F459948

General Info

Members Datasets Scaffolds Average Seq Length
530 298 1060 322

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10059615|Ga0157369_100596152
Length 357
Sequence VQGVPNAFEHLRDSAEFRNSAHRAGIDLYQAVRMWTGTLYALVAGLMWGLVFVGPLLVPEYPAALQSVGRYLAFGLIALPLAWLDRAALRQLSRADWIEALKLAAVGNLLYYLCLASAIQRAGGPLPTMIIGTLPVVIAVSANLRNARRDGRLPWGRLAPSLLLIAAGIACVNQAELAALKAQAGADLSRYASGALLAFGAVACWTWYPLRNADWLRHHPGRSPRSWATAQGVATLPLALAGYALLWLAMGVGGNAFPMPFGPRPQVFIALMAAIGLLASWLGTLCWNEASQRLPTALAGQLIVFETLAALSYAFVLRGTPPGAQTLLGIGLLVAGVAWATRVKPVPLERLEAERLP

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
87 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
165 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
166 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
169 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
170 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
171 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
176 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
246 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
252 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
253 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
254 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
255 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
256 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
257 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
258 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
259 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
260 2643221559 Lysobacter sp. Root559 Isolate Unclassified
261 2643221569 Achromobacter sp. Root565 Isolate Unclassified
262 2643221573 Lysobacter sp. Root604 Isolate Unclassified
263 2643221586 Lysobacter sp. Root667 Isolate Unclassified
264 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
265 2643221593 Lysobacter sp. Root690 Isolate Unclassified
266 2643221594 Achromobacter sp. Root170 Isolate Unclassified
267 2643221612 Lysobacter sp. Root76 Isolate Unclassified
268 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
269 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
270 2643221720 Lysobacter sp. Root916 Isolate Unclassified
271 2643221727 Lysobacter sp. Root96 Isolate Unclassified
272 2643221728 Lysobacter sp. Root983 Isolate Unclassified
273 2739367700 Dyella sp. YR388 Isolate Unclassified
274 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
275 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
276 2847085930 Erwinia persicina B64 Isolate Bulb
277 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
278 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
279 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
280 2858950400 Achromobacter sp. K91 Isolate Unclassified
281 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
282 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
283 2884411467 Dyella sp. AD56 Isolate Rhizosphere
284 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
285 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
286 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
287 2928963466 Dyella japonica 1073 Isolate Unclassified
288 2932406140 Serratia sp. 2723 Isolate Rhizosphere
289 2939577877 Serratia sp. 509 Isolate Rhizosphere
290 2941479691
291 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
292 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
293 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
294 640753048 Serratia proteamaculans 568 Isolate Endosphere
295 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
296 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
297 8004592986 Serratia sp. S119 Isolate Unclassified
298 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 0.38
Isolates 9.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.19
Endosphere 31.13
Nodule 0.94
Rhizoplane 3.21
Rhizosphere 48.49
Stem 0
Stem Tuber 0.94
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10059615 3300013105 Bacteria 4115
2 JGI24740J21852_10038774 3300001979 Bacteria 1459
3 JGI24739J22299_10000846 3300001989 Bacteria 11254
4 JGI25156J39149_1002853 3300002705 Bacteria 5933
5 JGI25162J39368_1000192 3300002737 Bacteria 64224
6 JGI25162J39368_1000991 3300002737 Bacteria 17952
7 JGI25162J39368_1001028 3300002737 Bacteria 17236
8 JGI25157J39369_1000068 3300002741 Bacteria 94833
9 JGI25157J39369_1000255 3300002741 Bacteria 39272
10 JGI25157J39369_1000266 3300002741 Bacteria 38247
11 JGI25157J39369_1002253 3300002741 Bacteria 5174
12 JGI25163J39215_1000813 3300002771 Bacteria 7505
13 JGI25164J39214_1000113 3300002772 Bacteria 78046
14 JGI25164J39214_1000195 3300002772 Bacteria 51957
15 JGI25164J39214_1000633 3300002772 Bacteria 14696
16 JGI25152J39213_1002357 3300002773 Bacteria 7248
17 JGI25151J46595_10000151 3300003187 Bacteria 90836
18 JGI25151J46595_10001849 3300003187 Bacteria 13624
19 JGI25151J46595_10007980 3300003187 Bacteria 5134
20 JGI25151J46595_10014538 3300003187 Bacteria 3503
21 JGI25165J46597_1000158 3300003214 Bacteria 108257
22 JGI25165J46597_1000195 3300003214 Bacteria 90569
23 JGI25165J46597_1001100 3300003214 Bacteria 17236
24 JGI25153J46596_10003204 3300003215 Bacteria 9196
25 rootH1_10120498 3300003323 Bacteria 3551
26 Ga0006562J51391_1175853 3300003578 Bacteria 3070
