F459906

General Info

Members Datasets Scaffolds Average Seq Length
530 278 1060 268

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10219407|Ga0070658_102194072
Length 296
Sequence MRDHYQRPALASRAFFCARPSRACYPMPMRLRVCTWNVNSVRLRAEQVARFVRDHAPDVLCMQEIKCQNGEFPAEAFVEMGLPHLRIAGQKGWHGVAIASRLPIEDAPHLDICREKHARCVSGIVAGVEIQNFYIPAGGDLPDRELNPKFDHKLDFYEKLTAEMTRRDPKAPLIVTGDLNVAPGEFDVWNHRYMSKIVSHTPVEIEAFARLMASLGFTNILREAVPEPEKLASWWSYRAQDFRQSNRGLLLDHLLLSPGLREAAFRLGAPAARVHDDVREWEKPSDHAPVSVDLGL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
213 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
214 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
220 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
224 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
225 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
229 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
230 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
231 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
232 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
233 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
237 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
238 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
239 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
244 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
245 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
246 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
249 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
250 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
251 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
252 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
253 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
254 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
255 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
256 2643221583 Caulobacter sp. Root655 Isolate Unclassified
257 2643221584 Caulobacter sp. Root656 Isolate Unclassified
258 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
259 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
260 2643221640 Caulobacter sp. Root342 Isolate Unclassified
261 2643221642 Caulobacter sp. Root343 Isolate Unclassified
262 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
263 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
264 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
265 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
266 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
267 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
268 2849560528 Caulobacter zeae 410 Isolate Unclassified
269 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
270 2851153111 Caulobacter radicis 736 Isolate Unclassified
271 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
272 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
273 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
274 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
275 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
276 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
277 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
278 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.08
Nodule 0
Rhizoplane 2.64
Rhizosphere 65.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10219407 3300005327 Bacteria 1608
2 rootH2_10042095 3300003320 Bacteria 1315
3 Ga0055524_1011000 3300003775 Bacteria 3563
4 Ga0055536_1003526 3300003781 Bacteria 8378
5 Ga0055536_1008141 3300003781 Bacteria 4564
6 Ga0055536_1009453 3300003781 Bacteria 4032
7 Ga0055528_1015927 3300003790 Bacteria 2687
8 Ga0055530_10000313 3300003791 Bacteria 44170
9 Ga0055530_10002661 3300003791 Bacteria 11168
10 Ga0055530_10006718 3300003791 Bacteria 5042
11 Ga0055531_10002220 3300003794 Bacteria 13181
12 Ga0055531_10004699 3300003794 Bacteria 8176
13 Ga0065165_1000583 3300005262 Bacteria 53842
14 Ga0070670_100000007 3300005331 Bacteria 318672
15 Ga0070666_10039451 3300005335 Bacteria 3148
16 Ga0070666_10071226 3300005335 Bacteria 2366
17 Ga0070666_10288247 3300005335 Bacteria 1168
18 Ga0070680_100169189 3300005336 Bacteria 1838
19 Ga0070668_100000272 3300005347 Bacteria 34235
20 Ga0070668_100005382 3300005347 Bacteria 9498
21 Ga0070668_100010729 3300005347 Bacteria 6813
22 Ga0070668_100044636 3300005347 Bacteria 3400
23 Ga0070668_100117006 3300005347 Bacteria 2126
24 Ga0070669_100001157 3300005353 Bacteria 19280
25 Ga0070669_100009792 3300005353 Bacteria 6826
26 Ga0070671_100001426 3300005355 Bacteria 17856
27 Ga0070671_100168959 3300005355 Bacteria 1849
28 Ga0070659_100002510 3300005366 Bacteria 13029
29 Ga0070659_100012009 3300005366 Bacteria 6411
30 Ga0070659_100041439 3300005366 Bacteria 3599
31 Ga0070667_100000291 3300005367 Bacteria 56512
32 Ga0070667_100004267 3300005367 Bacteria 12069
33 Ga0070667_100006296 3300005367 Bacteria 9865
34 Ga0070667_100010607 3300005367 Bacteria 7608
35 Ga0070681_10042288 3300005458 Bacteria 4566
36 Ga0070681_10156607 3300005458 Bacteria 2202
37 Ga0070679_100141555 3300005530 Bacteria 2384
38 Ga0068853_100029369 3300005539 Bacteria 4634
39 Ga0068853_100179815 3300005539 Bacteria 1918
40 Ga0070665_100000395 3300005548 Bacteria 64323
