F459967

General Info

Members Datasets Scaffolds Average Seq Length
530 273 1060 294

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10094038|Ga0207665_100940384
Length 340
Sequence VQAQYPEHLRREVERYLEAMRFSKEAMTAGLEEAMRYSLLAGGKRIRPVLALATARAIGLPPGELLPLAGAIELIHTYSLIHDDLPAMDDDELRRGQPTCHVKFGEDVAILAGDGLYAEAFRHLLTHQRAAPELLLAAAAELAAATGVNGMVGGQYADVSADTPPGAAALRRLHELKTGRLIGASVQCVLLLAGIADGPATMFFRRFASELGVLFQIVDDILDVTGTEDALGKPRGSDERHGKRTYVSEFGIDRARELAGDSHRMALEALAEAAAEXXXXPLGATRRVGKGETKRWPPPSSPWSDLRTPNPSGPGRRIFPRSSRERTRLSAHSSRSTPAF

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 4.53
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10094038 3300025939 Bacteria 2081
2 JGI24748J21848_1000359 3300002074 Bacteria 5255
3 JGI24034J26672_10000242 3300002239 Bacteria 7228
4 JGI24742J22300_10007271 3300002244 Bacteria 1826
5 JGI25407J50210_10000115 3300003373 Bacteria 11473
6 JGI25407J50210_10006170 3300003373 Bacteria 2975
7 Ga0070658_10176447 3300005327 Bacteria 1797
8 Ga0070683_100107710 3300005329 Bacteria 2628
9 Ga0070683_100383936 3300005329 Bacteria 1338
10 Ga0070683_100504748 3300005329 Bacteria 1155
11 Ga0068869_100339050 3300005334 Bacteria 1223
12 Ga0070680_100006520 3300005336 Bacteria 8875
13 Ga0070682_100000011 3300005337 Bacteria 266253
14 Ga0068868_100138614 3300005338 Bacteria 1995
15 Ga0070691_10000002 3300005341 Bacteria 90686
16 Ga0070691_10002018 3300005341 Bacteria 8953
17 Ga0070691_10095794 3300005341 Bacteria 1469
18 Ga0070692_10003975 3300005345 Bacteria 6104
19 Ga0070668_100001786 3300005347 Bacteria 15635
20 Ga0070668_100004153 3300005347 Bacteria 10726
21 Ga0070669_100206168 3300005353 Bacteria 1549
22 Ga0070674_100001881 3300005356 Bacteria 11399
23 Ga0070659_100000511 3300005366 Bacteria 28511
24 Ga0070659_100044738 3300005366 Bacteria 3467
25 Ga0070659_100236196 3300005366 Bacteria 1511
26 Ga0070667_100025574 3300005367 Bacteria 4908
27 Ga0070714_100000112 3300005435 Bacteria 67775
28 Ga0070714_100006988 3300005435 Bacteria 8752
29 Ga0070714_100015590 3300005435 Bacteria 6114
30 Ga0070714_100131860 3300005435 Bacteria 2234
31 Ga0070713_100144531 3300005436 Bacteria 2110
32 Ga0070710_10000004 3300005437 Bacteria 270399
33 Ga0070701_10117326 3300005438 Bacteria 1495
34 Ga0070711_100046290 3300005439 Bacteria 2963
35 Ga0070711_100079309 3300005439 Bacteria 2335
36 Ga0070711_100405906 3300005439 Bacteria 1107
37 Ga0070705_100013524 3300005440 Bacteria 4177
38 Ga0070705_100440534 3300005440 Bacteria 975
39 Ga0070700_100016636 3300005441 Bacteria 4194
40 Ga0070663_100007717 3300005455 Bacteria 6570
41 Ga0070663_100168373 3300005455 Bacteria 1692
42 Ga0070681_10008103 3300005458 Bacteria 10280
43 Ga0068867_100038031 3300005459 Bacteria 3502
44 Ga0070707_100374822 3300005468 Bacteria 1383
45 Ga0070679_100004961 3300005530 Bacteria 12284
46 Ga0070679_100102093 3300005530 Bacteria 2854