27 Ga0006562J51391_1175854 3300003578 Bacteria 3077
28 Ga0055538_1001608 3300003751 Bacteria 4093
29 Ga0055539_1000670 3300003752 Bacteria 9022
30 Ga0055533_1000427 3300003756 Bacteria 16163
31 Ga0055533_1001144 3300003756 Bacteria 7522
32 Ga0055525_1000057 3300003759 Bacteria 211185
33 Ga0055525_1000239 3300003759 Bacteria 57171
34 Ga0055525_1000623 3300003759 Bacteria 14563
35 Ga0055527_1000066 3300003760 Bacteria 88276
36 Ga0055527_1000136 3300003760 Bacteria 52239
37 Ga0055535_1000058 3300003761 Bacteria 125370
38 Ga0055535_1000105 3300003761 Bacteria 90569
39 Ga0055535_1000149 3300003761 Bacteria 74091
40 Ga0055535_1000427 3300003761 Bacteria 39418
41 Ga0055535_1000990 3300003761 Bacteria 18357
42 Ga0055535_1003209 3300003761 Bacteria 4826
43 Ga0055542_1000085 3300003762 Bacteria 125370
44 Ga0055542_1000134 3300003762 Bacteria 94890
45 Ga0055542_1000233 3300003762 Bacteria 64224
46 Ga0055542_1000315 3300003762 Bacteria 52239
47 Ga0055542_1000503 3300003762 Bacteria 35709
48 Ga0055542_1000514 3300003762 Bacteria 35180
49 Ga0055529_1000107 3300003763 Bacteria 122905
50 Ga0055529_1000169 3300003763 Bacteria 90495
51 Ga0055529_1000173 3300003763 Bacteria 88663
52 Ga0055529_1000240 3300003763 Bacteria 68255
53 Ga0055529_1000332 3300003763 Bacteria 53051
54 Ga0055529_1001277 3300003763 Bacteria 8983
55 Ga0055526_1000206 3300003771 Bacteria 50866
56 Ga0055526_1001135 3300003771 Bacteria 19316
57 Ga0055526_1019124 3300003771 Bacteria 2510
58 Ga0055537_1000539 3300003773 Bacteria 21873
59 Ga0055524_1000275 3300003775 Bacteria 51007
60 Ga0055536_1000211 3300003781 Bacteria 47611
61 Ga0055536_1007272 3300003781 Bacteria 4985
62 Ga0055536_1023133 3300003781 Bacteria 1835
63 Ga0055534_1000228 3300003784 Bacteria 40575
64 Ga0055528_1000199 3300003790 Bacteria 51007
65 Ga0055530_10000224 3300003791 Bacteria 50209
66 Ga0055530_10001962 3300003791 Bacteria 14006
67 Ga0055531_10000094 3300003794 Bacteria 96266
68 Ga0055531_10007087 3300003794 Bacteria 6196
69 Ga0055531_10012394 3300003794 Bacteria 4015
70 Ga0058692_1003913 3300003856 Bacteria 4511
71 Ga0065165_1001925 3300005262 Bacteria 19817
72 Ga0065165_1009636 3300005262 Bacteria 4296
73 Ga0070690_100134719 3300005330 Bacteria 1672
74 Ga0070666_10075229 3300005335 Bacteria 2303
75 Ga0070668_100010448 3300005347 Bacteria 6899
76 Ga0070668_100250545 3300005347 Bacteria 1470
77 Ga0070669_100051844 3300005353 Bacteria 3000
78 Ga0070671_100198089 3300005355 Bacteria 1703
79 Ga0070674_100043378 3300005356 Bacteria 3060
80 Ga0070674_100223488 3300005356 Bacteria 1466
81 Ga0070709_10057914 3300005434 Bacteria 2456
82 Ga0070700_100113947 3300005441 Bacteria 1802
83 Ga0070663_100000133 3300005455 Bacteria 35461
84 Ga0070663_100180500 3300005455 Bacteria 1637
85 Ga0068867_100031254 3300005459 Bacteria 3843
86 Ga0068867_100096331 3300005459 Bacteria 2253
87 Ga0070706_100111480 3300005467 Bacteria 2546
88 Ga0068853_100020997 3300005539 Bacteria 5436
89 Ga0070686_100174603 3300005544 Bacteria 1522
90 Ga0070665_100311648 3300005548 Bacteria 1577
91 Ga0068855_100040028 3300005563 Bacteria 5563
92 Ga0068855_100071513 3300005563 Bacteria 4034
93 Ga0068855_100114256 3300005563 Bacteria 3096
94 Ga0068857_100023422 3300005577 Bacteria 5436
95 Ga0068854_100000610 3300005578 Bacteria 21145
96 Ga0068854_100001065 3300005578 Bacteria 16494
97 Ga0068854_100118049 3300005578 Bacteria 2009
98 Ga0068856_100000022 3300005614 Bacteria 142768
99 Ga0068856_100002823 3300005614 Bacteria 17782
100 Ga0068852_100478548 3300005616 Bacteria 1237
101 Ga0068859_100093258 3300005617 Bacteria 3062
102 Ga0068859_100177866 3300005617 Bacteria 2210
103 Ga0068864_100260638 3300005618 Bacteria 1612
104 Ga0068866_10175082 3300005718 Bacteria 1263
105 Ga0068861_100053537 3300005719 Bacteria 3071
106 Ga0068851_10058604 3300005834 Bacteria 1968
107 Ga0068863_100037908 3300005841 Bacteria 4588
108 Ga0068863_100073124 3300005841 Bacteria 3243
109 Ga0068858_100047619 3300005842 Bacteria 3974
110 Ga0068858_100069562 3300005842 Bacteria 3263
111 Ga0068860_100006224 3300005843 Bacteria 11999
112 Ga0068860_100338693 3300005843 Bacteria 1479
113 Ga0068862_100004087 3300005844 Bacteria 12373
114 Ga0068862_100070178 3300005844 Bacteria 3024
115 Ga0075366_10003503 3300006195 Bacteria 8290
116 Ga0097621_100045476 3300006237 Bacteria 3546
117 Ga0097621_100052265 3300006237 Bacteria 3328
118 Ga0068865_100074141 3300006881 Bacteria 2423
119 Ga0068865_100087087 3300006881 Bacteria 2257
120 Ga0097620_100093256 3300006931 Bacteria 3062
121 Ga0097620_100177862 3300006931 Bacteria 2210
122 Ga0079104_1001435 3300006946 Bacteria 15995
123 Ga0105251_10000026 3300009011 Bacteria 132136
124 Ga0105251_10000359 3300009011 Bacteria 44796
125 Ga0105244_10000436 3300009036 Bacteria 38460
126 Ga0105244_10049046 3300009036 Bacteria 2159
127 Ga0105240_10004361 3300009093 Bacteria 21598
128 Ga0105240_10015487 3300009093 Bacteria 10365
129 Ga0105240_10018475 3300009093 Bacteria 9360
130 Ga0105240_10075562 3300009093 Bacteria 4155
131 Ga0105243_10002731 3300009148 Bacteria 14672
132 Ga0105243_10158429 3300009148 Bacteria 1949
133 Ga0105241_10000002 3300009174 Bacteria 869480
134 Ga0105237_10000711 3300009545 Bacteria 46033
135 Ga0105237_10001063 3300009545 Bacteria 36895
136 Ga0105237_10062798 3300009545 Bacteria 3713
