F459950

General Info

Members Datasets Scaffolds Average Seq Length
530 220 1060 352

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10008625|Ga0163162_100086252
Length 386
Sequence MSYCLSARTTQSLTQVEKQIRMDNLVASNIRQRPIRTLVSVAEVALGVCLIMLFTGLARGMSNDLQRRASNVRAEIIFTRPGSMQLTASTANLSTKYVDSLKQIEGVEEVLPVIRYVSQGGKGFGFEQIEGVEWEPWARVNQIHIESGRTPQADDEIVIDETKVRNNKLSIGNSIKLFSDKSYRIVGIYAPESGARVKMTLAAMQAALESPGRCTYVLIKLRDPNDQVTVAKRIDAQLPGNKIQFTRELFTSLEKSIPYLGIFLRVLVALAAFVSAMVVMLAMYTTITERTREIGILKAMGASRRYIVMIIESEAILISAVGLVAGFILSFVXXFAIYRVYGLFFEYSWGWALTAAAIGILGGALGALYPAWRASNLDAVSALAYE

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
169 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
189 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
192 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
200 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
201 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
211 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.94
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 15.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10008625 3300013306 Bacteria 9932
2 SwRhRL2b_contig_2075714 2162886007 Unclassified 4842
3 JGI24748J21848_1000087 3300002074 Bacteria 27375
4 JGI24034J26672_10000070 3300002239 Bacteria 27386
5 JGI24751J29686_10000056 3300002459 Bacteria 63361
6 JGI25406J46586_10006843 3300003203 Bacteria 5236
7 rootL2_10036561 3300003322 Unclassified 4202
8 Ga0065714_10002185 3300005288 Bacteria 199213
9 Ga0065704_10001059 3300005289 Bacteria 22956
10 Ga0065712_10010148 3300005290 Bacteria 3778
11 Ga0065712_10067734 3300005290 Bacteria 110577
12 Ga0065715_10000261 3300005293 Bacteria 18488
13 Ga0065715_10004679 3300005293 Bacteria 4456
14 Ga0065715_10089344 3300005293 Bacteria 10999
15 Ga0065715_10098648 3300005293 Bacteria 3517
16 Ga0065715_10147742 3300005293 Bacteria 1767
17 Ga0065707_10000832 3300005295 Bacteria 11469
18 Ga0070676_10057442 3300005328 Bacteria 2303
19 Ga0070676_10061969 3300005328 Bacteria 2224
20 Ga0070690_100003475 3300005330 Bacteria 8622
21 Ga0070690_100084764 3300005330 Bacteria 2078
22 Ga0070670_100000889 3300005331 Bacteria 23564
23 Ga0070670_100001590 3300005331 Bacteria 18331
24 Ga0070670_100101979 3300005331 Bacteria 2471
25 Ga0068869_100013603 3300005334 Bacteria 5416
26 Ga0068869_100018839 3300005334 Bacteria 4706
27 Ga0068869_100022347 3300005334 Bacteria 4357
28 Ga0068869_100051213 3300005334 Bacteria 2995
29 Ga0068869_100056937 3300005334 Bacteria 2852
30 Ga0068869_100261795 3300005334 Unclassified 1385
31 Ga0070680_100000437 3300005336 Bacteria 28394
32 Ga0070680_100014267 3300005336 Bacteria 6205
33 Ga0070680_100271545 3300005336 Unclassified 1436
34 Ga0070682_100000096 3300005337 Bacteria 79913
35 Ga0070682_100025027 3300005337 Bacteria 3560
36 Ga0070682_100053853 3300005337 Unclassified 2522
37 Ga0068868_100016049 3300005338 Bacteria 5554
38 Ga0068868_100368861 3300005338 Bacteria 1233
39 Ga0070660_100094971 3300005339 Bacteria 2356
40 Ga0070689_100000856 3300005340 Bacteria 18891
41 Ga0070689_100034666 3300005340 Unclassified 3851
42 Ga0070687_100001466 3300005343 Bacteria 8312
43 Ga0070687_100051527 3300005343 Bacteria 2131
44 Ga0070661_100033578 3300005344 Bacteria 3717
45 Ga0070692_10001958 3300005345 Bacteria 7803
46 Ga0070692_10015449 3300005345 Bacteria 3612
47 Ga0070692_10022406 3300005345 Bacteria 3085
48 Ga0070692_10035896 3300005345 Bacteria 2513
49 Ga0070692_10097041 3300005345 Bacteria 1611
50 Ga0070668_100007396 3300005347 Bacteria 8150
51 Ga0070669_100003351 3300005353 Bacteria 11515
52 Ga0070669_100003717 3300005353 Bacteria 11009
53 Ga0070669_100021822 3300005353 Bacteria 4578
54 Ga0070669_100079482 3300005353 Unclassified 2439
55 Ga0070675_100014027 3300005354 Bacteria 6311
56 Ga0070671_100003022 3300005355 Bacteria 13097
57 Ga0070671_100093535 3300005355 Bacteria 2519
58 Ga0070674_100012898 3300005356 Bacteria 5147
59 Ga0070673_100077760 3300005364 Bacteria 2682
60 Ga0070673_100138873 3300005364 Bacteria 2048
61 Ga0070673_100171176 3300005364 Bacteria 1854
62 Ga0070673_100377606 3300005364 Bacteria 1263
63 Ga0070659_100064696 3300005366 Bacteria 2895
64 Ga0070703_10003392 3300005406 Bacteria 4545
65 Ga0070701_10006666 3300005438 Bacteria 4876
66 Ga0070700_100010201 3300005441 Bacteria 5180
67 Ga0070700_100019912 3300005441 Unclassified 3878
68 Ga0070700_100084427 3300005441 Bacteria 2058
69 Ga0070700_100185655 3300005441 Bacteria 1450
70 Ga0070694_100001863 3300005444 Bacteria 12489
71 Ga0070694_100005617 3300005444 Bacteria 7602
72 Ga0070694_100008307 3300005444 Bacteria 6350
73 Ga0070694_100016626 3300005444 Bacteria 4632
74 Ga0070694_100035716 3300005444 Bacteria 3288
75 Ga0070694_100086236 3300005444 Bacteria 2193
76 Ga0070694_100134806 3300005444 Bacteria 1788
77 Ga0070708_100000406 3300005445 Bacteria 32362
78 Ga0070708_100017908 3300005445 Bacteria 5921
79 Ga0070708_100176149 3300005445 Unclassified 1998
80 Ga0070708_100270187 3300005445 Bacteria 1599
81 Ga0070678_100106151 3300005456 Unclassified 2188
82 Ga0070678_100229216 3300005456 Bacteria 1548
83 Ga0070681_10000158 3300005458 Bacteria 52016
