905 2906407335
906 2906409449
907 2906419232
908 2906434438
909 2919120405
910 2922135570
911 2922151880
912 2922160890
913 2922174398
914 2922181044
915 2922189897
916 2924716938
917 2924722712
918 2924728938
919 2924736521
920 2924741092
921 2924748642
922 2924757942
923 2924765590
924 2924778540
925 2924784989
926 2928522690
927 2937820106
928 2937826510
929 2937840582
930 2937849582
931 2937866120
932 2937876094
933 2937878826
934 2937897234
935 2937974393
936 2937982382
937 2938001108
938 2938017687
939 2954013929
940 2958041457
941 2958042431
942 2958052074
943 2958065283
944 2958077173
945 2958085977
946 2958097654
947 2958101952
948 2958109036
949 2958119238
950 2958123262
951 2958135169
952 2958140364
953 2958148063
954 2958160363
955 2958171374
956 2958173400
957 2958184198
958 2961082253
959 2961118979
960 2961135594
961 2961140520
962 2961169815
963 2961176358
964 2961184400
965 2963645136
966 2965024575
967 2965030173
968 2965036932
969 2965040887
970 2965049013
971 2965062346
972 2965096613
973 2965114551
974 2965120673
975 2967996727
976 2968004789
977 2968022977
978 2968089965
979 2968093669
980 2968098499
981 2968115020
982 2968122755
983 2968133898
984 2968144380
985 2968178207
986 2970475562
987 2970490026
988 2970509029
989 2970517560
990 2970525880
991 2970535524
992 2970544460
993 2970554370
994 2970561053
995 2970599299
996 2970619872
997 2970630203
998 2977823515
999 2977830937
1000 2977850350
1001 2977855253
1002 2977859830
1003 2977879652
1004 2977909177
1005 2977921269
1006 2977925736
1007 2977940940
1008 2977943439
1009 2977950902
1010 2977988140
1011 2979714295
1012 2979747362
1013 2979768474
1014 2979772717
1015 2979781809
1016 2979798075
1017 2979813708
1018 2987641432
1019 2987651449
1020 2987656421
1021 2987666039
1022 2987669335
1023 2987675273
1024 2996311608
1025 2996342420
1026 2996355828
1027 2996387523
1028 3000137159
1029 3002141768
1030 3004173021
1031 3004195062
1032 3004199902
1033 3004210241
1034 3004217274
1035 3004220460
1036 3004233581
1037 3004245650
1038 3004252870
1039 3004282254
1040 3004294630
1041 3004337600
1042 637077216
1043 649870357
1044 8002286368
1045 8004304438
1046 8004316563
1047 8004366243
1048 8004375877
1049 8004393058
1050 8004400653
1051 8004450325
1052 8004639999
1053 8004641546
1054 8004703445
1055 8004706822
1056 8004719845
1057 8004729848
1058 8055617696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13523

Acetyltransf_8

Acetyltransferase (GNAT) domain

35

174

0.95

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

31

168

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

167

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bue-assembly1.cif.gz_A structure of aac(6')-ib in complex with ribostamycin and coenzyme a. 0.9091 7 164
2vqy-assembly1.cif.gz_A structure of aac(6')-ib in complex with parmomycin and acetylcoa. 0.909 7 164
2prb-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a 0.9069 7 164
2qml-assembly1.cif.gz_A crystal structure of an uncharacterized protein (bh2621) from bacillus halodurans at 1.55 a resolution 0.9031 8 164
2qir-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a and kanamycin 0.9007 7 164
ID Description Score Start End Superfamily
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.911 104 164 3.40.630.30
2qirA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9007 7 164 3.40.630.30
af_Q9UUE3_131_325_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.884 8 164 3.40.630.30
1yk3B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8679 8 165 3.40.630.30
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8562 52 165 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A441ZGU6-F1-model_v4 N-acetyltransferase 0.99 1 168 GO:0016410
GO:0019290
GO:0046677
AF-A0A1X7MUB0-F1-model_v4 Aminoglycoside 6'-N-acetyltransferase 0.988 2 167 GO:0016410
GO:0019290
GO:0046677
AF-G6Y7A2-F1-model_v4 GCN5-like N-acetyltransferase 0.9864 2 172 GO:0016410
GO:0019290
GO:0046677
AF-A0A529X0U2-F1-model_v4 Acetyltransferase 0.9858 1 170 GO:0016410
GO:0019290
GO:0046677
AF-A0A2S0XEH4-F1-model_v4 Aminoglycoside N(6')-acetyltransferase type 1 (EC 2.3.1.82) 0.9807 7 172 GO:0019290
GO:0046677
GO:0047663

Map