137 Ga0105238_10014578 3300009551 Bacteria 7946
138 Ga0105238_10369359 3300009551 Bacteria 1425
139 Ga0105249_10489560 3300009553 Bacteria 1273
140 Ga0105028_100847 3300009993 Bacteria 3249
141 Ga0105239_10001983 3300010375 Bacteria 26623
142 Ga0157314_1000468 3300012500 Bacteria 3931
143 Ga0157373_10046930 3300013100 Bacteria 3081
144 Ga0157369_10015237 3300013105 Bacteria 8674
145 Ga0157374_10053781 3300013296 Bacteria 3754
146 Ga0157378_10009687 3300013297 Bacteria 8391
147 Ga0163162_10016128 3300013306 Bacteria 7303
148 Ga0163162_10020360 3300013306 Bacteria 6517
149 Ga0163162_10039934 3300013306 Bacteria 4690
150 Ga0157375_10454496 3300013308 Bacteria 1446
151 Ga0163163_10067289 3300014325 Bacteria 3561
152 Ga0157380_10089361 3300014326 Bacteria 2538
153 Ga0157377_10000010 3300014745 Bacteria 380929
154 Ga0157376_10007312 3300014969 Bacteria 7867
155 Ga0157376_10011511 3300014969 Bacteria 6525
156 Ga0157376_10045440 3300014969 Bacteria 3616
157 Ga0157376_10169016 3300014969 Bacteria 1989
158 Ga0183368_1002 3300015687 Bacteria 1865598
159 Ga0183360_10001 3300015689 Bacteria 3943671
160 Ga0213872_10014935 3300021361 Bacteria 3614
161 Ga0209435_103064 3300025206 Bacteria 1919
162 Ga0209760_100410 3300025207 Bacteria 10464
163 Ga0209784_100086 3300025224 Bacteria 122465
164 Ga0209674_100141 3300025226 Bacteria 108978
165 Ga0209674_100222 3300025226 Bacteria 52576
166 Ga0209672_100007 3300025228 Bacteria 959482
167 Ga0209672_100018 3300025228 Bacteria 432924
168 Ga0209672_100161 3300025228 Bacteria 57457
169 Ga0209563_100014 3300025230 Bacteria 940582
170 Ga0209563_100071 3300025230 Bacteria 232653
171 Ga0207427_100036 3300025231 Bacteria 309540
172 Ga0207427_100108 3300025231 Bacteria 116317
173 Ga0207427_100170 3300025231 Bacteria 72532
174 Ga0207427_107036 3300025231 Bacteria 1357
175 Ga0209437_100076 3300025233 Bacteria 295194
176 Ga0209437_100099 3300025233 Bacteria 229500
177 Ga0209437_100127 3300025233 Bacteria 190741
178 Ga0209437_100246 3300025233 Bacteria 87486
179 Ga0209258_100017 3300025242 Bacteria 590785
180 Ga0209258_100024 3300025242 Bacteria 542096
181 Ga0209258_100035 3300025242 Bacteria 430864
182 Ga0209258_100119 3300025242 Bacteria 183554
183 Ga0209258_100256 3300025242 Bacteria 93548
184 Ga0209258_100933 3300025242 Bacteria 14353
185 Ga0207425_1000416 3300025245 Bacteria 28639
186 Ga0207425_1004193 3300025245 Bacteria 4383
187 Ga0209646_1001311 3300025246 Bacteria 6944
188 Ga0209646_1004694 3300025246 Bacteria 2464
189 Ga0209026_1000056 3300025250 Bacteria 236450
190 Ga0209026_1000307 3300025250 Bacteria 53438
191 Ga0209026_1000647 3300025250 Bacteria 21431
192 Ga0209026_1002403 3300025250 Bacteria 7061
193 Ga0209677_103531 3300025253 Bacteria 4999
194 Ga0209148_1000002 3300025254 Bacteria 2399500
195 Ga0209148_1000009 3300025254 Bacteria 1395625
196 Ga0209148_1000036 3300025254 Bacteria 530505
197 Ga0209148_1000045 3300025254 Bacteria 448076
198 Ga0209148_1000048 3300025254 Bacteria 430913
199 Ga0209148_1000084 3300025254 Bacteria 268147
200 Ga0209759_1000317 3300025256 Bacteria 64752
201 Ga0209759_1000415 3300025256 Bacteria 52363
202 Ga0209759_1001126 3300025256 Bacteria 17187
203 Ga0209129_1000035 3300025258 Bacteria 329303
204 Ga0209129_1006410 3300025258 Bacteria 3806
205 Ga0209233_1000040 3300025261 Bacteria 530395
206 Ga0209233_1000101 3300025261 Bacteria 286063
207 Ga0209233_1000215 3300025261 Bacteria 108939
208 Ga0209565_1000005 3300025263 Bacteria 947317
209 Ga0209455_1000010 3300025272 Bacteria 959482
210 Ga0209455_1000029 3300025272 Bacteria 542096
211 Ga0209455_1000035 3300025272 Bacteria 479071
212 Ga0209455_1000095 3300025272 Bacteria 217487
213 Ga0209455_1000163 3300025272 Bacteria 115575
214 Ga0209455_1001731 3300025272 Bacteria 9289
215 Ga0209455_1008861 3300025272 Bacteria 2692
216 Ga0209673_1000011 3300025273 Bacteria 586604
217 Ga0209673_1005641 3300025273 Bacteria 6247
218 Ga0209673_1005921 3300025273 Bacteria 6036
219 Ga0209673_1012625 3300025273 Bacteria 3391
220 Ga0209130_1001922 3300025284 Bacteria 11675
221 Ga0209130_1008343 3300025284 Bacteria 3069
222 Ga0209675_1000004 3300025291 Bacteria 947166
223 Ga0209675_1000149 3300025291 Bacteria 93109
224 Ga0209675_1005964 3300025291 Bacteria 4987
225 Ga0209675_1014799 3300025291 Bacteria 2354
226 Ga0209676_1000014 3300025292 Bacteria 793514
227 Ga0209676_1000717 3300025292 Bacteria 45710
228 Ga0209676_1005821 3300025292 Bacteria 6305
229 Ga0209676_1017257 3300025292 Bacteria 2563
230 Ga0209676_1025946 3300025292 Bacteria 1870
231 Ga0209025_1000023 3300025294 Bacteria 541307
232 Ga0209025_1000115 3300025294 Bacteria 218871
233 Ga0209025_1001089 3300025294 Bacteria 39299
234 Ga0209025_1002404 3300025294 Bacteria 19970
235 Ga0209025_1006531 3300025294 Bacteria 9007
236 Ga0209025_1046224 3300025294 Bacteria 1793
237 Ga0209564_1000018 3300025295 Bacteria 586913
238 Ga0209564_1000024 3300025295 Bacteria 535041
239 Ga0209564_1001039 3300025295 Bacteria 34008
240 Ga0209564_1012577 3300025295 Bacteria 3676
241 Ga0209758_1000066 3300025297 Bacteria 298620
242 Ga0209758_1000377 3300025297 Bacteria 77592
243 Ga0209758_1001469 3300025297 Bacteria 27659
244 Ga0209758_1009400 3300025297 Bacteria 6083
245 Ga0209758_1017433 3300025297 Bacteria 3577