47 Ga0070684_100038935 3300005535 Bacteria 4087
48 Ga0070704_100247658 3300005549 Bacteria 1462
49 Ga0070664_100013012 3300005564 Bacteria 6771
50 Ga0070664_100133952 3300005564 Bacteria 2178
51 Ga0068854_100000113 3300005578 Bacteria 55436
52 Ga0068854_100099415 3300005578 Bacteria 2179
53 Ga0068856_100049110 3300005614 Bacteria 4159
54 Ga0068856_100108324 3300005614 Bacteria 2775
55 Ga0070702_100026749 3300005615 Bacteria 3104
56 Ga0070702_100159641 3300005615 Bacteria 1456
57 Ga0068852_100065971 3300005616 Bacteria 3160
58 Ga0068866_10119726 3300005718 Bacteria 1482
59 Ga0068861_100019001 3300005719 Bacteria 4903
60 Ga0068861_100138922 3300005719 Bacteria 1981
61 Ga0068851_10054356 3300005834 Bacteria 2039
62 Ga0068860_100112001 3300005843 Bacteria 2609
63 Ga0068862_100002034 3300005844 Bacteria 18317
64 Ga0081455_10017937 3300005937 Bacteria 6761
65 Ga0081455_10048913 3300005937 Bacteria 3649
66 Ga0081455_10118599 3300005937 Bacteria 2089
67 Ga0081538_10000143 3300005981 Bacteria 73830
68 Ga0081538_10000621 3300005981 Bacteria 39454
69 Ga0081538_10001370 3300005981 Bacteria 25079
70 Ga0081538_10002815 3300005981 Bacteria 16647
71 Ga0081538_10008799 3300005981 Bacteria 8508
72 Ga0081538_10011511 3300005981 Bacteria 7160
73 Ga0081538_10012442 3300005981 Bacteria 6817
74 Ga0081538_10017737 3300005981 Bacteria 5386
75 Ga0081538_10017998 3300005981 Bacteria 5333
76 Ga0081538_10020034 3300005981 Bacteria 4943
77 Ga0081538_10034807 3300005981 Bacteria 3321
78 Ga0081538_10045466 3300005981 Bacteria 2721
79 Ga0081539_10013226 3300005985 Bacteria 6242
80 Ga0070717_10000001 3300006028 Bacteria 465573
81 Ga0070717_10044817 3300006028 Bacteria 3614
82 Ga0070717_10052820 3300006028 Bacteria 3349
83 Ga0070717_10062770 3300006028 Bacteria 3082
84 Ga0070717_10064372 3300006028 Bacteria 3045
85 Ga0070717_10192972 3300006028 Bacteria 1780
86 Ga0070712_100000022 3300006175 Bacteria 81392
87 Ga0070712_100039185 3300006175 Bacteria 3242
88 Ga0070712_100153885 3300006175 Bacteria 1768
89 Ga0070712_100209839 3300006175 Bacteria 1535
90 Ga0070712_100299770 3300006175 Bacteria 1300
91 Ga0075367_10094777 3300006178 Bacteria 1820
92 Ga0075428_100075486 3300006844 Bacteria 3681
93 Ga0075428_100316636 3300006844 Bacteria 1677
94 Ga0075430_100002402 3300006846 Bacteria 15579
95 Ga0075430_100157477 3300006846 Bacteria 1890
96 Ga0075430_100222660 3300006846 Bacteria 1565
97 Ga0075430_100295506 3300006846 Bacteria 1340
98 Ga0075431_100006364 3300006847 Bacteria 11723
99 Ga0075433_10000002 3300006852 Bacteria 92986
100 Ga0075434_100146149 3300006871 Bacteria 2385
101 Ga0075429_100012966 3300006880 Bacteria 7232
102 Ga0075429_100020471 3300006880 Bacteria 5741
103 Ga0068865_100053911 3300006881 Bacteria 2792
104 Ga0068865_100400819 3300006881 Bacteria 1124
105 Ga0105240_10022224 3300009093 Bacteria 8415