84 Ga0070681_10003321 3300005458 Bacteria 15033
85 Ga0070681_10039133 3300005458 Bacteria 4753
86 Ga0070706_100000398 3300005467 Bacteria 52374
87 Ga0070706_100006309 3300005467 Bacteria 11203
88 Ga0070706_100007238 3300005467 Bacteria 10424
89 Ga0070706_100044395 3300005467 Bacteria 4107
90 Ga0070706_100232096 3300005467 Bacteria 1723
91 Ga0070707_100000299 3300005468 Bacteria 48396
92 Ga0070707_100025071 3300005468 Bacteria 5656
93 Ga0070707_100050238 3300005468 Bacteria 3997
94 Ga0070707_100108730 3300005468 Unclassified 2689
95 Ga0070698_100000709 3300005471 Bacteria 35662
96 Ga0070698_100004914 3300005471 Bacteria 14661
97 Ga0070698_100007013 3300005471 Bacteria 12206
98 Ga0070698_100011622 3300005471 Bacteria 9342
99 Ga0070698_100047039 3300005471 Unclassified 4411
100 Ga0070698_100058813 3300005471 Bacteria 3885
101 Ga0070699_100000218 3300005518 Bacteria 57007
102 Ga0070699_100015384 3300005518 Bacteria 6575
103 Ga0070699_100016295 3300005518 Bacteria 6382
104 Ga0070699_100030991 3300005518 Unclassified 4617
105 Ga0070699_100039830 3300005518 Unclassified 4069
106 Ga0070699_100064665 3300005518 Unclassified 3173
107 Ga0070699_100109963 3300005518 Bacteria 2419
108 Ga0070679_100000173 3300005530 Bacteria 51987
109 Ga0070679_100006044 3300005530 Bacteria 11258
110 Ga0070679_100063048 3300005530 Bacteria 3695
111 Ga0070697_100000740 3300005536 Bacteria 24384
112 Ga0070697_100005751 3300005536 Bacteria 9561
113 Ga0070697_100017334 3300005536 Bacteria 5666
114 Ga0070697_100026726 3300005536 Bacteria 4615
115 Ga0068853_100002224 3300005539 Bacteria 14501
116 Ga0068853_100007814 3300005539 Bacteria 8578
117 Ga0070672_100048132 3300005543 Bacteria 3311
118 Ga0070672_100291418 3300005543 Bacteria 1382
119 Ga0070686_100029532 3300005544 Unclassified 3336
120 Ga0070686_100117788 3300005544 Bacteria 1819
121 Ga0070695_100016065 3300005545 Unclassified 4526
122 Ga0070695_100018164 3300005545 Bacteria 4269
123 Ga0070695_100035095 3300005545 Bacteria 3149
124 Ga0070695_100203958 3300005545 Unclassified 1415
125 Ga0070696_100004340 3300005546 Bacteria 9453
126 Ga0070696_100017410 3300005546 Unclassified 4850
127 Ga0070696_100028121 3300005546 Bacteria 3835
128 Ga0070696_100034555 3300005546 Bacteria 3478
129 Ga0070696_100110014 3300005546 Unclassified 1983
130 Ga0070693_100004279 3300005547 Bacteria 6738
131 Ga0070665_100169223 3300005548 Bacteria 2187
132 Ga0070665_100203575 3300005548 Archaea 1980
133 Ga0070704_100055744 3300005549 Unclassified 2804
134 Ga0070704_100126682 3300005549 Bacteria 1972
135 Ga0070704_100137698 3300005549 Bacteria 1901
136 Ga0070704_100204613 3300005549 Bacteria 1596
137 Ga0068855_100337054 3300005563 Bacteria 1664
138 Ga0070664_100002340 3300005564 Bacteria 15230
139 Ga0070664_100129255 3300005564 Bacteria 2218
140 Ga0068857_100003456 3300005577 Bacteria 13177
141 Ga0068857_100254455 3300005577 Bacteria 1611
142 Ga0068854_100034243 3300005578 Unclassified 3547
143 Ga0068854_100072936 3300005578 Bacteria 2515
144 Ga0068854_100091237 3300005578 Bacteria 2267
145 Ga0068856_100139343 3300005614 Bacteria 2432
146 Ga0070702_100012573 3300005615 Bacteria 4246
147 Ga0070702_100103654 3300005615 Bacteria 1750
148 Ga0070702_100185568 3300005615 Bacteria 1365
149 Ga0068852_100092181 3300005616 Archaea 2713
150 Ga0068852_100122700 3300005616 Bacteria 2382
151 Ga0068859_100000577 3300005617 Bacteria 36570
152 Ga0068859_100042581 3300005617 Bacteria 4561
153 Ga0068859_100044202 3300005617 Unclassified 4476
154 Ga0068859_100049939 3300005617 Bacteria 4202
155 Ga0068859_100062132 3300005617 Unclassified 3764
156 Ga0068859_100081553 3300005617 Unclassified 3277
157 Ga0068859_100081897 3300005617 Bacteria 3270
158 Ga0068859_100097139 3300005617 Unclassified 2999
159 Ga0068859_100097498 3300005617 Unclassified 2993
160 Ga0068859_100134721 3300005617 Bacteria 2542
161 Ga0068859_100464923 3300005617 Unclassified 1361
162 Ga0068864_100009469 3300005618 Bacteria 8038
163 Ga0068864_100012697 3300005618 Bacteria 6962
164 Ga0068864_100069280 3300005618 Bacteria 3067
165 Ga0068864_100097203 3300005618 Bacteria 2607
166 Ga0068861_100004053 3300005719 Bacteria 9812
167 Ga0068861_100006711 3300005719 Bacteria 7865
168 Ga0068861_100034964 3300005719 Bacteria 3719
169 Ga0068861_100062656 3300005719 Unclassified 2857
170 Ga0068851_10008901 3300005834 Bacteria 4656
171 Ga0068870_10065874 3300005840 Bacteria 1961
172 Ga0068863_100029593 3300005841 Bacteria 5228
173 Ga0068863_100058969 3300005841 Unclassified 3632
174 Ga0068858_100000077 3300005842 Bacteria 103156
175 Ga0068858_100088258 3300005842 Bacteria 2885
176 Ga0068860_100005073 3300005843 Bacteria 13393
177 Ga0068860_100024011 3300005843 Bacteria 5894
178 Ga0068860_100031492 3300005843 Bacteria 5098
179 Ga0068860_100059125 3300005843 Bacteria 3645
180 Ga0068860_100111142 3300005843 Bacteria 2620
181 Ga0068860_100392447 3300005843 Bacteria 1372
182 Ga0068862_100020962 3300005844 Bacteria 5461
183 Ga0068862_100022943 3300005844 Bacteria 5226
184 Ga0068862_100140162 3300005844 Unclassified 2145
185 Ga0081539_10000413 3300005985 Bacteria 91117
186 Ga0081539_10001567 3300005985 Bacteria 37931
187 Ga0081539_10004502 3300005985 Bacteria 15324