41 Ga0070665_100002782 3300005548 Bacteria 18967
42 Ga0070665_100017425 3300005548 Bacteria 7211
43 Ga0070665_100155747 3300005548 Bacteria 2287
44 Ga0068855_100034109 3300005563 Bacteria 6072
45 Ga0068855_100156944 3300005563 Bacteria 2585
46 Ga0068855_100394587 3300005563 Bacteria 1517
47 Ga0068855_100422748 3300005563 Bacteria 1457
48 Ga0070664_100011039 3300005564 Bacteria 7325
49 Ga0070664_100097198 3300005564 Bacteria 2556
50 Ga0068854_100311900 3300005578 Bacteria 1276
51 Ga0068856_100096630 3300005614 Bacteria 2943
52 Ga0068856_100726928 3300005614 Bacteria 1013
53 Ga0068852_100258988 3300005616 Bacteria 1670
54 Ga0068859_100001326 3300005617 Bacteria 25257
55 Ga0068859_100001699 3300005617 Bacteria 22416
56 Ga0068864_100002407 3300005618 Bacteria 15450
57 Ga0068864_100003084 3300005618 Bacteria 13759
58 Ga0068864_100086573 3300005618 Bacteria 2757
59 Ga0068864_100167963 3300005618 Bacteria 1999
60 Ga0068864_100365885 3300005618 Bacteria 1364
61 Ga0068863_100000262 3300005841 Bacteria 55027
62 Ga0068863_100003500 3300005841 Bacteria 15493
63 Ga0068863_100003720 3300005841 Bacteria 15086
64 Ga0068863_100044605 3300005841 Bacteria 4208
65 Ga0068863_100602868 3300005841 Bacteria 1087
66 Ga0068858_100001577 3300005842 Bacteria 23351
67 Ga0068858_100011317 3300005842 Bacteria 8428
68 Ga0068858_100074394 3300005842 Bacteria 3154
69 Ga0068860_100000047 3300005843 Bacteria 213287
70 Ga0068860_100002126 3300005843 Bacteria 20896
71 Ga0068860_100003451 3300005843 Bacteria 16259
72 Ga0068862_100004496 3300005844 Bacteria 11756
73 Ga0068862_100035969 3300005844 Bacteria 4195
74 Ga0068862_100062514 3300005844 Bacteria 3202
75 Ga0068862_100096486 3300005844 Bacteria 2581
76 Ga0075364_10000600 3300006051 Bacteria 18642
77 Ga0075367_10053550 3300006178 Bacteria 2391
78 Ga0075366_10040517 3300006195 Bacteria 2755
79 Ga0075370_10027305 3300006353 Bacteria 3166
80 Ga0097620_100001326 3300006931 Bacteria 25257
81 Ga0097620_100001698 3300006931 Bacteria 22416
82 Ga0105250_10048171 3300009092 Bacteria 1710
83 Ga0105240_10003418 3300009093 Bacteria 24667
84 Ga0105240_10004843 3300009093 Bacteria 20283
85 Ga0105240_10012284 3300009093 Bacteria 11833
86 Ga0105240_10100147 3300009093 Bacteria 3526
87 Ga0105240_10163340 3300009093 Bacteria 2643
88 Ga0105240_10864653 3300009093 Bacteria 975
89 Ga0105245_10146375 3300009098 Bacteria 2229
90 Ga0105247_10058669 3300009101 Bacteria 2381
91 Ga0105248_10000746 3300009177 Bacteria 36566
92 Ga0105248_10001254 3300009177 Bacteria 28372
93 Ga0105248_10001644 3300009177 Bacteria 24861
94 Ga0105248_10010845 3300009177 Bacteria 10062
95 Ga0105248_10064392 3300009177 Bacteria 4116
96 Ga0105248_10363005 3300009177 Bacteria 1631
97 Ga0105248_10571402 3300009177 Bacteria 1276
98 Ga0105237_10246297 3300009545 Bacteria 1789
99 Ga0105238_10079187 3300009551 Bacteria 3276
100 Ga0105238_10107149 3300009551 Bacteria 2776
101 Ga0105238_10554103 3300009551 Bacteria 1154
102 Ga0105238_10700525 3300009551 Bacteria 1025
103 Ga0105249_10002418 3300009553 Bacteria 16212
104 Ga0105249_10284569 3300009553 Bacteria 1652
105 Ga0105249_10444750 3300009553 Bacteria 1334
106 Ga0105249_10578067 3300009553 Bacteria 1176
107 Ga0105239_10071623 3300010375 Bacteria 3808
108 Ga0105239_10119796 3300010375 Bacteria 2922
109 Ga0157373_10000879 3300013100 Bacteria 23263
110 Ga0157373_10002637 3300013100 Bacteria 13606
111 Ga0157371_10007280 3300013102 Bacteria 8989
112 Ga0157370_10019913 3300013104 Bacteria 6713
113 Ga0157370_10185989 3300013104 Bacteria 1929
114 Ga0157369_10020217 3300013105 Bacteria 7444
115 Ga0157369_10170137 3300013105 Bacteria 2296
116 Ga0157369_10709319 3300013105 Bacteria 1036
117 Ga0163162_10153192 3300013306 Bacteria 2424
118 Ga0163162_11025038 3300013306 Bacteria 933
119 Ga0157375_10240189 3300013308 Bacteria 1971
120 Ga0163163_10008395 3300014325 Bacteria 9173
121 Ga0163163_10041831 3300014325 Bacteria 4484
122 Ga0163163_10092487 3300014325 Bacteria 3040
123 Ga0163163_10145338 3300014325 Bacteria 2415
124 Ga0163163_10163368 3300014325 Bacteria 2273
125 Ga0163163_10179468 3300014325 Bacteria 2164
126 Ga0163163_10572141 3300014325 Bacteria 1193
127 Ga0157377_10192011 3300014745 Bacteria 1291
128 Ga0157379_10003580 3300014968 Bacteria 13164
129 Ga0157379_10024480 3300014968 Bacteria 5359
130 Ga0157379_10059719 3300014968 Bacteria 3410
131 Ga0157379_10152607 3300014968 Bacteria 2084
132 Ga0157376_10344179 3300014969 Bacteria 1425
133 Ga0213872_10008803 3300021361 Bacteria 4871
134 Ga0213872_10020485 3300021361 Bacteria 3048
135 Ga0213876_10000081 3300021384 Bacteria 108997
136 Ga0213876_10077415 3300021384 Bacteria 1757
137 Ga0209026_1001196 3300025250 Bacteria 12024
138 Ga0209148_1010595 3300025254 Bacteria 1742
139 Ga0209565_1000090 3300025263 Bacteria 146540
140 Ga0209673_1004907 3300025273 Bacteria 6967
141 Ga0209676_1000140 3300025292 Bacteria 176735
142 Ga0209676_1000257 3300025292 Bacteria 112662
143 Ga0209676_1001860 3300025292 Bacteria 17366
144 Ga0209676_1005474 3300025292 Bacteria 6626
145 Ga0209564_1015123 3300025295 Bacteria 3159
146 Ga0209758_1001380 3300025297 Bacteria 28958
147 Ga0209758_1002555 3300025297 Bacteria 18327
148 Ga0209050_1000053 3300025298 Bacteria 349521