246 Ga0209758_1024412 3300025297 Bacteria 2695
247 Ga0209050_1000071 3300025298 Bacteria 295478
248 Ga0209050_1000336 3300025298 Bacteria 93100
249 Ga0209050_1000621 3300025298 Bacteria 55657
250 Ga0209050_1006909 3300025298 Bacteria 6567
251 Ga0209256_1000021 3300025299 Bacteria 537097
252 Ga0209256_1006332 3300025299 Bacteria 6319
253 Ga0209256_1013741 3300025299 Bacteria 2980
254 Ga0209256_1021366 3300025299 Bacteria 1989
255 Ga0209051_1003087 3300025303 Bacteria 11232
256 Ga0209051_1014826 3300025303 Bacteria 3619
257 Ga0209051_1068721 3300025303 Bacteria 1077
258 Ga0209257_1000027 3300025304 Bacteria 703541
259 Ga0209257_1000154 3300025304 Bacteria 185887
260 Ga0209257_1000993 3300025304 Bacteria 38475
261 Ga0209257_1001274 3300025304 Bacteria 30856
262 Ga0209257_1011894 3300025304 Bacteria 4111
263 Ga0207656_10040578 3300025321 Bacteria 1974
264 Ga0207655_1000064 3300025728 Bacteria 255782
265 Ga0207713_1000008 3300025735 Bacteria 553952
266 Ga0207713_1002101 3300025735 Bacteria 14859
267 Ga0207642_10111163 3300025899 Bacteria 1395
268 Ga0207680_10054671 3300025903 Bacteria 2403
269 Ga0207647_10063615 3300025904 Bacteria 2244
270 Ga0207647_10082602 3300025904 Bacteria 1924
271 Ga0207684_10120866 3300025910 Bacteria 2246
272 Ga0207654_10000005 3300025911 Bacteria 869492
273 Ga0207695_10001097 3300025913 Bacteria 47167
274 Ga0207695_10001597 3300025913 Bacteria 36803
275 Ga0207695_10009868 3300025913 Bacteria 11732
276 Ga0207695_10058174 3300025913 Bacteria 4013
277 Ga0207671_10000057 3300025914 Bacteria 183729
278 Ga0207671_10001085 3300025914 Bacteria 32918
279 Ga0207671_10006472 3300025914 Bacteria 10427
280 Ga0207681_10201807 3300025923 Bacteria 1527
281 Ga0207709_10237441 3300025935 Bacteria 1324
282 Ga0207669_10049730 3300025937 Bacteria 2501
283 Ga0207704_10076695 3300025938 Bacteria 2142
284 Ga0207667_10000851 3300025949 Bacteria 39363
285 Ga0207667_10002051 3300025949 Bacteria 25262
286 Ga0207667_10011994 3300025949 Bacteria 10033
287 Ga0207712_10230983 3300025961 Bacteria 1485
288 Ga0207668_10232098 3300025972 Bacteria 1488
289 Ga0207640_10000241 3300025981 Bacteria 37027
290 Ga0207640_10002328 3300025981 Bacteria 10213
291 Ga0207703_10026084 3300026035 Bacteria 4599
292 Ga0207703_10063889 3300026035 Bacteria 3020
293 Ga0207639_10360704 3300026041 Bacteria 1300
294 Ga0207678_10000627 3300026067 Bacteria 32287
295 Ga0207678_10060966 3300026067 Bacteria 3244
296 Ga0207678_10239621 3300026067 Bacteria 1554
297 Ga0207708_10090125 3300026075 Bacteria 2364
298 Ga0207702_10000049 3300026078 Bacteria 140303
299 Ga0207702_10001812 3300026078 Bacteria 21025
300 Ga0207641_10031223 3300026088 Bacteria 4418
301 Ga0207648_10000002 3300026089 Bacteria 307909
302 Ga0207648_10014505 3300026089 Bacteria 7277
303 Ga0207648_10040404 3300026089 Bacteria 4099
304 Ga0207648_10059091 3300026089 Bacteria 3344
305 Ga0207674_10004190 3300026116 Bacteria 17403
306 Ga0207675_100002383 3300026118 Bacteria 18615
307 Ga0207683_10027433 3300026121 Bacteria 4921
308 Ga0207683_10059384 3300026121 Bacteria 3359
309 Ga0207683_10250905 3300026121 Bacteria 1615
310 Ga0209281_1000003 3300027111 Bacteria 1260089
311 Ga0268265_10010145 3300028380 Bacteria 6360
312 Ga0268264_10062060 3300028381 Bacteria 3137
313 Ga0268264_10291420 3300028381 Bacteria 1533
314 Ga0307517_10104229 3300028786 Bacteria 2211
315 Ga0307515_10000013 3300028794 Bacteria 568456
316 Ga0307515_10000037 3300028794 Bacteria 331970
317 Ga0307513_10027069 3300031456 Bacteria 6591
318 Ga0307513_10143475 3300031456 Bacteria 2310
319 Ga0307516_10000506 3300031730 Bacteria 51918
320 Ga0307406_10128248 3300031901 Bacteria 1776
321 Ga0373937_0028834 3300036401 Bacteria 5026
322 Ga0373937_0040794 3300036401 Bacteria 4232
323 Ga0373937_0166237 3300036401 Bacteria 2069
324 Ga0395899_0000119 3300037312 Bacteria 127184
325 Ga0395899_0001295 3300037312 Bacteria 21592
326 Ga0395900_0001704 3300037418 Bacteria 25505
327 Ga0395898_0000078 3300037466 Bacteria 244514
328 Ga0395898_0000211 3300037466 Bacteria 149301
329 Ga0395905_0030225 3300037471 Bacteria 5106
330 Ga0436361_0990678 3300039447 Bacteria 20071
331 Ga0439436_0002640 3300041404 Bacteria 5402
332 Ga0439447_000534 3300041407 Bacteria 14050
333 Ga0439465_0000415 3300041413 Bacteria 12465
334 Ga0439465_0028857 3300041413 Bacteria 1761
335 Ga0451789_0440531 3300041443 Bacteria 3933
336 Ga0451797_1585104 3300041453 Bacteria 1102
337 Ga0451795_0847903 3300041456 Bacteria 1164
338 Ga0451800_0112043 3300041459 Bacteria 2203
339 Ga0451851_0477192 3300041507 Bacteria 1809
340 Ga0451855_1865069 3300041511 Unclassified 1678
341 Ga0439431_0013175 3300041997 Bacteria 1905
342 Ga0439443_001609 3300042003 Bacteria 2545
343 Ga0439445_0010546 3300042004 Bacteria 2189
344 Ga0439449_0000038 3300042007 Bacteria 39365
345 Ga0439449_0006086 3300042007 Bacteria 4614
346 Ga0439462_0010038 3300042015 Bacteria 2396
347 Ga0450911_000014 3300042115 Bacteria 115031
348 Ga0450904_000134 3300042139 Bacteria 16552
349 Ga0439459_0000835 3300042438 Bacteria 4297
350 Ga0450893_0004130 3300042532 Bacteria 2310
351 Ga0451577_0149282 3300042876 Bacteria 2103
352 Ga0466969_0001652 3300044656 Bacteria 11944
353 Ga0466969_0018421 3300044656 Bacteria 3637
354 Ga0466969_0030355 3300044656 Bacteria 2755