188 Ga0081539_10080943 3300005985 Bacteria 1707
189 Ga0070716_100027196 3300006173 Bacteria 3070
190 Ga0097621_100000891 3300006237 Bacteria 20934
191 Ga0068871_100003452 3300006358 Bacteria 10863
192 Ga0068871_100041535 3300006358 Unclassified 3688
193 Ga0075428_100014452 3300006844 Bacteria 8768
194 Ga0075428_100172205 3300006844 Unclassified 2346
195 Ga0075428_100360252 3300006844 Bacteria 1560
196 Ga0075430_100221304 3300006846 Unclassified 1570
197 Ga0075433_10009213 3300006852 Bacteria 7890
198 Ga0075433_10018668 3300006852 Bacteria 5767
199 Ga0075433_10041404 3300006852 Bacteria 3991
200 Ga0075433_10063504 3300006852 Bacteria 3235
201 Ga0075433_10112846 3300006852 Bacteria 2411
202 Ga0075433_10128981 3300006852 Bacteria 2247
203 Ga0075434_100000642 3300006871 Bacteria 27039
204 Ga0075434_100021648 3300006871 Bacteria 6252
205 Ga0075434_100040210 3300006871 Bacteria 4631
206 Ga0075434_100042432 3300006871 Unclassified 4509
207 Ga0075434_100451638 3300006871 Bacteria 1306
208 Ga0068865_100015488 3300006881 Bacteria 4864
209 Ga0097620_100000577 3300006931 Bacteria 36570
210 Ga0097620_100042584 3300006931 Bacteria 4561
211 Ga0097620_100044202 3300006931 Unclassified 4476
212 Ga0097620_100049939 3300006931 Bacteria 4202
213 Ga0097620_100062133 3300006931 Unclassified 3764
214 Ga0097620_100081551 3300006931 Unclassified 3277
215 Ga0097620_100081898 3300006931 Bacteria 3270
216 Ga0097620_100097135 3300006931 Unclassified 2999
217 Ga0097620_100097502 3300006931 Unclassified 2993
218 Ga0097620_100134714 3300006931 Bacteria 2542
219 Ga0097620_100464949 3300006931 Unclassified 1361
220 Ga0075435_100099444 3300007076 Bacteria 2409
221 Ga0105240_10043150 3300009093 Bacteria 5741
222 Ga0111539_10000639 3300009094 Bacteria 45247
223 Ga0111539_10344520 3300009094 Unclassified 1735
224 Ga0105245_10015306 3300009098 Bacteria 6684
225 Ga0105247_10000015 3300009101 Bacteria 277224
226 Ga0105247_10003178 3300009101 Bacteria 10827
227 Ga0105247_10115956 3300009101 Bacteria 1729
228 Ga0114129_10015192 3300009147 Bacteria 10959
229 Ga0114129_10018678 3300009147 Bacteria 9872
230 Ga0114129_10024316 3300009147 Bacteria 8583
231 Ga0114129_10034148 3300009147 Bacteria 7184
232 Ga0114129_10043058 3300009147 Bacteria 6354
233 Ga0114129_10162815 3300009147 Bacteria 3046
234 Ga0114129_10247189 3300009147 Bacteria 2396
235 Ga0114129_10344440 3300009147 Bacteria 1976
236 Ga0114129_10388560 3300009147 Bacteria 1841
237 Ga0114129_10613471 3300009147 Unclassified 1408
238 Ga0105243_10008077 3300009148 Bacteria 8077
239 Ga0105243_10076613 3300009148 Unclassified 2718
240 Ga0105243_10084273 3300009148 Bacteria 2603
241 Ga0105243_10128693 3300009148 Bacteria 2145
242 Ga0105243_10261758 3300009148 Bacteria 1549
243 Ga0105241_10128277 3300009174 Unclassified 2050
244 Ga0105242_10053918 3300009176 Unclassified 3285
245 Ga0105242_10096013 3300009176 Bacteria 2503
246 Ga0105242_10197132 3300009176 Unclassified 1786
247 Ga0105248_10003227 3300009177 Bacteria 18083
248 Ga0105248_10047267 3300009177 Unclassified 4826
249 Ga0105248_10070413 3300009177 Bacteria 3928
250 Ga0105248_10322487 3300009177 Bacteria 1740
251 Ga0105248_10460602 3300009177 Bacteria 1433
252 Ga0105237_10027016 3300009545 Bacteria 5861
253 Ga0105237_10092484 3300009545 Bacteria 3014
254 Ga0105238_10003867 3300009551 Bacteria 14874
255 Ga0105238_10026618 3300009551 Bacteria 5897
256 Ga0105249_10000018 3300009553 Bacteria 275907
257 Ga0105249_10022813 3300009553 Bacteria 5611
258 Ga0105249_10083022 3300009553 Bacteria 2982
259 Ga0105249_10352491 3300009553 Bacteria 1491
260 Ga0105249_10442117 3300009553 Bacteria 1338
261 Ga0105249_10498824 3300009553 Bacteria 1262
262 Ga0105239_10012595 3300010375 Bacteria 9410
263 Ga0105239_10153544 3300010375 Bacteria 2570
264 Ga0105239_10184751 3300010375 Bacteria 2333
265 Ga0157373_10001239 3300013100 Bacteria 19501
266 Ga0157373_10037625 3300013100 Unclassified 3469
267 Ga0157374_10071112 3300013296 Bacteria 3280
268 Ga0157378_10029038 3300013297 Bacteria 4882
269 Ga0157378_10034781 3300013297 Bacteria 4456
270 Ga0157378_10049427 3300013297 Bacteria 3742
271 Ga0157378_10152602 3300013297 Bacteria 2153
272 Ga0157378_10167119 3300013297 Unclassified 2061
273 Ga0157378_10203571 3300013297 Archaea 1873
274 Ga0157378_10447081 3300013297 Bacteria 1282
275 Ga0157378_10474928 3300013297 Bacteria 1245
276 Ga0163162_10000001 3300013306 Bacteria 751833
277 Ga0163162_10003565 3300013306 Bacteria 14887
278 Ga0163162_10023098 3300013306 Bacteria 6135
279 Ga0163162_10083121 3300013306 Bacteria 3275
280 Ga0163162_10138060 3300013306 Bacteria 2549
281 Ga0157372_10005077 3300013307 Bacteria 13994
282 Ga0157372_10020033 3300013307 Bacteria 7212
283 Ga0157375_10006324 3300013308 Bacteria 10319
284 Ga0157375_10073146 3300013308 Bacteria 3446
285 Ga0157375_10130490 3300013308 Bacteria 2632
286 Ga0157375_10169363 3300013308 Bacteria 2331
287 Ga0157375_10185824 3300013308 Bacteria 2232
288 Ga0163163_10003127 3300014325 Bacteria 14029
289 Ga0163163_10023181 3300014325 Bacteria 5889
290 Ga0163163_10062256 3300014325 Bacteria 3697
291 Ga0163163_10108408 3300014325 Bacteria 2804