149 Ga0209050_1003986 3300025298 Bacteria 10412
150 Ga0209050_1006790 3300025298 Bacteria 6668
151 Ga0209050_1012795 3300025298 Bacteria 3805
152 Ga0209256_1008640 3300025299 Bacteria 4667
153 Ga0209256_1026005 3300025299 Bacteria 1695
154 Ga0209256_1027974 3300025299 Bacteria 1598
155 Ga0209051_1000743 3300025303 Bacteria 35022
156 Ga0209257_1000292 3300025304 Bacteria 110440
157 Ga0209257_1000419 3300025304 Bacteria 81956
158 Ga0209257_1000624 3300025304 Bacteria 56974
159 Ga0209257_1003494 3300025304 Bacteria 13386
160 Ga0209257_1006554 3300025304 Bacteria 7426
161 Ga0207680_10020782 3300025903 Bacteria 3542
162 Ga0207680_10024436 3300025903 Bacteria 3316
163 Ga0207680_10041937 3300025903 Bacteria 2674
164 Ga0207705_10001195 3300025909 Bacteria 21043
165 Ga0207707_10237260 3300025912 Bacteria 1586
166 Ga0207695_10000269 3300025913 Bacteria 130183
167 Ga0207695_10000886 3300025913 Bacteria 54376
168 Ga0207695_10010613 3300025913 Bacteria 11257
169 Ga0207695_10057503 3300025913 Bacteria 4039
170 Ga0207695_10090094 3300025913 Bacteria 3083
171 Ga0207695_10291095 3300025913 Bacteria 1525
172 Ga0207671_10171187 3300025914 Bacteria 1686
173 Ga0207660_10007322 3300025917 Bacteria 7142
174 Ga0207657_10000235 3300025919 Bacteria 58394
175 Ga0207652_10083115 3300025921 Bacteria 2803
176 Ga0207681_10014772 3300025923 Bacteria 4861
177 Ga0207681_10094346 3300025923 Bacteria 2144
178 Ga0207694_10020782 3300025924 Bacteria 4969
179 Ga0207694_10065289 3300025924 Bacteria 2837
180 Ga0207694_10084995 3300025924 Bacteria 2489
181 Ga0207650_10000033 3300025925 Bacteria 226809
182 Ga0207650_10025851 3300025925 Bacteria 4184
183 Ga0207687_10125590 3300025927 Bacteria 1926
184 Ga0207644_10003812 3300025931 Bacteria 9764
185 Ga0207644_10016427 3300025931 Bacteria 4979
186 Ga0207644_10288034 3300025931 Bacteria 1320
187 Ga0207690_10000031 3300025932 Bacteria 154724
188 Ga0207690_10026967 3300025932 Bacteria 3626
189 Ga0207690_10072722 3300025932 Bacteria 2375
190 Ga0207706_10044166 3300025933 Bacteria 3950
191 Ga0207686_10190485 3300025934 Bacteria 1462
192 Ga0207711_10000331 3300025941 Bacteria 50472
193 Ga0207711_10000764 3300025941 Bacteria 31611
194 Ga0207711_10005910 3300025941 Bacteria 10337
195 Ga0207711_10099228 3300025941 Bacteria 2574
196 Ga0207711_10247650 3300025941 Bacteria 1635
197 Ga0207679_10073590 3300025945 Bacteria 2586
198 Ga0207679_10083989 3300025945 Bacteria 2443
199 Ga0207667_10006978 3300025949 Bacteria 13647
200 Ga0207667_10009903 3300025949 Bacteria 11181
201 Ga0207667_10009952 3300025949 Bacteria 11153
202 Ga0207667_10125857 3300025949 Bacteria 2640
203 Ga0207667_10164800 3300025949 Bacteria 2279
204 Ga0207667_10367531 3300025949 Bacteria 1466
205 Ga0207712_10001293 3300025961 Bacteria 17165
206 Ga0207712_10383893 3300025961 Bacteria 1176
207 Ga0207668_10000013 3300025972 Bacteria 167989
208 Ga0207668_10001021 3300025972 Bacteria 16758
209 Ga0207668_10002317 3300025972 Bacteria 11116
210 Ga0207668_10006177 3300025972 Bacteria 7068
211 Ga0207668_10018010 3300025972 Bacteria 4436
212 Ga0207668_10288338 3300025972 Bacteria 1349
213 Ga0207658_10000323 3300025986 Bacteria 48151
214 Ga0207658_10002054 3300025986 Bacteria 15002
215 Ga0207658_10055831 3300025986 Bacteria 2928
216 Ga0207658_10093017 3300025986 Bacteria 2343
217 Ga0207658_10318727 3300025986 Bacteria 1345
218 Ga0207703_10000027 3300026035 Bacteria 209608
219 Ga0207703_10006596 3300026035 Bacteria 9263
220 Ga0207703_10007679 3300026035 Bacteria 8547
221 Ga0207703_10038927 3300026035 Bacteria 3798
222 Ga0207703_10132568 3300026035 Bacteria 2154
223 Ga0207639_10034526 3300026041 Bacteria 3738
224 Ga0207702_10144845 3300026078 Bacteria 2155
225 Ga0207702_10344429 3300026078 Bacteria 1424
226 Ga0207702_10575389 3300026078 Bacteria 1104
227 Ga0207641_10000003 3300026088 Bacteria 496984
228 Ga0207641_10004327 3300026088 Bacteria 12331
229 Ga0207641_10005567 3300026088 Bacteria 10738
230 Ga0207641_10083996 3300026088 Bacteria 2771
231 Ga0207676_10000135 3300026095 Bacteria 64914
232 Ga0207676_10000203 3300026095 Bacteria 51550
233 Ga0207676_10087279 3300026095 Bacteria 2551
234 Ga0207674_10490161 3300026116 Bacteria 1188
235 Ga0209999_1000895 3300027543 Bacteria 4996
236 Ga0209983_1003347 3300027665 Bacteria 3436
237 Ga0209813_10031727 3300027866 Bacteria 1561
238 Ga0268266_10000003 3300028379 Bacteria 1701703
239 Ga0268266_10003032 3300028379 Bacteria 17238
240 Ga0268266_10021376 3300028379 Bacteria 5512
241 Ga0268266_10183772 3300028379 Bacteria 1905
242 Ga0268266_10658341 3300028379 Bacteria 1008
243 Ga0268265_10002897 3300028380 Bacteria 12605
244 Ga0268265_10063519 3300028380 Bacteria 2841
245 Ga0268265_10064068 3300028380 Bacteria 2830
246 Ga0268265_10303534 3300028380 Bacteria 1438
247 Ga0268264_10000113 3300028381 Bacteria 203262
248 Ga0268264_10000205 3300028381 Bacteria 120743
249 Ga0268264_10005653 3300028381 Bacteria 10596
250 Ga0268264_10339598 3300028381 Bacteria 1426
251 Ga0307517_10011953 3300028786 Bacteria 11980
252 Ga0307517_10024392 3300028786 Bacteria 7456
253 Ga0307517_10078738 3300028786 Bacteria 2846
254 Ga0265338_10040359 3300028800 Bacteria 4385
255 Ga0265338_10047904 3300028800 Bacteria 3896
256 Ga0265338_10099439 3300028800 Bacteria 2376