355 Ga0466972_0000531 3300044658 Bacteria 18737
356 Ga0466972_0023953 3300044658 Bacteria 3032
357 Ga0466982_0000005 3300044672 Bacteria 364340
358 Ga0466966_0006893 3300044684 Bacteria 7527
359 Ga0466966_0008888 3300044684 Bacteria 6652
360 Ga0466966_0021148 3300044684 Bacteria 4272
361 Ga0466961_0001214 3300044693 Bacteria 15843
362 Ga0466961_0001459 3300044693 Bacteria 14689
363 Ga0466961_0004487 3300044693 Bacteria 8749
364 Ga0466961_0005020 3300044693 Bacteria 8320
365 Ga0466961_0012120 3300044693 Bacteria 5512
366 Ga0466961_0047938 3300044693 Bacteria 2730
367 Ga0466961_0091275 3300044693 Bacteria 1923
368 Ga0466963_0098185 3300044694 Bacteria 2002
369 Ga0466964_0032985 3300044706 Bacteria 2060
370 Ga0466971_0006893 3300044719 Bacteria 4938
371 Ga0466971_0009806 3300044719 Bacteria 4181
372 Ga0466971_0112878 3300044719 Bacteria 1255
373 Ga0466968_0025819 3300044735 Bacteria 2407
374 Ga0466970_0003441 3300044765 Bacteria 7707
375 Ga0466970_0057275 3300044765 Bacteria 2083
376 Ga0466957_0003724 3300044842 Bacteria 8426
377 Ga0466959_0000007 3300045049 Bacteria 184664
378 Ga0466959_0016115 3300045049 Bacteria 5454
379 Ga0466959_0043316 3300045049 Bacteria 3317
380 Ga0451576_0062743 3300045051 Bacteria 3873
381 Ga0451576_0123080 3300045051 Bacteria 2701
382 Ga0466958_0001990 3300045836 Bacteria 10053
383 Ga0466958_0023758 3300045836 Bacteria 3602
384 Ga0466958_0055066 3300045836 Bacteria 2413
385 Ga0466958_0058527 3300045836 Bacteria 2343
386 Ga0466967_0200673 3300045976 Bacteria 1889
387 Ga0495638_0061564 3300046460 Bacteria 2319
388 Ga0495638_0062215 3300046460 Bacteria 2304
389 Ga0495620_0028615 3300046515 Bacteria 2589
390 Ga0495632_0005628 3300046519 Bacteria 8242
391 Ga0495654_0000203 3300046530 Bacteria 57142
392 Ga0495622_0005343 3300046557 Bacteria 5962
393 Ga0495656_0011022 3300046615 Bacteria 3306
394 Ga0495668_0000981 3300046616 Bacteria 31164
395 Ga0495625_0015526 3300046660 Bacteria 6030
396 Ga0495625_0086317 3300046660 Bacteria 2177
397 Ga0495649_0001557 3300046694 Bacteria 17209
398 Ga0495589_0000001 3300046794 Bacteria 888100
399 Ga0495636_0016619 3300047318 Bacteria 2940
400 Ga0495636_0025826 3300047318 Bacteria 2386
401 Ga0495672_0114343 3300047320 Bacteria 1444
402 Ga0496102_0106365 3300048905 Bacteria 2611
403 Ga0496104_0001153 3300048907 Bacteria 22633
404 Ga0496104_0269617 3300048907 Bacteria 1615
405 Ga0496105_0000012 3300048908 Bacteria 261713
406 Ga0496109_0154001 3300048912 Bacteria 2153
407 Ga0496112_0152700 3300048915 Bacteria 2277
408 Ga0496113_0037308 3300048916 Bacteria 3565
409 Ga0496115_0000175 3300048918 Bacteria 59610
410 Ga0496115_0000383 3300048918 Bacteria 36509
411 Ga0496115_0029131 3300048918 Bacteria 4334
412 Ga0496116_0000181 3300048919 Bacteria 126124
413 Ga0496116_0001634 3300048919 Bacteria 24666
414 Ga0496116_0027562 3300048919 Bacteria 4135
415 Ga0496116_0068191 3300048919 Bacteria 2267
416 Ga0496118_0006957 3300048921 Bacteria 12221
417 Ga0496118_0045256 3300048921 Bacteria 3438
418 Ga0496119_0000160 3300048922 Bacteria 93515
419 Ga0496119_0001223 3300048922 Bacteria 31981
420 Ga0496119_0001800 3300048922 Bacteria 24933
421 Ga0496119_0003140 3300048922 Bacteria 17396
422 Ga0496119_0039045 3300048922 Bacteria 3055
423 Ga0496120_0000038 3300048923 Bacteria 204168
424 Ga0496120_0000192 3300048923 Bacteria 104239
425 Ga0496120_0000527 3300048923 Bacteria 59033
426 Ga0496120_0000538 3300048923 Bacteria 58168
427 Ga0496120_0004000 3300048923 Bacteria 12812
428 Ga0496121_0000211 3300048924 Bacteria 127602
429 Ga0496121_0010601 3300048924 Bacteria 10355
430 Ga0496121_0021557 3300048924 Bacteria 6305
431 Ga0496121_0036053 3300048924 Bacteria 4416
432 Ga0496122_0000021 3300048925 Bacteria 391363
433 Ga0496123_0000174 3300048926 Bacteria 130310
434 Ga0496123_0074332 3300048926 Bacteria 2104
435 Ga0496124_0000008 3300048927 Bacteria 864372
436 Ga0496124_0003616 3300048927 Bacteria 18775
437 Ga0496124_0023287 3300048927 Bacteria 5656
438 Ga0496125_0000005 3300048928 Bacteria 827598
439 Ga0496125_0004159 3300048928 Bacteria 16877
440 Ga0496125_0104722 3300048928 Bacteria 2071
441 Ga0496126_0014257 3300048929 Bacteria 8042
442 Ga0496126_0083574 3300048929 Bacteria 2818
443 Ga0496126_0167449 3300048929 Bacteria 1874
444 Ga0501032_0071445 3300049569 Bacteria 2313
445 Ga0501033_0006988 3300049570 Bacteria 8813
446 Ga0501034_0010814 3300049571 Bacteria 9480
447 Ga0501037_0044224 3300049573 Bacteria 3270
448 Ga0501038_0152223 3300049574 Bacteria 1885
449 Ga0501039_0111817 3300049575 Bacteria 2135
450 Ga0501043_0000101 3300049579 Bacteria 78983
451 Ga0501043_0011423 3300049579 Bacteria 6953
452 Ga0501043_0016890 3300049579 Bacteria 5721
453 Ga0501043_0080898 3300049579 Bacteria 2552
454 Ga0501046_0000135 3300049580 Bacteria 79084
455 Ga0501046_0035892 3300049580 Bacteria 3992
456 Ga0501046_0065064 3300049580 Bacteria 2845
457 Ga0501047_0000173 3300049581 Bacteria 79071
458 Ga0501047_0045902 3300049581 Bacteria 4223
459 Ga0501048_0000452 3300049582 Bacteria 28741
460 Ga0501070_0044829 3300049586 Bacteria 3679
461 Ga0501073_0128214 3300049589 Bacteria 1759
462 Ga0501080_0271216 3300049742 Bacteria 1544
463 Ga0501035_0114327 3300049822 Bacteria 2363
464 Ga0501035_0179856 3300049822 Bacteria 1822
465 Ga0501044_0096227 3300049823 Bacteria 2982