292 Ga0163163_10123578 3300014325 Bacteria 2624
293 Ga0163163_10343303 3300014325 Bacteria 1549
294 Ga0157380_10002344 3300014326 Bacteria 12728
295 Ga0157380_10010831 3300014326 Bacteria 6573
296 Ga0157380_10018218 3300014326 Bacteria 5211
297 Ga0157380_10037433 3300014326 Bacteria 3759
298 Ga0157380_10067159 3300014326 Bacteria 2887
299 Ga0157380_10165558 3300014326 Bacteria 1926
300 Ga0157377_10010866 3300014745 Bacteria 4522
301 Ga0157377_10185810 3300014745 Unclassified 1310
302 Ga0157376_10011777 3300014969 Bacteria 6461
303 Ga0157376_10413266 3300014969 Unclassified 1307
304 Ga0182007_10063208 3300015262 Bacteria 1213
305 Ga0163161_10015451 3300017792 Bacteria 5321
306 Ga0213876_10000137 3300021384 Bacteria 79910
307 Ga0213876_10000360 3300021384 Bacteria 38971
308 Ga0207672_1000466 3300025223 Bacteria 5116
309 Ga0207656_10006132 3300025321 Bacteria 4304
310 Ga0207653_10004947 3300025885 Bacteria 4161
311 Ga0207710_10000004 3300025900 Bacteria 846540
312 Ga0207710_10009506 3300025900 Bacteria 4089
313 Ga0207688_10120624 3300025901 Unclassified 1530
314 Ga0207647_10001140 3300025904 Bacteria 20474
315 Ga0207645_10068299 3300025907 Bacteria 2272
316 Ga0207643_10014163 3300025908 Bacteria 4330
317 Ga0207643_10024790 3300025908 Bacteria 3310
318 Ga0207643_10026809 3300025908 Unclassified 3193
319 Ga0207684_10000358 3300025910 Bacteria 62368
320 Ga0207684_10004065 3300025910 Bacteria 13960
321 Ga0207684_10042679 3300025910 Bacteria 3846
322 Ga0207684_10053424 3300025910 Unclassified 3429
323 Ga0207654_10081026 3300025911 Unclassified 1953
324 Ga0207707_10000072 3300025912 Bacteria 102454
325 Ga0207707_10021249 3300025912 Bacteria 5673
326 Ga0207707_10042856 3300025912 Bacteria 3949
327 Ga0207671_10004857 3300025914 Bacteria 12651
328 Ga0207671_10086908 3300025914 Bacteria 2351
329 Ga0207660_10000584 3300025917 Bacteria 24554
330 Ga0207660_10014523 3300025917 Bacteria 5180
331 Ga0207660_10053098 3300025917 Bacteria 2887
332 Ga0207662_10015604 3300025918 Bacteria 4275
333 Ga0207662_10018192 3300025918 Bacteria 3983
334 Ga0207662_10054476 3300025918 Bacteria 2385
335 Ga0207657_10074270 3300025919 Bacteria 2872
336 Ga0207652_10000083 3300025921 Bacteria 101957
337 Ga0207652_10018490 3300025921 Bacteria 5718
338 Ga0207652_10097205 3300025921 Bacteria 2595
339 Ga0207646_10001326 3300025922 Bacteria 30723
340 Ga0207646_10079095 3300025922 Bacteria 2940
341 Ga0207646_10126019 3300025922 Bacteria 2303
342 Ga0207646_10264578 3300025922 Bacteria 1554
343 Ga0207681_10000423 3300025923 Bacteria 29441
344 Ga0207681_10043004 3300025923 Bacteria 3021
345 Ga0207694_10000399 3300025924 Bacteria 40379
346 Ga0207694_10021242 3300025924 Bacteria 4918
347 Ga0207650_10000001 3300025925 Bacteria 1545726
348 Ga0207650_10000975 3300025925 Bacteria 21528
349 Ga0207650_10074670 3300025925 Bacteria 2557
350 Ga0207644_10001811 3300025931 Bacteria 13881
351 Ga0207644_10102086 3300025931 Bacteria 2156
352 Ga0207644_10132732 3300025931 Unclassified 1909
353 Ga0207644_10262661 3300025931 Bacteria 1381
354 Ga0207690_10004859 3300025932 Bacteria 7926
355 Ga0207706_10037096 3300025933 Unclassified 4328
356 Ga0207709_10001808 3300025935 Bacteria 14284
357 Ga0207709_10071731 3300025935 Bacteria 2200
358 Ga0207670_10000357 3300025936 Bacteria 26785
359 Ga0207670_10170776 3300025936 Unclassified 1630
360 Ga0207665_10019296 3300025939 Bacteria 4481
361 Ga0207691_10011274 3300025940 Bacteria 8576
362 Ga0207711_10018492 3300025941 Bacteria 5795
363 Ga0207711_10144049 3300025941 Bacteria 2146
364 Ga0207689_10001503 3300025942 Bacteria 22272
365 Ga0207689_10005347 3300025942 Bacteria 11498
366 Ga0207689_10017811 3300025942 Bacteria 6002
367 Ga0207689_10065590 3300025942 Bacteria 2986
368 Ga0207689_10111793 3300025942 Bacteria 2246
369 Ga0207689_10140103 3300025942 Unclassified 1992
370 Ga0207689_10217384 3300025942 Bacteria 1579
371 Ga0207679_10003183 3300025945 Bacteria 10127
372 Ga0207679_10229359 3300025945 Bacteria 1567
373 Ga0207651_10050662 3300025960 Bacteria 2821
374 Ga0207651_10299624 3300025960 Unclassified 1336
375 Ga0207712_10000081 3300025961 Bacteria 114043
376 Ga0207712_10005355 3300025961 Bacteria 8102
377 Ga0207712_10017512 3300025961 Bacteria 4654
378 Ga0207712_10186356 3300025961 Bacteria 1634
379 Ga0207712_10243697 3300025961 Bacteria 1449
380 Ga0207668_10004533 3300025972 Bacteria 8172
381 Ga0207640_10015648 3300025981 Bacteria 4396
382 Ga0207640_10222053 3300025981 Bacteria 1447
383 Ga0207658_10040600 3300025986 Archaea 3365
384 Ga0207703_10000043 3300026035 Bacteria 161047
385 Ga0207703_10068777 3300026035 Bacteria 2918
386 Ga0207703_10075757 3300026035 Bacteria 2789
387 Ga0207703_10267250 3300026035 Bacteria 1548
388 Ga0207639_10019323 3300026041 Unclassified 4858
389 Ga0207639_10144830 3300026041 Bacteria 1983
390 Ga0207708_10000108 3300026075 Bacteria 63624
391 Ga0207708_10013808 3300026075 Bacteria 6037
392 Ga0207702_10031754 3300026078 Bacteria 4403
393 Ga0207641_10030292 3300026088 Bacteria 4482
394 Ga0207641_10069075 3300026088 Bacteria 3031
395 Ga0207641_10187612 3300026088 Bacteria 1898
396 Ga0207641_10191139 3300026088 Bacteria 1882