257 Ga0265338_10142249 3300028800 Bacteria 1877
258 Ga0265338_10186049 3300028800 Bacteria 1579
259 Ga0265328_10000370 3300031239 Bacteria 20970
260 Ga0265328_10002129 3300031239 Bacteria 8937
261 Ga0265328_10034348 3300031239 Bacteria 1878
262 Ga0265331_10184466 3300031250 Bacteria 942
263 Ga0265327_10000331 3300031251 Bacteria 89636
264 Ga0265327_10001088 3300031251 Bacteria 37825
265 Ga0265327_10001225 3300031251 Bacteria 34433
266 Ga0307513_10000178 3300031456 Bacteria 91751
267 Ga0307513_10021691 3300031456 Bacteria 7576
268 Ga0307513_10027358 3300031456 Bacteria 6550
269 Ga0265314_10116665 3300031711 Bacteria 1688
270 Ga0307516_10000144 3300031730 Bacteria 87138
271 Ga0307413_10361626 3300031824 Bacteria 1124
272 Ga0307413_10393883 3300031824 Bacteria 1083
273 Ga0307410_10158181 3300031852 Bacteria 1695
274 Ga0307412_10002217 3300031911 Bacteria 10785
275 Ga0307414_10048083 3300032004 Bacteria 2940
276 Ga0307414_10051035 3300032004 Bacteria 2869
277 Ga0307414_10056959 3300032004 Bacteria 2744
278 Ga0307414_10068561 3300032004 Bacteria 2546
279 Ga0307414_10101841 3300032004 Bacteria 2163
280 Ga0307414_10200853 3300032004 Bacteria 1621
281 Ga0307414_10200925 3300032004 Bacteria 1621
282 Ga0307414_10455031 3300032004 Bacteria 1123
283 Ga0307415_100415475 3300032126 Bacteria 1153
284 Ga0307510_10012875 3300033180 Bacteria 9930
285 Ga0373926_0037853 3300035083 Bacteria 1717
286 Ga0373936_0004232 3300035113 Bacteria 5417
287 Ga0373927_0007778 3300035695 Bacteria 7249
288 Ga0373947_0319358 3300035725 Bacteria 1038
289 Ga0373937_0496997 3300036401 Bacteria 1159
290 Ga0373925_0000653 3300037068 Bacteria 32591
291 Ga0373925_0031244 3300037068 Bacteria 3913
292 Ga0395899_0000003 3300037312 Bacteria 1232684
293 Ga0395899_0002855 3300037312 Bacteria 13906
294 Ga0395900_0000002 3300037418 Bacteria 671103
295 Ga0395900_0091736 3300037418 Bacteria 3121
296 Ga0395900_0229711 3300037418 Bacteria 1866
297 Ga0395898_0022989 3300037466 Bacteria 6304
298 Ga0395898_0042939 3300037466 Bacteria 4458
299 Ga0395898_0054819 3300037466 Bacteria 3889
300 Ga0395905_0021654 3300037471 Bacteria 6080
301 Ga0395905_0027712 3300037471 Bacteria 5342
302 Ga0395905_0090233 3300037471 Bacteria 2873
303 Ga0395905_0351962 3300037471 Bacteria 1365
304 Ga0436364_0873267 3300037853 Bacteria 1512
305 Ga0395901_0000013 3300038443 Bacteria 375733
306 Ga0395901_0105328 3300038443 Bacteria 2960
307 Ga0395901_0341230 3300038443 Bacteria 1548
308 Ga0395901_0341761 3300038443 Bacteria 1546
309 Ga0436365_0187494 3300039437 Bacteria 67801
310 Ga0436365_1028735 3300039437 Bacteria 924
311 Ga0436361_0940191 3300039447 Bacteria 3365
312 Ga0436361_1069972 3300039447 Bacteria 36104
313 Ga0436362_0049463 3300039453 Bacteria 1501
314 Ga0439431_0027999 3300041997 Bacteria 1386
315 Ga0439445_0042828 3300042004 Bacteria 1207
316 Ga0453684_0117159 3300044712 Bacteria 3224
317 Ga0466959_0028432 3300045049 Bacteria 4146
318 Ga0495617_061434 3300046452 Bacteria 1242
319 Ga0495590_0000467 3300046457 Bacteria 20006
320 Ga0495629_0056529 3300046459 Bacteria 2743
321 Ga0495638_0000283 3300046460 Bacteria 67742
322 Ga0495638_0000292 3300046460 Bacteria 65766
323 Ga0495638_0000939 3300046460 Bacteria 29527
324 Ga0495638_0036419 3300046460 Bacteria 3135
325 Ga0495650_0000168 3300046471 Bacteria 145714
326 Ga0495585_0113098 3300046492 Bacteria 1442
327 Ga0495607_0017682 3300046501 Bacteria 4568
328 Ga0495583_0008671 3300046506 Bacteria 6185
329 Ga0495606_0003607 3300046507 Bacteria 16276
330 Ga0495610_0001080 3300046512 Bacteria 24952
331 Ga0495610_0004585 3300046512 Bacteria 10134
332 Ga0495610_0045762 3300046512 Bacteria 2163
333 Ga0495616_0001277 3300046513 Bacteria 17673
334 Ga0495616_0043246 3300046513 Bacteria 2289
335 Ga0495620_0019780 3300046515 Bacteria 3302
336 Ga0495628_0096218 3300046516 Bacteria 2287
337 Ga0495630_0037598 3300046517 Bacteria 3620
338 Ga0495631_0004826 3300046518 Bacteria 7106
339 Ga0495632_0004711 3300046519 Bacteria 9207
340 Ga0495637_0023266 3300046520 Bacteria 2818
341 Ga0495637_0062793 3300046520 Bacteria 1519
342 Ga0495643_0054919 3300046522 Bacteria 2130
343 Ga0495643_0060500 3300046522 Bacteria 2010
344 Ga0495644_0060242 3300046523 Bacteria 1427
345 Ga0495648_0000107 3300046524 Bacteria 104376
346 Ga0495642_0143425 3300046528 Bacteria 1031
347 Ga0495654_0000085 3300046530 Bacteria 107010
348 Ga0495598_0044498 3300046537 Bacteria 1312
349 Ga0495609_0020633 3300046538 Bacteria 3043
350 Ga0495597_0003622 3300046542 Bacteria 8887
351 Ga0495622_0012681 3300046557 Bacteria 3906
352 Ga0495633_0001477 3300046558 Bacteria 18231
353 Ga0495668_0003283 3300046616 Bacteria 12284
354 Ga0495668_0006744 3300046616 Bacteria 7468
355 Ga0495668_0042080 3300046616 Bacteria 2543
356 Ga0495668_0074955 3300046616 Bacteria 1858
357 Ga0495611_0004621 3300046648 Bacteria 5923
358 Ga0495625_0000034 3300046660 Bacteria 225120
359 Ga0495625_0005125 3300046660 Bacteria 12110
360 Ga0495625_0005802 3300046660 Bacteria 11152
361 Ga0495625_0100003 3300046660 Bacteria 1993
362 Ga0495625_0105456 3300046660 Bacteria 1930
363 Ga0495625_0112556 3300046660 Bacteria 1859
364 Ga0495669_0000007 3300046684 Bacteria 180797
365 Ga0495669_0000919 3300046684 Bacteria 12304