466 Ga0501045_0158338 3300049824 Bacteria 1685
467 nmdc:mga0k408_18941_c1 3300050493 Bacteria 3844
468 nmdc:mga0k408_19094_c1 3300050493 Bacteria 3828
469 nmdc:mga06z11_60388_c1 3300050494 Bacteria 1973
470 nmdc:mga09592_6399_c1 3300050508 Bacteria 9596
471 nmdc:mga0qj67_283574_c1 3300050509 Bacteria 1342
472 Ga0500578_0000103 3300053086 Bacteria 98876
473 Ga0500628_001540 3300053129 Bacteria 3924
474 Ga0500642_0007843 3300053130 Bacteria 3612
475 Ga0500642_0038147 3300053130 Bacteria 2057
476 Ga0500652_000193 3300053131 Bacteria 23601
477 Ga0500568_0005666 3300053139 Bacteria 6413
478 Ga0500622_0000363 3300053156 Bacteria 43752
479 Ga0500622_0029108 3300053156 Bacteria 2906
480 Ga0466962_0019643 3300061719 Bacteria 3247
481 Ga0466962_0034488 3300061719 Bacteria 2422
482 Ga0466962_0060857 3300061719 Bacteria 1802
483 2508852564 2508501071 Bacteria 5454741
484 2513955221 2513237150 Bacteria 6553639
485 2514043637 2513237165 Bacteria 6771773
486 2538425991 2537561728 Bacteria 5149301
487 2587726152 2585428057 Bacteria 6737412
488 2587736521 2585428058 Bacteria 6853932
489 2588292707 2588253510 Bacteria 6901809
490 2599902074 2599185292 Bacteria 6290804
491 2608670851 2608642108 Bacteria 4104624
492 2643816518 2643221559 Bacteria 4424915
493 2643863364 2643221569 Bacteria 6064337
494 2643882032 2643221573 Bacteria 4784121
495 2643938803 2643221586 Bacteria 4446529
496 2643967285 2643221592 Bacteria 6608788
497 2643977898 2643221593 Bacteria 6296053
498 2643978754 2643221594 Bacteria 5811388
499 2644077454 2643221612 Bacteria 4361984
500 2644140115 2643221625 Bacteria 6512927
501 2644271355 2643221648 Bacteria 6521465
502 2644661693 2643221720 Bacteria 4694283
503 2644694231 2643221727 Bacteria 4415595
504 2644698498 2643221728 Bacteria 4797149
505 2739732187 2739367700 Bacteria 4747630
506 2807177502 2806310673 Bacteria 4801221
507 2809036488 2808606395 Bacteria 6020352
508 2847089445 2847085930 Bacteria 5070450
509 2855199846 2855195626 Bacteria 4927512
510 2857538854 2857537821 Bacteria 5248181
511 2858470221 2858466076 Bacteria 4722413
512 2858953679 2858950400 Bacteria 6783797
513 2871275445 2871272651 Bacteria 5042015
514 2871285498 2871282230 Bacteria 4917173
515 2884413673 2884411467 Bacteria 5246714
516 2888369157 2888366609 Bacteria 5155009
517 2891636507 2891633521 Bacteria 4602265
518 2900055554 2900051742 Bacteria 4985156
519 2928964874 2928963466 Bacteria 5165703
520 2932408071 2932406140 Bacteria 5134491
521 2939578528 2939577877 Bacteria 5132791
522 2941483393
523 2941491930 2941489479 Bacteria 6313767
524 2995952870 2995948881 Bacteria 6358104
525 2998346513 2998344455 Bacteria 4222996
526 640938077 640753048 Bacteria 5495657
527 644747973 644736347 Bacteria 6476522
528 8003017224 8003014200 Bacteria 4059994
529 8004597257 8004592986 Bacteria 5122074
530 8015399084 8015394850 Bacteria 5064660
531 Ga0157369_10059615
532 JGI24740J21852_10038774
533 JGI24739J22299_10000846
534 JGI25156J39149_1002853
535 JGI25162J39368_1000192
536 JGI25162J39368_1000991
537 JGI25162J39368_1001028
538 JGI25157J39369_1000068
539 JGI25157J39369_1000255
540 JGI25157J39369_1000266
541 JGI25157J39369_1002253
542 JGI25163J39215_1000813
543 JGI25164J39214_1000113
544 JGI25164J39214_1000195
545 JGI25164J39214_1000633
546 JGI25152J39213_1002357
547 JGI25151J46595_10000151
548 JGI25151J46595_10001849
549 JGI25151J46595_10007980
550 JGI25151J46595_10014538
551 JGI25165J46597_1000158
552 JGI25165J46597_1000195
553 JGI25165J46597_1001100
554 JGI25153J46596_10003204
555 rootH1_10120498
556 Ga0006562J51391_1175853
557 Ga0006562J51391_1175854
558 Ga0055538_1001608
559 Ga0055539_1000670
560 Ga0055533_1000427
561 Ga0055533_1001144
562 Ga0055525_1000057
563 Ga0055525_1000239
564 Ga0055525_1000623
565 Ga0055527_1000066
566 Ga0055527_1000136
567 Ga0055535_1000058
568 Ga0055535_1000105
569 Ga0055535_1000149
570 Ga0055535_1000427
571 Ga0055535_1000990
572 Ga0055535_1003209
573 Ga0055542_1000085
574 Ga0055542_1000134
575 Ga0055542_1000233
576 Ga0055542_1000315
577 Ga0055542_1000503
578 Ga0055542_1000514
579 Ga0055529_1000107
580 Ga0055529_1000169
581 Ga0055529_1000173
582 Ga0055529_1000240
583 Ga0055529_1000332
584 Ga0055529_1001277
585 Ga0055526_1000206
586 Ga0055526_1001135
587 Ga0055526_1019124
588 Ga0055537_1000539
589 Ga0055524_1000275
590 Ga0055536_1000211
591 Ga0055536_1007272
592 Ga0055536_1023133
593 Ga0055534_1000228
594 Ga0055528_1000199
595 Ga0055530_10000224
596 Ga0055530_10001962
597 Ga0055531_10000094
598 Ga0055531_10007087
599 Ga0055531_10012394
600 Ga0058692_1003913
601 Ga0065165_1001925
602 Ga0065165_1009636
603 Ga0070690_100134719
604 Ga0070666_10075229
605 Ga0070668_100010448
606 Ga0070668_100250545
607 Ga0070669_100051844
608 Ga0070671_100198089
609 Ga0070674_100043378
610 Ga0070674_100223488
611 Ga0070709_10057914
612 Ga0070700_100113947
613 Ga0070663_100000133
614 Ga0070663_100180500
615 Ga0068867_100031254
616 Ga0068867_100096331
617 Ga0070706_100111480
618 Ga0068853_100020997
619 Ga0070686_100174603
620 Ga0070665_100311648
621 Ga0068855_100040028
622 Ga0068855_100071513
623 Ga0068855_100114256
624 Ga0068857_100023422
625 Ga0068854_100000610
626 Ga0068854_100001065
627 Ga0068854_100118049
628 Ga0068856_100000022
629 Ga0068856_100002823
630 Ga0068852_100478548