397 Ga0207648_10033879 3300026089 Bacteria 4504
398 Ga0207648_10100807 3300026089 Bacteria 2530
399 Ga0207648_10116567 3300026089 Unclassified 2347
400 Ga0207648_10191376 3300026089 Bacteria 1813
401 Ga0207676_10000852 3300026095 Bacteria 23666
402 Ga0207676_10016501 3300026095 Bacteria 5347
403 Ga0207676_10095759 3300026095 Bacteria 2448
404 Ga0207674_10000077 3300026116 Bacteria 104302
405 Ga0207674_10022367 3300026116 Bacteria 6789
406 Ga0207674_10093811 3300026116 Bacteria 2989
407 Ga0207674_10163360 3300026116 Bacteria 2181
408 Ga0207674_10203077 3300026116 Bacteria 1931
409 Ga0207674_10395821 3300026116 Bacteria 1335
410 Ga0207675_100014186 3300026118 Bacteria 7431
411 Ga0207675_100055672 3300026118 Bacteria 3690
412 Ga0207675_100074774 3300026118 Bacteria 3170
413 Ga0207675_100215682 3300026118 Bacteria 1848
414 Ga0207675_100223100 3300026118 Unclassified 1816
415 Ga0207683_10224539 3300026121 Bacteria 1712
416 Ga0207428_10018657 3300027907 Bacteria 5922
417 Ga0207428_10112190 3300027907 Bacteria 2097
418 Ga0268265_10057515 3300028380 Bacteria 2964
419 Ga0268265_10069517 3300028380 Unclassified 2734
420 Ga0268265_10136922 3300028380 Bacteria 2044
421 Ga0268264_10002589 3300028381 Bacteria 15820
422 Ga0268264_10014083 3300028381 Bacteria 6574
423 Ga0268264_10022855 3300028381 Bacteria 5101
424 Ga0268264_10282310 3300028381 Bacteria 1556
425 Ga0307405_10019776 3300031731 Bacteria 3749
426 Ga0307413_10118257 3300031824 Bacteria 1789
427 Ga0307410_10015251 3300031852 Bacteria 4552
428 Ga0307406_10014912 3300031901 Unclassified 4481
429 Ga0307407_10012183 3300031903 Bacteria 4126
430 Ga0307407_10124596 3300031903 Bacteria 1639
431 Ga0307412_10140583 3300031911 Bacteria 1767
432 Ga0307412_10248238 3300031911 Bacteria 1381
433 Ga0307409_100058652 3300031995 Bacteria 2991
434 Ga0307414_10001198 3300032004 Bacteria 13342
435 Ga0307411_10002441 3300032005 Bacteria 8218
436 Ga0307415_100006772 3300032126 Bacteria 6214
437 Ga0307415_100112327 3300032126 Bacteria 2024
438 Ga0307415_100124703 3300032126 Bacteria 1939
439 Ga0373951_0001961 3300035091 Bacteria 5287
440 Ga0395900_0100203 3300037418 Bacteria 2976
441 Ga0395900_0251628 3300037418 Bacteria 1768
442 Ga0395898_0205998 3300037466 Bacteria 1877
443 Ga0395905_0001486 3300037471 Bacteria 28070
444 Ga0395901_0024217 3300038443 Bacteria 6229
445 Ga0395901_0303823 3300038443 Bacteria 1654
446 Ga0242422_00395 3300038699 Bacteria 2713
447 Ga0242420_005302 3300038996 Bacteria 1992
448 Ga0242420_005434 3300038996 Bacteria 1976
449 Ga0436365_0453322 3300039437 Bacteria 114543
450 Ga0436365_1885657 3300039437 Bacteria 103056
451 Ga0439433_0017769 3300041999 Bacteria 1580
452 Ga0439448_0027236 3300042005 Bacteria 1800
453 Ga0439458_0003236 3300042157 Bacteria 3850
454 Ga0439434_0002455 3300042435 Bacteria 5394
455 Ga0453683_0021633 3300044673 Bacteria 4104
456 Ga0453683_0126573 3300044673 Unclassified 1609
457 Ga0451576_0101922 3300045051 Bacteria 2985
458 Ga0451576_0119832 3300045051 Unclassified 2740
459 Ga0451576_0487224 3300045051 Bacteria 1295
460 Ga0495580_0125669 3300046472 Bacteria 1780
461 Ga0495663_0004000 3300046525 Bacteria 4185
462 Ga0495598_0000032 3300046537 Bacteria 21535
463 Ga0495621_0000371 3300046539 Bacteria 10957
464 Ga0495621_0009548 3300046539 Unclassified 2949
465 Ga0495659_0055671 3300046664 Unclassified 1450
466 Ga0495636_0019105 3300047318 Bacteria 2752
467 Ga0496104_0055466 3300048907 Bacteria 3747
468 Ga0496106_0057949 3300048909 Bacteria 2931
469 Ga0496107_0282625 3300048910 Unclassified 1235
470 Ga0496108_0450762 3300048911 Bacteria 1124
471 Ga0496109_0281634 3300048912 Bacteria 1567
472 Ga0501291_002642 3300049514 Unclassified 2168
473 Ga0501291_006292 3300049514 Bacteria 1580
474 Ga0501295_019277 3300049518 Bacteria 1222
475 Ga0501298_003411 3300049521 Unclassified 2462
476 Ga0501299_004649 3300049522 Bacteria 2066
477 Ga0501303_001278 3300049526 Bacteria 1875
478 Ga0501038_0005530 3300049574 Bacteria 11735
479 Ga0501198_000659 3300049649 Unclassified 4295
480 Ga0501198_006878 3300049649 Bacteria 1628
481 Ga0501202_000146 3300049652 Bacteria 8372
482 Ga0501216_003338 3300049660 Unclassified 2332
483 Ga0501217_000674 3300049661 Bacteria 5817
484 Ga0501223_002826 3300049663 Bacteria 3806
485 Ga0501223_019683 3300049663 Bacteria 1325
486 Ga0501224_000187 3300049664 Bacteria 7024
487 Ga0501224_017601 3300049664 Bacteria 1062
488 Ga0501227_000114 3300049665 Bacteria 13866
489 Ga0501230_011469 3300049667 Unclassified 1405
490 Ga0501233_004282 3300049668 Bacteria 2607
491 Ga0501235_003106 3300049669 Bacteria 3579
492 Ga0501235_022166 3300049669 Unclassified 1412
493 Ga0501243_001527 3300049675 Bacteria 3321
494 Ga0501257_008591 3300049686 Bacteria 2299
495 Ga0501259_014995 3300049688 Bacteria 1319
496 Ga0501221_000764 3300049704 Bacteria 5211
497 Ga0501225_0000554 3300049705 Bacteria 11667
498 Ga0501225_0009197 3300049705 Unclassified 2819
499 Ga0501225_0017597 3300049705 Bacteria 1983
500 Ga0501225_0020040 3300049705 Bacteria 1849
501 Ga0501234_000070 3300049707 Bacteria 12479
502 Ga0501234_002715 3300049707 Unclassified 2785
503 Ga0501283_003000 3300049779 Unclassified 2216