366 Ga0495669_0004238 3300046684 Bacteria 5907
367 Ga0495613_0103597 3300046689 Bacteria 2054
368 Ga0495670_0039294 3300046691 Bacteria 2360
369 Ga0495671_0023786 3300046692 Bacteria 3199
370 Ga0495649_0000171 3300046694 Bacteria 56672
371 Ga0495589_0001385 3300046794 Bacteria 14102
372 Ga0495672_0001097 3300047320 Bacteria 27486
373 Ga0495677_0061942 3300047445 Bacteria 1388
374 Ga0495673_0000492 3300047469 Bacteria 42153
375 Ga0495673_0000697 3300047469 Bacteria 32802
376 Ga0495673_0007360 3300047469 Bacteria 6343
377 Ga0495681_0043609 3300047470 Bacteria 2161
378 Ga0495686_0001488 3300047472 Bacteria 25389
379 Ga0495686_0004012 3300047472 Bacteria 12315
380 Ga0495686_0030422 3300047472 Bacteria 3506
381 Ga0495593_0033823 3300047673 Bacteria 2782
382 Ga0496101_0438544 3300048904 Bacteria 1030
383 Ga0496103_0178823 3300048906 Bacteria 1363
384 Ga0496106_0536480 3300048909 Bacteria 939
385 Ga0496107_0000085 3300048910 Bacteria 44306
386 Ga0496107_0453614 3300048910 Bacteria 952
387 Ga0496108_0337507 3300048911 Bacteria 1315
388 Ga0496109_0074039 3300048912 Bacteria 3130
389 Ga0496112_0073457 3300048915 Bacteria 3381
390 Ga0496115_0001891 3300048918 Bacteria 14988
391 Ga0496115_0003837 3300048918 Bacteria 10833
392 Ga0496115_0011589 3300048918 Bacteria 6612
393 Ga0496115_0033238 3300048918 Bacteria 4071
394 Ga0496115_0073234 3300048918 Bacteria 2780
395 Ga0496115_0608250 3300048918 Bacteria 868
396 Ga0496116_0030216 3300048919 Bacteria 3896
397 Ga0496118_0005332 3300048921 Bacteria 14647
398 Ga0496119_0106591 3300048922 Bacteria 1563
399 Ga0496121_0000042 3300048924 Bacteria 342304
400 Ga0496121_0034434 3300048924 Bacteria 4558
401 Ga0496121_0170224 3300048924 Bacteria 1583
402 Ga0496121_0267828 3300048924 Bacteria 1176
403 Ga0496122_0002925 3300048925 Bacteria 23284
404 Ga0496123_0219862 3300048926 Bacteria 959
405 Ga0496124_0031229 3300048927 Bacteria 4718
406 Ga0496124_0407712 3300048927 Bacteria 941
407 Ga0496125_0004796 3300048928 Bacteria 15397
408 Ga0496125_0010081 3300048928 Bacteria 9586
409 Ga0496125_0058254 3300048928 Bacteria 3122
410 Ga0496126_0004759 3300048929 Bacteria 15996
411 Ga0501032_0029180 3300049569 Bacteria 3788
412 Ga0501033_0002538 3300049570 Bacteria 15455
413 Ga0501033_0032648 3300049570 Bacteria 3910
414 Ga0501034_0294946 3300049571 Bacteria 1559
415 Ga0501037_0015263 3300049573 Bacteria 5651
416 Ga0501037_0165055 3300049573 Bacteria 1577
417 Ga0501047_0008331 3300049581 Bacteria 9785
418 Ga0501047_0059385 3300049581 Bacteria 3692
419 Ga0501047_0325418 3300049581 Bacteria 1376
420 Ga0501048_0160555 3300049582 Bacteria 1591
421 Ga0501035_0035106 3300049822 Bacteria 4553
422 Ga0501044_0005062 3300049823 Bacteria 14710
423 Ga0501044_0019605 3300049823 Bacteria 7231
424 nmdc:mga03683_133527_c1 3300050489 Bacteria 1112
425 nmdc:mga03n38_287812_c1 3300050490 Bacteria 879
426 nmdc:mga00v17_685_c1 3300050491 Bacteria 18642
427 nmdc:mga0k408_42736_c1 3300050493 Bacteria 2610
428 nmdc:mga04h51_6330_c1 3300050495 Bacteria 3064
429 nmdc:mga07m45_56608_c1 3300050496 Bacteria 2216
430 nmdc:mga07m45_8698_c1 3300050496 Bacteria 5230
431 nmdc:mga0sz30_2797_c1 3300050516 Bacteria 6229
432 Ga0500635_0000123 3300053080 Bacteria 45690
433 Ga0500643_000265 3300053087 Bacteria 46271
434 Ga0500643_002905 3300053087 Bacteria 8515
435 Ga0500643_004445 3300053087 Bacteria 6341
436 Ga0500643_005542 3300053087 Bacteria 5423
437 Ga0500643_011598 3300053087 Bacteria 3204
438 Ga0500644_0000124 3300053088 Bacteria 47262
439 Ga0500644_0001671 3300053088 Bacteria 5783
440 Ga0500646_0066997 3300053090 Bacteria 1069
441 Ga0500647_0001502 3300053091 Bacteria 8058
442 Ga0500583_0028302 3300053092 Bacteria 2429
443 Ga0500651_0002111 3300053093 Bacteria 10338
444 Ga0500651_0074942 3300053093 Bacteria 2103
445 Ga0500651_0079971 3300053093 Bacteria 2025
446 Ga0500566_0033378 3300053094 Bacteria 3000
447 Ga0500641_0000871 3300053096 Bacteria 10785
448 Ga0500641_0001351 3300053096 Bacteria 8719
449 Ga0500641_0194437 3300053096 Bacteria 867
450 Ga0500650_0032999 3300053098 Bacteria 2361
451 Ga0500554_047911 3300053102 Bacteria 1335
452 Ga0500555_013525 3300053103 Bacteria 2354
453 Ga0500555_014601 3300053103 Bacteria 2264
454 Ga0500556_0001023 3300053104 Bacteria 14627
455 Ga0500556_0037442 3300053104 Bacteria 1688
456 Ga0500562_002828 3300053108 Bacteria 4325
457 Ga0500562_003821 3300053108 Bacteria 3792
458 Ga0500562_004079 3300053108 Bacteria 3681
459 Ga0500569_002611 3300053109 Bacteria 3581
460 Ga0500572_002628 3300053111 Bacteria 4260
461 Ga0500593_033222 3300053117 Bacteria 2310
462 Ga0500595_002332 3300053119 Bacteria 9491
463 Ga0500595_008312 3300053119 Bacteria 4247
464 Ga0500595_009160 3300053119 Bacteria 4009
465 Ga0500597_097732 3300053120 Bacteria 1276
466 Ga0500607_205471 3300053121 Bacteria 840
467 Ga0500608_000011 3300053122 Bacteria 92215
468 Ga0500608_001751 3300053122 Bacteria 7757
469 Ga0500614_001062 3300053123 Bacteria 6832
470 Ga0500642_0018179 3300053130 Bacteria 2713
471 Ga0500655_025410 3300053133 Bacteria 1124
472 Ga0500658_0002725 3300053134 Bacteria 6792
473 Ga0500559_0000004 3300053136 Bacteria 241551
474 Ga0500559_0005404 3300053136 Bacteria 5884
475 Ga0500559_0014378 3300053136 Bacteria 3345