631 Ga0068859_100093258
632 Ga0068859_100177866
633 Ga0068864_100260638
634 Ga0068866_10175082
635 Ga0068861_100053537
636 Ga0068851_10058604
637 Ga0068863_100037908
638 Ga0068863_100073124
639 Ga0068858_100047619
640 Ga0068858_100069562
641 Ga0068860_100006224
642 Ga0068860_100338693
643 Ga0068862_100004087
644 Ga0068862_100070178
645 Ga0075366_10003503
646 Ga0097621_100045476
647 Ga0097621_100052265
648 Ga0068865_100074141
649 Ga0068865_100087087
650 Ga0097620_100093256
651 Ga0097620_100177862
652 Ga0079104_1001435
653 Ga0105251_10000026
654 Ga0105251_10000359
655 Ga0105244_10000436
656 Ga0105244_10049046
657 Ga0105240_10004361
658 Ga0105240_10015487
659 Ga0105240_10018475
660 Ga0105240_10075562
661 Ga0105243_10002731
662 Ga0105243_10158429
663 Ga0105241_10000002
664 Ga0105237_10000711
665 Ga0105237_10001063
666 Ga0105237_10062798
667 Ga0105238_10014578
668 Ga0105238_10369359
669 Ga0105249_10489560
670 Ga0105028_100847
671 Ga0105239_10001983
672 Ga0157314_1000468
673 Ga0157373_10046930
674 Ga0157369_10015237
675 Ga0157374_10053781
676 Ga0157378_10009687
677 Ga0163162_10016128
678 Ga0163162_10020360
679 Ga0163162_10039934
680 Ga0157375_10454496
681 Ga0163163_10067289
682 Ga0157380_10089361
683 Ga0157377_10000010
684 Ga0157376_10007312
685 Ga0157376_10011511
686 Ga0157376_10045440
687 Ga0157376_10169016
688 Ga0183368_1002
689 Ga0183360_10001
690 Ga0213872_10014935
691 Ga0209435_103064
692 Ga0209760_100410
693 Ga0209784_100086
694 Ga0209674_100141
695 Ga0209674_100222
696 Ga0209672_100007
697 Ga0209672_100018
698 Ga0209672_100161
699 Ga0209563_100014
700 Ga0209563_100071
701 Ga0207427_100036
702 Ga0207427_100108
703 Ga0207427_100170
704 Ga0207427_107036
705 Ga0209437_100076
706 Ga0209437_100099
707 Ga0209437_100127
708 Ga0209437_100246
709 Ga0209258_100017
710 Ga0209258_100024
711 Ga0209258_100035
712 Ga0209258_100119
713 Ga0209258_100256
714 Ga0209258_100933
715 Ga0207425_1000416
716 Ga0207425_1004193
717 Ga0209646_1001311
718 Ga0209646_1004694
719 Ga0209026_1000056
720 Ga0209026_1000307
721 Ga0209026_1000647
722 Ga0209026_1002403
723 Ga0209677_103531
724 Ga0209148_1000002
725 Ga0209148_1000009
726 Ga0209148_1000036
727 Ga0209148_1000045
728 Ga0209148_1000048
729 Ga0209148_1000084
730 Ga0209759_1000317
731 Ga0209759_1000415
732 Ga0209759_1001126
733 Ga0209129_1000035
734 Ga0209129_1006410
735 Ga0209233_1000040
736 Ga0209233_1000101
737 Ga0209233_1000215
738 Ga0209565_1000005
739 Ga0209455_1000010
740 Ga0209455_1000029
741 Ga0209455_1000035
742 Ga0209455_1000095
743 Ga0209455_1000163
744 Ga0209455_1001731
745 Ga0209455_1008861
746 Ga0209673_1000011
747 Ga0209673_1005641
748 Ga0209673_1005921
749 Ga0209673_1012625
750 Ga0209130_1001922
751 Ga0209130_1008343
752 Ga0209675_1000004
753 Ga0209675_1000149
754 Ga0209675_1005964
755 Ga0209675_1014799
756 Ga0209676_1000014
757 Ga0209676_1000717
758 Ga0209676_1005821
759 Ga0209676_1017257
760 Ga0209676_1025946
761 Ga0209025_1000023
762 Ga0209025_1000115
763 Ga0209025_1001089
764 Ga0209025_1002404
765 Ga0209025_1006531
766 Ga0209025_1046224
767 Ga0209564_1000018
768 Ga0209564_1000024
769 Ga0209564_1001039
770 Ga0209564_1012577
771 Ga0209758_1000066
772 Ga0209758_1000377
773 Ga0209758_1001469
774 Ga0209758_1009400
775 Ga0209758_1017433
776 Ga0209758_1024412
777 Ga0209050_1000071
778 Ga0209050_1000336
779 Ga0209050_1000621
780 Ga0209050_1006909
781 Ga0209256_1000021
782 Ga0209256_1006332
783 Ga0209256_1013741
784 Ga0209256_1021366
785 Ga0209051_1003087
786 Ga0209051_1014826
787 Ga0209051_1068721
788 Ga0209257_1000027
789 Ga0209257_1000154
790 Ga0209257_1000993
791 Ga0209257_1001274
792 Ga0209257_1011894
793 Ga0207656_10040578
794 Ga0207655_1000064
795 Ga0207713_1000008
796 Ga0207713_1002101
797 Ga0207642_10111163
798 Ga0207680_10054671
799 Ga0207647_10063615
800 Ga0207647_10082602
801 Ga0207684_10120866
802 Ga0207654_10000005
803 Ga0207695_10001097
804 Ga0207695_10001597
805 Ga0207695_10009868
806 Ga0207695_10058174
807 Ga0207671_10000057
808 Ga0207671_10001085
809 Ga0207671_10006472
810 Ga0207681_10201807
811 Ga0207709_10237441
812 Ga0207669_10049730
813 Ga0207704_10076695
814 Ga0207667_10000851
815 Ga0207667_10002051
816 Ga0207667_10011994
817 Ga0207712_10230983
818 Ga0207668_10232098
819 Ga0207640_10000241
820 Ga0207640_10002328
821 Ga0207703_10026084
822 Ga0207703_10063889
823 Ga0207639_10360704
824 Ga0207678_10000627
825 Ga0207678_10060966
826 Ga0207678_10239621
827 Ga0207708_10090125
828 Ga0207702_10000049
829 Ga0207702_10001812
830 Ga0207641_10031223
831 Ga0207648_10000002
832 Ga0207648_10014505
833 Ga0207648_10040404
834 Ga0207648_10059091
835 Ga0207674_10004190
836 Ga0207675_100002383
837 Ga0207683_10027433
838 Ga0207683_10059384
839 Ga0207683_10250905
840 Ga0209281_1000003
841 Ga0268265_10010145
842 Ga0268264_10062060
843 Ga0268264_10291420
844 Ga0307517_10104229
845 Ga0307515_10000013
846 Ga0307515_10000037
847 Ga0307513_10027069
848 Ga0307513_10143475
849 Ga0307516_10000506
850 Ga0307406_10128248
851 Ga0373937_0028834
852 Ga0373937_0040794
853 Ga0373937_0166237
854 Ga0395899_0000119
855 Ga0395899_0001295
856 Ga0395900_0001704
857 Ga0395898_0000078
858 Ga0395898_0000211
859 Ga0395905_0030225
860 Ga0436361_0990678
861 Ga0439436_0002640
862 Ga0439447_000534
863 Ga0439465_0000415
864 Ga0439465_0028857
865 Ga0451789_0440531