504 Ga0501226_000727 3300049853 Bacteria 4472
505 nmdc:mga05p37_181351_c1 3300050507 Bacteria 2561
506 nmdc:mga05p37_23053_c1 3300050507 Bacteria 7553
507 nmdc:mga05p37_27533_c1 3300050507 Bacteria 6920
508 nmdc:mga05p37_286457_c1 3300050507 Bacteria 1962
509 nmdc:mga05p37_49023_c2 3300050507 Bacteria 4677
510 nmdc:mga0qj67_348363_c1 3300050509 Bacteria 1198
511 nmdc:mga06r32_94586_c1 3300050510 Bacteria 2923
512 nmdc:mga08y16_150564_c1 3300050511 Bacteria 2419
513 nmdc:mga08y16_78653_c1 3300050511 Bacteria 3438
514 nmdc:mga08y16_85332_c1 3300050511 Unclassified 3291
515 nmdc:mga0n895_112998_c1 3300050512 Bacteria 2733
516 nmdc:mga0n895_26588_c1 3300050512 Bacteria 5483
517 nmdc:mga0n895_30790_c1 3300050512 Bacteria 5132
518 nmdc:mga0n895_43489_c1 3300050512 Bacteria 4377
519 nmdc:mga0n895_435109_c1 3300050512 Bacteria 1325
520 nmdc:mga08x19_202851_c1 3300050514 Unclassified 1360
521 nmdc:mga0a205_111455_c1 3300050515 Bacteria 2635
522 nmdc:mga0a205_18492_c1 3300050515 Bacteria 6554
523 nmdc:mga0a205_188719_c1 3300050515 Bacteria 1954
524 nmdc:mga0a205_248267_c1 3300050515 Bacteria 1659
525 nmdc:mga0a205_323417_c1 3300050515 Bacteria 1413
526 nmdc:mga0a205_39258_c1 3300050515 Bacteria 4557
527 nmdc:mga0a205_53586_c1 3300050515 Unclassified 3893
528 nmdc:mga0a205_74019_c1 3300050515 Bacteria 3291
529 Ga0500616_0001243 3300053153 Bacteria 25559
530 Ga0530510_0161453 3300061734 Unclassified 1658
531 Ga0163162_10008625
532 SwRhRL2b_contig_2075714
533 JGI24748J21848_1000087
534 JGI24034J26672_10000070
535 JGI24751J29686_10000056
536 JGI25406J46586_10006843
537 rootL2_10036561
538 Ga0065714_10002185
539 Ga0065704_10001059
540 Ga0065712_10010148
541 Ga0065712_10067734
542 Ga0065715_10000261
543 Ga0065715_10004679
544 Ga0065715_10089344
545 Ga0065715_10098648
546 Ga0065715_10147742
547 Ga0065707_10000832
548 Ga0070676_10057442
549 Ga0070676_10061969
550 Ga0070690_100003475
551 Ga0070690_100084764
552 Ga0070670_100000889
553 Ga0070670_100001590
554 Ga0070670_100101979
555 Ga0068869_100013603
556 Ga0068869_100018839
557 Ga0068869_100022347
558 Ga0068869_100051213
559 Ga0068869_100056937
560 Ga0068869_100261795
561 Ga0070680_100000437
562 Ga0070680_100014267
563 Ga0070680_100271545
564 Ga0070682_100000096
565 Ga0070682_100025027
566 Ga0070682_100053853
567 Ga0068868_100016049
568 Ga0068868_100368861
569 Ga0070660_100094971
570 Ga0070689_100000856
571 Ga0070689_100034666
572 Ga0070687_100001466
573 Ga0070687_100051527
574 Ga0070661_100033578
575 Ga0070692_10001958
576 Ga0070692_10015449
577 Ga0070692_10022406
578 Ga0070692_10035896
579 Ga0070692_10097041
580 Ga0070668_100007396
581 Ga0070669_100003351
582 Ga0070669_100003717
583 Ga0070669_100021822
584 Ga0070669_100079482
585 Ga0070675_100014027
586 Ga0070671_100003022
587 Ga0070671_100093535
588 Ga0070674_100012898
589 Ga0070673_100077760
590 Ga0070673_100138873
591 Ga0070673_100171176
592 Ga0070673_100377606
593 Ga0070659_100064696
594 Ga0070703_10003392
595 Ga0070701_10006666
596 Ga0070700_100010201
597 Ga0070700_100019912
598 Ga0070700_100084427
599 Ga0070700_100185655
600 Ga0070694_100001863
601 Ga0070694_100005617
602 Ga0070694_100008307
603 Ga0070694_100016626
604 Ga0070694_100035716
605 Ga0070694_100086236
606 Ga0070694_100134806
607 Ga0070708_100000406
608 Ga0070708_100017908
609 Ga0070708_100176149
610 Ga0070708_100270187
611 Ga0070678_100106151
612 Ga0070678_100229216
613 Ga0070681_10000158
614 Ga0070681_10003321
615 Ga0070681_10039133
616 Ga0070706_100000398
617 Ga0070706_100006309
618 Ga0070706_100007238
619 Ga0070706_100044395
620 Ga0070706_100232096
621 Ga0070707_100000299
622 Ga0070707_100025071
623 Ga0070707_100050238
624 Ga0070707_100108730
625 Ga0070698_100000709
626 Ga0070698_100004914
627 Ga0070698_100007013
628 Ga0070698_100011622
629 Ga0070698_100047039
630 Ga0070698_100058813
631 Ga0070699_100000218
632 Ga0070699_100015384
633 Ga0070699_100016295
634 Ga0070699_100030991
635 Ga0070699_100039830
636 Ga0070699_100064665
637 Ga0070699_100109963
638 Ga0070679_100000173
639 Ga0070679_100006044
640 Ga0070679_100063048
641 Ga0070697_100000740
642 Ga0070697_100005751
643 Ga0070697_100017334
644 Ga0070697_100026726
645 Ga0068853_100002224
646 Ga0068853_100007814
647 Ga0070672_100048132
648 Ga0070672_100291418
649 Ga0070686_100029532
650 Ga0070686_100117788
651 Ga0070695_100016065
652 Ga0070695_100018164
653 Ga0070695_100035095
654 Ga0070695_100203958
655 Ga0070696_100004340
656 Ga0070696_100017410
657 Ga0070696_100028121
658 Ga0070696_100034555
659 Ga0070696_100110014
660 Ga0070693_100004279
661 Ga0070665_100169223
662 Ga0070665_100203575
663 Ga0070704_100055744
664 Ga0070704_100126682
665 Ga0070704_100137698
666 Ga0070704_100204613
667 Ga0068855_100337054
668 Ga0070664_100002340
669 Ga0070664_100129255
670 Ga0068857_100003456
671 Ga0068857_100254455
672 Ga0068854_100034243
673 Ga0068854_100072936
674 Ga0068854_100091237
675 Ga0068856_100139343
676 Ga0070702_100012573
677 Ga0070702_100103654
678 Ga0070702_100185568
679 Ga0068852_100092181
680 Ga0068852_100122700
681 Ga0068859_100000577
682 Ga0068859_100042581
683 Ga0068859_100044202
684 Ga0068859_100049939
685 Ga0068859_100062132
686 Ga0068859_100081553