476 Ga0500559_0025335 3300053136 Bacteria 2524
477 Ga0500559_0127772 3300053136 Bacteria 1186
478 Ga0500564_000063 3300053138 Bacteria 28411
479 Ga0500577_0012108 3300053142 Bacteria 2597
480 Ga0500590_046523 3300053148 Bacteria 2217
481 Ga0500604_0023031 3300053151 Bacteria 1773
482 Ga0500616_0005230 3300053153 Bacteria 8876
483 Ga0500616_0044842 3300053153 Bacteria 2358
484 Ga0500619_004773 3300053154 Bacteria 2947
485 Ga0500622_0000643 3300053156 Bacteria 31235
486 Ga0500622_0005996 3300053156 Bacteria 7140
487 Ga0500622_0023760 3300053156 Bacteria 3246
488 Ga0500622_0042108 3300053156 Bacteria 2374
489 Ga0500622_0086872 3300053156 Bacteria 1558
490 Ga0500639_084571 3300053163 Bacteria 1592
491 Ga0500636_0003167 3300053177 Bacteria 9217
492 Ga0500637_0005271 3300053178 Bacteria 6247
493 Ga0500637_0098026 3300053178 Bacteria 1699
494 Ga0500576_041914 3300053725 Bacteria 2057
495 Ga0500645_001143 3300053730 Bacteria 14378
496 Ga0500645_001630 3300053730 Bacteria 11078
497 Ga0500645_013157 3300053730 Bacteria 2661
498 Ga0500645_091407 3300053730 Bacteria 863
499 Ga0500609_007218 3300053731 Bacteria 1500
500 Ga0500552_004704 3300053733 Bacteria 1453
501 Ga0500596_000393 3300053735 Bacteria 7980
502 2585149727 2582581279 Bacteria 4980720
503 2587915781 2585428106 Bacteria 5179711
504 2643750134 2643221545 Bacteria 5083237
505 2643781786 2643221552 Bacteria 5708754
506 2643884549 2643221574 Bacteria 2789653
507 2643922353 2643221583 Bacteria 5218014
508 2643931976 2643221584 Bacteria 5511711
509 2643999660 2643221598 Bacteria 4578346
510 2644087646 2643221614 Bacteria 4260023
511 2644223331 2643221640 Bacteria 5258820
512 2644236399 2643221642 Bacteria 5357871
513 2644344310 2643221661 Bacteria 4267604
514 2644367005 2643221666 Bacteria 4265935
515 2644507023 2643221691 Bacteria 5093099
516 2644549067 2643221699 Bacteria 5731501
517 2644553203 2643221699 Bacteria 5731501
518 2792460853 2791355048 Bacteria 5832535
519 2843745487 2843744320 Bacteria 5659202
520 2849561101 2849560528 Bacteria 5393480
521 2849578567 2849573788 Bacteria 5421256
522 2851157137 2851153111 Bacteria 5542585
523 2857505707 2857504554 Bacteria 5369913
524 2884965523 2884960567 Bacteria 5437054
525 2891093160 2891088606 Bacteria 4762464
526 2898332795 2898329390 Bacteria 5168154
527 2928532190 2928531327 Bacteria 5101314
528 2928974622 2928972540 Bacteria 3058286
529 2941488065 2941485952 Bacteria 3591484
530 2977243546 2977240413 Bacteria 3191065
531 Ga0070658_10219407
532 rootH2_10042095
533 Ga0055524_1011000
534 Ga0055536_1003526
535 Ga0055536_1008141
536 Ga0055536_1009453
537 Ga0055528_1015927
538 Ga0055530_10000313
539 Ga0055530_10002661
540 Ga0055530_10006718
541 Ga0055531_10002220
542 Ga0055531_10004699
543 Ga0065165_1000583
544 Ga0070670_100000007
545 Ga0070666_10039451
546 Ga0070666_10071226
547 Ga0070666_10288247
548 Ga0070680_100169189
549 Ga0070668_100000272
550 Ga0070668_100005382
551 Ga0070668_100010729
552 Ga0070668_100044636
553 Ga0070668_100117006
554 Ga0070669_100001157
555 Ga0070669_100009792
556 Ga0070671_100001426
557 Ga0070671_100168959
558 Ga0070659_100002510
559 Ga0070659_100012009
560 Ga0070659_100041439
561 Ga0070667_100000291
562 Ga0070667_100004267
563 Ga0070667_100006296
564 Ga0070667_100010607
565 Ga0070681_10042288
566 Ga0070681_10156607
567 Ga0070679_100141555
568 Ga0068853_100029369
569 Ga0068853_100179815
570 Ga0070665_100000395
571 Ga0070665_100002782
572 Ga0070665_100017425
573 Ga0070665_100155747
574 Ga0068855_100034109
575 Ga0068855_100156944
576 Ga0068855_100394587
577 Ga0068855_100422748
578 Ga0070664_100011039
579 Ga0070664_100097198
580 Ga0068854_100311900
581 Ga0068856_100096630
582 Ga0068856_100726928
583 Ga0068852_100258988
584 Ga0068859_100001326
585 Ga0068859_100001699
586 Ga0068864_100002407
587 Ga0068864_100003084
588 Ga0068864_100086573
589 Ga0068864_100167963
590 Ga0068864_100365885
591 Ga0068863_100000262
592 Ga0068863_100003500
593 Ga0068863_100003720
594 Ga0068863_100044605
595 Ga0068863_100602868
596 Ga0068858_100001577
597 Ga0068858_100011317
598 Ga0068858_100074394
599 Ga0068860_100000047
600 Ga0068860_100002126
601 Ga0068860_100003451
602 Ga0068862_100004496
603 Ga0068862_100035969
604 Ga0068862_100062514
605 Ga0068862_100096486
606 Ga0075364_10000600
607 Ga0075367_10053550
608 Ga0075366_10040517
609 Ga0075370_10027305
610 Ga0097620_100001326
611 Ga0097620_100001698
612 Ga0105250_10048171
613 Ga0105240_10003418
614 Ga0105240_10004843
615 Ga0105240_10012284
616 Ga0105240_10100147
617 Ga0105240_10163340
618 Ga0105240_10864653
619 Ga0105245_10146375
620 Ga0105247_10058669
621 Ga0105248_10000746
622 Ga0105248_10001254
623 Ga0105248_10001644
624 Ga0105248_10010845
625 Ga0105248_10064392
626 Ga0105248_10363005
627 Ga0105248_10571402
628 Ga0105237_10246297
629 Ga0105238_10079187
630 Ga0105238_10107149
631 Ga0105238_10554103
632 Ga0105238_10700525
633 Ga0105249_10002418
634 Ga0105249_10284569
635 Ga0105249_10444750
636 Ga0105249_10578067
637 Ga0105239_10071623
638 Ga0105239_10119796
639 Ga0157373_10000879
640 Ga0157373_10002637
641 Ga0157371_10007280
642 Ga0157370_10019913
643 Ga0157370_10185989
644 Ga0157369_10020217
645 Ga0157369_10170137
646 Ga0157369_10709319