866 Ga0451797_1585104
867 Ga0451795_0847903
868 Ga0451800_0112043
869 Ga0451851_0477192
870 Ga0451855_1865069
871 Ga0439431_0013175
872 Ga0439443_001609
873 Ga0439445_0010546
874 Ga0439449_0000038
875 Ga0439449_0006086
876 Ga0439462_0010038
877 Ga0450911_000014
878 Ga0450904_000134
879 Ga0439459_0000835
880 Ga0450893_0004130
881 Ga0451577_0149282
882 Ga0466969_0001652
883 Ga0466969_0018421
884 Ga0466969_0030355
885 Ga0466972_0000531
886 Ga0466972_0023953
887 Ga0466982_0000005
888 Ga0466966_0006893
889 Ga0466966_0008888
890 Ga0466966_0021148
891 Ga0466961_0001214
892 Ga0466961_0001459
893 Ga0466961_0004487
894 Ga0466961_0005020
895 Ga0466961_0012120
896 Ga0466961_0047938
897 Ga0466961_0091275
898 Ga0466963_0098185
899 Ga0466964_0032985
900 Ga0466971_0006893
901 Ga0466971_0009806
902 Ga0466971_0112878
903 Ga0466968_0025819
904 Ga0466970_0003441
905 Ga0466970_0057275
906 Ga0466957_0003724
907 Ga0466959_0000007
908 Ga0466959_0016115
909 Ga0466959_0043316
910 Ga0451576_0062743
911 Ga0451576_0123080
912 Ga0466958_0001990
913 Ga0466958_0023758
914 Ga0466958_0055066
915 Ga0466958_0058527
916 Ga0466967_0200673
917 Ga0495638_0061564
918 Ga0495638_0062215
919 Ga0495620_0028615
920 Ga0495632_0005628
921 Ga0495654_0000203
922 Ga0495622_0005343
923 Ga0495656_0011022
924 Ga0495668_0000981
925 Ga0495625_0015526
926 Ga0495625_0086317
927 Ga0495649_0001557
928 Ga0495589_0000001
929 Ga0495636_0016619
930 Ga0495636_0025826
931 Ga0495672_0114343
932 Ga0496102_0106365
933 Ga0496104_0001153
934 Ga0496104_0269617
935 Ga0496105_0000012
936 Ga0496109_0154001
937 Ga0496112_0152700
938 Ga0496113_0037308
939 Ga0496115_0000175
940 Ga0496115_0000383
941 Ga0496115_0029131
942 Ga0496116_0000181
943 Ga0496116_0001634
944 Ga0496116_0027562
945 Ga0496116_0068191
946 Ga0496118_0006957
947 Ga0496118_0045256
948 Ga0496119_0000160
949 Ga0496119_0001223
950 Ga0496119_0001800
951 Ga0496119_0003140
952 Ga0496119_0039045
953 Ga0496120_0000038
954 Ga0496120_0000192
955 Ga0496120_0000527
956 Ga0496120_0000538
957 Ga0496120_0004000
958 Ga0496121_0000211
959 Ga0496121_0010601
960 Ga0496121_0021557
961 Ga0496121_0036053
962 Ga0496122_0000021
963 Ga0496123_0000174
964 Ga0496123_0074332
965 Ga0496124_0000008
966 Ga0496124_0003616
967 Ga0496124_0023287
968 Ga0496125_0000005
969 Ga0496125_0004159
970 Ga0496125_0104722
971 Ga0496126_0014257
972 Ga0496126_0083574
973 Ga0496126_0167449
974 Ga0501032_0071445
975 Ga0501033_0006988
976 Ga0501034_0010814
977 Ga0501037_0044224
978 Ga0501038_0152223
979 Ga0501039_0111817
980 Ga0501043_0000101
981 Ga0501043_0011423
982 Ga0501043_0016890
983 Ga0501043_0080898
984 Ga0501046_0000135
985 Ga0501046_0035892
986 Ga0501046_0065064
987 Ga0501047_0000173
988 Ga0501047_0045902
989 Ga0501048_0000452
990 Ga0501070_0044829
991 Ga0501073_0128214
992 Ga0501080_0271216
993 Ga0501035_0114327
994 Ga0501035_0179856
995 Ga0501044_0096227
996 Ga0501045_0158338
997 nmdc:mga0k408_18941_c1
998 nmdc:mga0k408_19094_c1
999 nmdc:mga06z11_60388_c1
1000 nmdc:mga09592_6399_c1
1001 nmdc:mga0qj67_283574_c1
1002 Ga0500578_0000103
1003 Ga0500628_001540
1004 Ga0500642_0007843
1005 Ga0500642_0038147
1006 Ga0500652_000193
1007 Ga0500568_0005666
1008 Ga0500622_0000363
1009 Ga0500622_0029108
1010 Ga0466962_0019643
1011 Ga0466962_0034488
1012 Ga0466962_0060857
1013 2508852564
1014 2513955221
1015 2514043637
1016 2538425991
1017 2587726152
1018 2587736521
1019 2588292707
1020 2599902074
1021 2608670851
1022 2643816518
1023 2643863364
1024 2643882032
1025 2643938803
1026 2643967285
1027 2643977898
1028 2643978754
1029 2644077454
1030 2644140115
1031 2644271355
1032 2644661693
1033 2644694231
1034 2644698498
1035 2739732187
1036 2807177502
1037 2809036488
1038 2847089445
1039 2855199846
1040 2857538854
1041 2858470221
1042 2858953679
1043 2871275445
1044 2871285498
1045 2884413673
1046 2888369157
1047 2891636507
1048 2900055554
1049 2928964874
1050 2932408071
1051 2939578528
1052 2941483393
1053 2941491930
1054 2995952870
1055 2998346513
1056 640938077
1057 644747973
1058 8003017224
1059 8004597257
1060 8015399084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

35

173

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly4.cif.gz_D crystal structure of protein 0.8159 4 309
5i20-assembly2.cif.gz_B crystal structure of protein 0.8019 4 308
5i20-assembly4.cif.gz_D crystal structure of protein 0.798 4 309
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7941 5 307
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7866 5 307
ID Description Score Start End Superfamily
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7238 3 307 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.711 3 308 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.686 3 307 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6783 3 308 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6514 7 307 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A3Q9BQM2-F1-model_v4 DMT family transporter 0.9719 1 309 GO:0016020
AF-A0A1V8ND85-F1-model_v4 EamA domain-containing protein 0.9644 1 311 GO:0016020
AF-A0A6L5JZ25-F1-model_v4 EamA family transporter 0.9531 3 309 GO:0005886
AF-A0A847DXZ3-F1-model_v4 DMT family transporter 0.953 3 309 GO:0005886
AF-A0A3Q9BQM2-F1-model_v4 DMT family transporter 0.9506 1 309 GO:0016020

Map