687 Ga0068859_100081897
688 Ga0068859_100097139
689 Ga0068859_100097498
690 Ga0068859_100134721
691 Ga0068859_100464923
692 Ga0068864_100009469
693 Ga0068864_100012697
694 Ga0068864_100069280
695 Ga0068864_100097203
696 Ga0068861_100004053
697 Ga0068861_100006711
698 Ga0068861_100034964
699 Ga0068861_100062656
700 Ga0068851_10008901
701 Ga0068870_10065874
702 Ga0068863_100029593
703 Ga0068863_100058969
704 Ga0068858_100000077
705 Ga0068858_100088258
706 Ga0068860_100005073
707 Ga0068860_100024011
708 Ga0068860_100031492
709 Ga0068860_100059125
710 Ga0068860_100111142
711 Ga0068860_100392447
712 Ga0068862_100020962
713 Ga0068862_100022943
714 Ga0068862_100140162
715 Ga0081539_10000413
716 Ga0081539_10001567
717 Ga0081539_10004502
718 Ga0081539_10080943
719 Ga0070716_100027196
720 Ga0097621_100000891
721 Ga0068871_100003452
722 Ga0068871_100041535
723 Ga0075428_100014452
724 Ga0075428_100172205
725 Ga0075428_100360252
726 Ga0075430_100221304
727 Ga0075433_10009213
728 Ga0075433_10018668
729 Ga0075433_10041404
730 Ga0075433_10063504
731 Ga0075433_10112846
732 Ga0075433_10128981
733 Ga0075434_100000642
734 Ga0075434_100021648
735 Ga0075434_100040210
736 Ga0075434_100042432
737 Ga0075434_100451638
738 Ga0068865_100015488
739 Ga0097620_100000577
740 Ga0097620_100042584
741 Ga0097620_100044202
742 Ga0097620_100049939
743 Ga0097620_100062133
744 Ga0097620_100081551
745 Ga0097620_100081898
746 Ga0097620_100097135
747 Ga0097620_100097502
748 Ga0097620_100134714
749 Ga0097620_100464949
750 Ga0075435_100099444
751 Ga0105240_10043150
752 Ga0111539_10000639
753 Ga0111539_10344520
754 Ga0105245_10015306
755 Ga0105247_10000015
756 Ga0105247_10003178
757 Ga0105247_10115956
758 Ga0114129_10015192
759 Ga0114129_10018678
760 Ga0114129_10024316
761 Ga0114129_10034148
762 Ga0114129_10043058
763 Ga0114129_10162815
764 Ga0114129_10247189
765 Ga0114129_10344440
766 Ga0114129_10388560
767 Ga0114129_10613471
768 Ga0105243_10008077
769 Ga0105243_10076613
770 Ga0105243_10084273
771 Ga0105243_10128693
772 Ga0105243_10261758
773 Ga0105241_10128277
774 Ga0105242_10053918
775 Ga0105242_10096013
776 Ga0105242_10197132
777 Ga0105248_10003227
778 Ga0105248_10047267
779 Ga0105248_10070413
780 Ga0105248_10322487
781 Ga0105248_10460602
782 Ga0105237_10027016
783 Ga0105237_10092484
784 Ga0105238_10003867
785 Ga0105238_10026618
786 Ga0105249_10000018
787 Ga0105249_10022813
788 Ga0105249_10083022
789 Ga0105249_10352491
790 Ga0105249_10442117
791 Ga0105249_10498824
792 Ga0105239_10012595
793 Ga0105239_10153544
794 Ga0105239_10184751
795 Ga0157373_10001239
796 Ga0157373_10037625
797 Ga0157374_10071112
798 Ga0157378_10029038
799 Ga0157378_10034781
800 Ga0157378_10049427
801 Ga0157378_10152602
802 Ga0157378_10167119
803 Ga0157378_10203571
804 Ga0157378_10447081
805 Ga0157378_10474928
806 Ga0163162_10000001
807 Ga0163162_10003565
808 Ga0163162_10023098
809 Ga0163162_10083121
810 Ga0163162_10138060
811 Ga0157372_10005077
812 Ga0157372_10020033
813 Ga0157375_10006324
814 Ga0157375_10073146
815 Ga0157375_10130490
816 Ga0157375_10169363
817 Ga0157375_10185824
818 Ga0163163_10003127
819 Ga0163163_10023181
820 Ga0163163_10062256
821 Ga0163163_10108408
822 Ga0163163_10123578
823 Ga0163163_10343303
824 Ga0157380_10002344
825 Ga0157380_10010831
826 Ga0157380_10018218
827 Ga0157380_10037433
828 Ga0157380_10067159
829 Ga0157380_10165558
830 Ga0157377_10010866
831 Ga0157377_10185810
832 Ga0157376_10011777
833 Ga0157376_10413266
834 Ga0182007_10063208
835 Ga0163161_10015451
836 Ga0213876_10000137
837 Ga0213876_10000360
838 Ga0207672_1000466
839 Ga0207656_10006132
840 Ga0207653_10004947
841 Ga0207710_10000004
842 Ga0207710_10009506
843 Ga0207688_10120624
844 Ga0207647_10001140
845 Ga0207645_10068299
846 Ga0207643_10014163
847 Ga0207643_10024790
848 Ga0207643_10026809
849 Ga0207684_10000358
850 Ga0207684_10004065
851 Ga0207684_10042679
852 Ga0207684_10053424
853 Ga0207654_10081026
854 Ga0207707_10000072
855 Ga0207707_10021249
856 Ga0207707_10042856
857 Ga0207671_10004857
858 Ga0207671_10086908
859 Ga0207660_10000584
860 Ga0207660_10014523
861 Ga0207660_10053098
862 Ga0207662_10015604
863 Ga0207662_10018192
864 Ga0207662_10054476
865 Ga0207657_10074270
866 Ga0207652_10000083
867 Ga0207652_10018490
868 Ga0207652_10097205
869 Ga0207646_10001326
870 Ga0207646_10079095
871 Ga0207646_10126019
872 Ga0207646_10264578
873 Ga0207681_10000423
874 Ga0207681_10043004
875 Ga0207694_10000399
876 Ga0207694_10021242
877 Ga0207650_10000001
878 Ga0207650_10000975
879 Ga0207650_10074670
880 Ga0207644_10001811
881 Ga0207644_10102086
882 Ga0207644_10132732
883 Ga0207644_10262661
884 Ga0207690_10004859
885 Ga0207706_10037096
886 Ga0207709_10001808
887 Ga0207709_10071731
888 Ga0207670_10000357
889 Ga0207670_10170776
890 Ga0207665_10019296
891 Ga0207691_10011274
892 Ga0207711_10018492
893 Ga0207711_10144049
894 Ga0207689_10001503
895 Ga0207689_10005347
896 Ga0207689_10017811
897 Ga0207689_10065590
898 Ga0207689_10111793
899 Ga0207689_10140103
900 Ga0207689_10217384
901 Ga0207679_10003183
902 Ga0207679_10229359
903 Ga0207651_10050662
904 Ga0207651_10299624
905 Ga0207712_10000081
906 Ga0207712_10005355
907 Ga0207712_10017512