647 Ga0163162_10153192
648 Ga0163162_11025038
649 Ga0157375_10240189
650 Ga0163163_10008395
651 Ga0163163_10041831
652 Ga0163163_10092487
653 Ga0163163_10145338
654 Ga0163163_10163368
655 Ga0163163_10179468
656 Ga0163163_10572141
657 Ga0157377_10192011
658 Ga0157379_10003580
659 Ga0157379_10024480
660 Ga0157379_10059719
661 Ga0157379_10152607
662 Ga0157376_10344179
663 Ga0213872_10008803
664 Ga0213872_10020485
665 Ga0213876_10000081
666 Ga0213876_10077415
667 Ga0209026_1001196
668 Ga0209148_1010595
669 Ga0209565_1000090
670 Ga0209673_1004907
671 Ga0209676_1000140
672 Ga0209676_1000257
673 Ga0209676_1001860
674 Ga0209676_1005474
675 Ga0209564_1015123
676 Ga0209758_1001380
677 Ga0209758_1002555
678 Ga0209050_1000053
679 Ga0209050_1003986
680 Ga0209050_1006790
681 Ga0209050_1012795
682 Ga0209256_1008640
683 Ga0209256_1026005
684 Ga0209256_1027974
685 Ga0209051_1000743
686 Ga0209257_1000292
687 Ga0209257_1000419
688 Ga0209257_1000624
689 Ga0209257_1003494
690 Ga0209257_1006554
691 Ga0207680_10020782
692 Ga0207680_10024436
693 Ga0207680_10041937
694 Ga0207705_10001195
695 Ga0207707_10237260
696 Ga0207695_10000269
697 Ga0207695_10000886
698 Ga0207695_10010613
699 Ga0207695_10057503
700 Ga0207695_10090094
701 Ga0207695_10291095
702 Ga0207671_10171187
703 Ga0207660_10007322
704 Ga0207657_10000235
705 Ga0207652_10083115
706 Ga0207681_10014772
707 Ga0207681_10094346
708 Ga0207694_10020782
709 Ga0207694_10065289
710 Ga0207694_10084995
711 Ga0207650_10000033
712 Ga0207650_10025851
713 Ga0207687_10125590
714 Ga0207644_10003812
715 Ga0207644_10016427
716 Ga0207644_10288034
717 Ga0207690_10000031
718 Ga0207690_10026967
719 Ga0207690_10072722
720 Ga0207706_10044166
721 Ga0207686_10190485
722 Ga0207711_10000331
723 Ga0207711_10000764
724 Ga0207711_10005910
725 Ga0207711_10099228
726 Ga0207711_10247650
727 Ga0207679_10073590
728 Ga0207679_10083989
729 Ga0207667_10006978
730 Ga0207667_10009903
731 Ga0207667_10009952
732 Ga0207667_10125857
733 Ga0207667_10164800
734 Ga0207667_10367531
735 Ga0207712_10001293
736 Ga0207712_10383893
737 Ga0207668_10000013
738 Ga0207668_10001021
739 Ga0207668_10002317
740 Ga0207668_10006177
741 Ga0207668_10018010
742 Ga0207668_10288338
743 Ga0207658_10000323
744 Ga0207658_10002054
745 Ga0207658_10055831
746 Ga0207658_10093017
747 Ga0207658_10318727
748 Ga0207703_10000027
749 Ga0207703_10006596
750 Ga0207703_10007679
751 Ga0207703_10038927
752 Ga0207703_10132568
753 Ga0207639_10034526
754 Ga0207702_10144845
755 Ga0207702_10344429
756 Ga0207702_10575389
757 Ga0207641_10000003
758 Ga0207641_10004327
759 Ga0207641_10005567
760 Ga0207641_10083996
761 Ga0207676_10000135
762 Ga0207676_10000203
763 Ga0207676_10087279
764 Ga0207674_10490161
765 Ga0209999_1000895
766 Ga0209983_1003347
767 Ga0209813_10031727
768 Ga0268266_10000003
769 Ga0268266_10003032
770 Ga0268266_10021376
771 Ga0268266_10183772
772 Ga0268266_10658341
773 Ga0268265_10002897
774 Ga0268265_10063519
775 Ga0268265_10064068
776 Ga0268265_10303534
777 Ga0268264_10000113
778 Ga0268264_10000205
779 Ga0268264_10005653
780 Ga0268264_10339598
781 Ga0307517_10011953
782 Ga0307517_10024392
783 Ga0307517_10078738
784 Ga0265338_10040359
785 Ga0265338_10047904
786 Ga0265338_10099439
787 Ga0265338_10142249
788 Ga0265338_10186049
789 Ga0265328_10000370
790 Ga0265328_10002129
791 Ga0265328_10034348
792 Ga0265331_10184466
793 Ga0265327_10000331
794 Ga0265327_10001088
795 Ga0265327_10001225
796 Ga0307513_10000178
797 Ga0307513_10021691
798 Ga0307513_10027358
799 Ga0265314_10116665
800 Ga0307516_10000144
801 Ga0307413_10361626
802 Ga0307413_10393883
803 Ga0307410_10158181
804 Ga0307412_10002217
805 Ga0307414_10048083
806 Ga0307414_10051035
807 Ga0307414_10056959
808 Ga0307414_10068561
809 Ga0307414_10101841
810 Ga0307414_10200853
811 Ga0307414_10200925
812 Ga0307414_10455031
813 Ga0307415_100415475
814 Ga0307510_10012875
815 Ga0373926_0037853
816 Ga0373936_0004232
817 Ga0373927_0007778
818 Ga0373947_0319358
819 Ga0373937_0496997
820 Ga0373925_0000653
821 Ga0373925_0031244
822 Ga0395899_0000003
823 Ga0395899_0002855
824 Ga0395900_0000002
825 Ga0395900_0091736
826 Ga0395900_0229711
827 Ga0395898_0022989
828 Ga0395898_0042939
829 Ga0395898_0054819
830 Ga0395905_0021654
831 Ga0395905_0027712
832 Ga0395905_0090233
833 Ga0395905_0351962
834 Ga0436364_0873267
835 Ga0395901_0000013
836 Ga0395901_0105328
837 Ga0395901_0341230
838 Ga0395901_0341761
839 Ga0436365_0187494
840 Ga0436365_1028735
841 Ga0436361_0940191
842 Ga0436361_1069972
843 Ga0436362_0049463
844 Ga0439431_0027999
845 Ga0439445_0042828
846 Ga0453684_0117159
847 Ga0466959_0028432
848 Ga0495617_061434
849 Ga0495590_0000467
850 Ga0495629_0056529
851 Ga0495638_0000283
852 Ga0495638_0000292
853 Ga0495638_0000939
854 Ga0495638_0036419
855 Ga0495650_0000168
856 Ga0495585_0113098
857 Ga0495607_0017682
858 Ga0495583_0008671
859 Ga0495606_0003607
860 Ga0495610_0001080
861 Ga0495610_0004585
862 Ga0495610_0045762
863 Ga0495616_0001277
864 Ga0495616_0043246
865 Ga0495620_0019780
866 Ga0495628_0096218
867 Ga0495630_0037598
868 Ga0495631_0004826
869 Ga0495632_0004711
870 Ga0495637_0023266
871 Ga0495637_0062793
872 Ga0495643_0054919
873 Ga0495643_0060500
874 Ga0495644_0060242
875 Ga0495648_0000107
876 Ga0495642_0143425
877 Ga0495654_0000085
878 Ga0495598_0044498
879 Ga0495609_0020633
880 Ga0495597_0003622
881 Ga0495622_0012681
882 Ga0495633_0001477
883 Ga0495668_0003283
884 Ga0495668_0006744
885 Ga0495668_0042080
886 Ga0495668_0074955
887 Ga0495611_0004621
888 Ga0495625_0000034
889 Ga0495625_0005125
890 Ga0495625_0005802
891 Ga0495625_0100003
892 Ga0495625_0105456
893 Ga0495625_0112556
894 Ga0495669_0000007
895 Ga0495669_0000919
896 Ga0495669_0004238
897 Ga0495613_0103597
898 Ga0495670_0039294
899 Ga0495671_0023786
900 Ga0495649_0000171
901 Ga0495589_0001385
902 Ga0495672_0001097
903 Ga0495677_0061942
904 Ga0495673_0000492
905 Ga0495673_0000697
906 Ga0495673_0007360
907 Ga0495681_0043609
908 Ga0495686_0001488
909 Ga0495686_0004012
910 Ga0495686_0030422
911 Ga0495593_0033823
912 Ga0496101_0438544
913 Ga0496103_0178823
914 Ga0496106_0536480
915 Ga0496107_0000085
916 Ga0496107_0453614
917 Ga0496108_0337507
918 Ga0496109_0074039
919 Ga0496112_0073457
920 Ga0496115_0001891
921 Ga0496115_0003837
922 Ga0496115_0011589
923 Ga0496115_0033238
924 Ga0496115_0073234
925 Ga0496115_0608250
926 Ga0496116_0030216
927 Ga0496118_0005332
928 Ga0496119_0106591
929 Ga0496121_0000042
930 Ga0496121_0034434
931 Ga0496121_0170224
932 Ga0496121_0267828
933 Ga0496122_0002925
934 Ga0496123_0219862
935 Ga0496124_0031229
936 Ga0496124_0407712
937 Ga0496125_0004796
938 Ga0496125_0010081
939 Ga0496125_0058254
940 Ga0496126_0004759
941 Ga0501032_0029180
942 Ga0501033_0002538
943 Ga0501033_0032648
944 Ga0501034_0294946
945 Ga0501037_0015263
946 Ga0501037_0165055
947 Ga0501047_0008331
948 Ga0501047_0059385
949 Ga0501047_0325418
950 Ga0501048_0160555
951 Ga0501035_0035106
952 Ga0501044_0005062
953 Ga0501044_0019605
954 nmdc:mga03683_133527_c1
955 nmdc:mga03n38_287812_c1
956 nmdc:mga00v17_685_c1
957 nmdc:mga0k408_42736_c1
958 nmdc:mga04h51_6330_c1
959 nmdc:mga07m45_56608_c1
960 nmdc:mga07m45_8698_c1
961 nmdc:mga0sz30_2797_c1
962 Ga0500635_0000123
963 Ga0500643_000265
964 Ga0500643_002905
965 Ga0500643_004445
966 Ga0500643_005542
967 Ga0500643_011598
968 Ga0500644_0000124
969 Ga0500644_0001671
970 Ga0500646_0066997
971 Ga0500647_0001502
972 Ga0500583_0028302
973 Ga0500651_0002111
974 Ga0500651_0074942
975 Ga0500651_0079971
976 Ga0500566_0033378
977 Ga0500641_0000871
978 Ga0500641_0001351
979 Ga0500641_0194437
980 Ga0500650_0032999
981 Ga0500554_047911
982 Ga0500555_013525
983 Ga0500555_014601
984 Ga0500556_0001023
985 Ga0500556_0037442
986 Ga0500562_002828
987 Ga0500562_003821
988 Ga0500562_004079
989 Ga0500569_002611
990 Ga0500572_002628
991 Ga0500593_033222
992 Ga0500595_002332
993 Ga0500595_008312
994 Ga0500595_009160
995 Ga0500597_097732
996 Ga0500607_205471
997 Ga0500608_000011
998 Ga0500608_001751
999 Ga0500614_001062
1000 Ga0500642_0018179
1001 Ga0500655_025410
1002 Ga0500658_0002725
1003 Ga0500559_0000004
1004 Ga0500559_0005404
1005 Ga0500559_0014378
1006 Ga0500559_0025335
1007 Ga0500559_0127772
1008 Ga0500564_000063
1009 Ga0500577_0012108
1010 Ga0500590_046523
1011 Ga0500604_0023031
1012 Ga0500616_0005230
1013 Ga0500616_0044842
1014 Ga0500619_004773
1015 Ga0500622_0000643
1016 Ga0500622_0005996
1017 Ga0500622_0023760
1018 Ga0500622_0042108
1019 Ga0500622_0086872
1020 Ga0500639_084571
1021 Ga0500636_0003167
1022 Ga0500637_0005271
1023 Ga0500637_0098026
1024 Ga0500576_041914
1025 Ga0500645_001143
1026 Ga0500645_001630
1027 Ga0500645_013157
1028 Ga0500645_091407
1029 Ga0500609_007218
1030 Ga0500552_004704
1031 Ga0500596_000393
1032 2585149727
1033 2587915781
1034 2643750134
1035 2643781786
1036 2643884549
1037 2643922353
1038 2643931976
1039 2643999660
1040 2644087646
1041 2644223331
1042 2644236399
1043 2644344310
1044 2644367005
1045 2644507023
1046 2644549067
1047 2644553203
1048 2792460853
1049 2843745487
1050 2849561101
1051 2849578567
1052 2851157137
1053 2857505707
1054 2884965523
1055 2891093160
1056 2898332795
1057 2928532190
1058 2928974622
1059 2941488065
1060 2977243546

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

34

287

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9342 3 268
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9272 3 268
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9178 3 266
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9041 3 266
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9037 3 268
ID Description Score Start End Superfamily
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9318 3 268 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9248 3 268 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9102 3 266 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8966 3 266 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8762 3 268 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A354EQZ5-F1-model_v4 Exodeoxyribonuclease III 0.9933 1 174 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A0V2F737-F1-model_v4 deleted 0.9912 1 268
AF-A0A4Q3SZN9-F1-model_v4 Exodeoxyribonuclease III 0.991 1 144 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A258DE36-F1-model_v4 Exodeoxyribonuclease III 0.9884 29 268 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A4Q3SZN9-F1-model_v4 Exodeoxyribonuclease III 0.9842 1 144 GO:0003677
GO:0004519
GO:0006281
GO:0008311

Map