908 Ga0207712_10186356
909 Ga0207712_10243697
910 Ga0207668_10004533
911 Ga0207640_10015648
912 Ga0207640_10222053
913 Ga0207658_10040600
914 Ga0207703_10000043
915 Ga0207703_10068777
916 Ga0207703_10075757
917 Ga0207703_10267250
918 Ga0207639_10019323
919 Ga0207639_10144830
920 Ga0207708_10000108
921 Ga0207708_10013808
922 Ga0207702_10031754
923 Ga0207641_10030292
924 Ga0207641_10069075
925 Ga0207641_10187612
926 Ga0207641_10191139
927 Ga0207648_10033879
928 Ga0207648_10100807
929 Ga0207648_10116567
930 Ga0207648_10191376
931 Ga0207676_10000852
932 Ga0207676_10016501
933 Ga0207676_10095759
934 Ga0207674_10000077
935 Ga0207674_10022367
936 Ga0207674_10093811
937 Ga0207674_10163360
938 Ga0207674_10203077
939 Ga0207674_10395821
940 Ga0207675_100014186
941 Ga0207675_100055672
942 Ga0207675_100074774
943 Ga0207675_100215682
944 Ga0207675_100223100
945 Ga0207683_10224539
946 Ga0207428_10018657
947 Ga0207428_10112190
948 Ga0268265_10057515
949 Ga0268265_10069517
950 Ga0268265_10136922
951 Ga0268264_10002589
952 Ga0268264_10014083
953 Ga0268264_10022855
954 Ga0268264_10282310
955 Ga0307405_10019776
956 Ga0307413_10118257
957 Ga0307410_10015251
958 Ga0307406_10014912
959 Ga0307407_10012183
960 Ga0307407_10124596
961 Ga0307412_10140583
962 Ga0307412_10248238
963 Ga0307409_100058652
964 Ga0307414_10001198
965 Ga0307411_10002441
966 Ga0307415_100006772
967 Ga0307415_100112327
968 Ga0307415_100124703
969 Ga0373951_0001961
970 Ga0395900_0100203
971 Ga0395900_0251628
972 Ga0395898_0205998
973 Ga0395905_0001486
974 Ga0395901_0024217
975 Ga0395901_0303823
976 Ga0242422_00395
977 Ga0242420_005302
978 Ga0242420_005434
979 Ga0436365_0453322
980 Ga0436365_1885657
981 Ga0439433_0017769
982 Ga0439448_0027236
983 Ga0439458_0003236
984 Ga0439434_0002455
985 Ga0453683_0021633
986 Ga0453683_0126573
987 Ga0451576_0101922
988 Ga0451576_0119832
989 Ga0451576_0487224
990 Ga0495580_0125669
991 Ga0495663_0004000
992 Ga0495598_0000032
993 Ga0495621_0000371
994 Ga0495621_0009548
995 Ga0495659_0055671
996 Ga0495636_0019105
997 Ga0496104_0055466
998 Ga0496106_0057949
999 Ga0496107_0282625
1000 Ga0496108_0450762
1001 Ga0496109_0281634
1002 Ga0501291_002642
1003 Ga0501291_006292
1004 Ga0501295_019277
1005 Ga0501298_003411
1006 Ga0501299_004649
1007 Ga0501303_001278
1008 Ga0501038_0005530
1009 Ga0501198_000659
1010 Ga0501198_006878
1011 Ga0501202_000146
1012 Ga0501216_003338
1013 Ga0501217_000674
1014 Ga0501223_002826
1015 Ga0501223_019683
1016 Ga0501224_000187
1017 Ga0501224_017601
1018 Ga0501227_000114
1019 Ga0501230_011469
1020 Ga0501233_004282
1021 Ga0501235_003106
1022 Ga0501235_022166
1023 Ga0501243_001527
1024 Ga0501257_008591
1025 Ga0501259_014995
1026 Ga0501221_000764
1027 Ga0501225_0000554
1028 Ga0501225_0009197
1029 Ga0501225_0017597
1030 Ga0501225_0020040
1031 Ga0501234_000070
1032 Ga0501234_002715
1033 Ga0501283_003000
1034 Ga0501226_000727
1035 nmdc:mga05p37_181351_c1
1036 nmdc:mga05p37_23053_c1
1037 nmdc:mga05p37_27533_c1
1038 nmdc:mga05p37_286457_c1
1039 nmdc:mga05p37_49023_c2
1040 nmdc:mga0qj67_348363_c1
1041 nmdc:mga06r32_94586_c1
1042 nmdc:mga08y16_150564_c1
1043 nmdc:mga08y16_78653_c1
1044 nmdc:mga08y16_85332_c1
1045 nmdc:mga0n895_112998_c1
1046 nmdc:mga0n895_26588_c1
1047 nmdc:mga0n895_30790_c1
1048 nmdc:mga0n895_43489_c1
1049 nmdc:mga0n895_435109_c1
1050 nmdc:mga08x19_202851_c1
1051 nmdc:mga0a205_111455_c1
1052 nmdc:mga0a205_18492_c1
1053 nmdc:mga0a205_188719_c1
1054 nmdc:mga0a205_248267_c1
1055 nmdc:mga0a205_323417_c1
1056 nmdc:mga0a205_39258_c1
1057 nmdc:mga0a205_53586_c1
1058 nmdc:mga0a205_74019_c1
1059 Ga0500616_0001243
1060 Ga0530510_0161453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

265

379

0.97

PF12704

MacB_PCD

MacB-like periplasmic core domain

37

237

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8838 242 349
8tzj-assembly1.cif.gz_D cryo-em structure of vibrio cholerae ftse/ftsx complex 0.7043 205 345
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.7 43 225
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6846 38 225
3ftj-assembly1.cif.gz_A crystal structure of the periplasmic region of macb from actinobacillus actinomycetemcomitans 0.6829 47 237
ID Description Score Start End Superfamily
af_Q641Z9_62_169_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7354 276 337 1.20.1300.10
2h88C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6837 273 337 1.20.1300.10
2h89C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5687 263 337 1.20.1300.10
af_A0A143ZY25_2_123_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5512 243 339 1.10.1760.20
af_P95210_10_113_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5445 264 335 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A321LCU2-F1-model_v4 ABC transporter permease 0.8876 1 352 GO:0005886
GO:0022857
AF-A0A321LCU2-F1-model_v4 ABC transporter permease 0.8852 1 352 GO:0005886
GO:0022857
AF-A0A2E0UNS3-F1-model_v4 Uncharacterized protein 0.8262 5 339 GO:0005886
AF-A0A419L043-F1-model_v4 FtsX-like permease family protein 0.8218 4 352 GO:0005886
GO:0022857
AF-A0A1V5VGG8-F1-model_v4 Putative ABC transporter permease YknZ 0.8203 1 352 GO:0005886
GO:0022857

Map