106 Ga0111539_10122527 3300009094 Bacteria 3047
107 Ga0111539_10145486 3300009094 Bacteria 2775
108 Ga0105245_10016370 3300009098 Bacteria 6466
109 Ga0105245_10025138 3300009098 Bacteria 5237
110 Ga0105245_10113121 3300009098 Bacteria 2527
111 Ga0105245_10450093 3300009098 Bacteria 1296
112 Ga0114129_10003484 3300009147 Bacteria 22125
113 Ga0114129_10185003 3300009147 Bacteria 2832
114 Ga0114129_10425024 3300009147 Bacteria 1747
115 Ga0114129_10661760 3300009147 Bacteria 1347
116 Ga0114129_10721999 3300009147 Bacteria 1278
117 Ga0105243_10009996 3300009148 Bacteria 7212
118 Ga0105242_10168189 3300009176 Bacteria 1925
119 Ga0105248_10000020 3300009177 Bacteria 284637
120 Ga0105237_10015588 3300009545 Bacteria 7905
121 Ga0105237_10391128 3300009545 Bacteria 1395
122 Ga0105238_10172024 3300009551 Bacteria 2142
123 Ga0105249_10003965 3300009553 Bacteria 12769
124 Ga0105249_10022075 3300009553 Bacteria 5700
125 Ga0105239_10162205 3300010375 Bacteria 2498
126 Ga0105239_10335205 3300010375 Bacteria 1707
127 Ga0105246_10040592 3300011119 Bacteria 3141
128 Ga0105246_10150446 3300011119 Bacteria 1761
129 Ga0157371_10142792 3300013102 Bacteria 1705
130 Ga0157370_10007260 3300013104 Bacteria 12091
131 Ga0157369_10044580 3300013105 Bacteria 4826
132 Ga0157369_10155501 3300013105 Bacteria 2415
133 Ga0163162_10509855 3300013306 Bacteria 1333
134 Ga0157372_10000060 3300013307 Bacteria 122372
135 Ga0157372_10385596 3300013307 Bacteria 1633
136 Ga0157372_10606878 3300013307 Bacteria 1275
137 Ga0157375_10373334 3300013308 Bacteria 1593
138 Ga0163163_10194553 3300014325 Bacteria 2076
139 Ga0157377_10073069 3300014745 Bacteria 1986
140 Ga0157376_10014568 3300014969 Bacteria 5907
141 Ga0157376_10102789 3300014969 Bacteria 2500
142 Ga0206356_10625664 3300020070 Bacteria 3175
143 Ga0206354_10289258 3300020081 Bacteria 1429
144 Ga0206353_10750617 3300020082 Bacteria 1678
145 Ga0206353_11358559 3300020082 Bacteria 1583
146 Ga0213873_10014599 3300021358 Bacteria 1743
147 Ga0213873_10018783 3300021358 Bacteria 1594
148 Ga0213874_10001577 3300021377 Bacteria 4765
149 Ga0213874_10039317 3300021377 Bacteria 1408
150 Ga0213876_10001623 3300021384 Bacteria 13749
151 Ga0213876_10006022 3300021384 Bacteria 6629
152 Ga0213876_10011780 3300021384 Bacteria 4662
153 Ga0213876_10018565 3300021384 Bacteria 3673
154 Ga0213876_10027503 3300021384 Bacteria 3000
155 Ga0213876_10027860 3300021384 Bacteria 2979
156 Ga0213875_10006603 3300021388 Bacteria 6066
157 Ga0213875_10019322 3300021388 Bacteria 3277
158 Ga0213875_10032152 3300021388 Bacteria 2480
159 Ga0213875_10038991 3300021388 Bacteria 2238
160 Ga0213875_10093214 3300021388 Bacteria 1405
161 Ga0207656_10004378 3300025321 Bacteria 4926
162 Ga0207692_10000002 3300025898 Bacteria 453100
163 Ga0207692_10009787 3300025898 Bacteria 4016
164 Ga0207642_10095115 3300025899 Bacteria 1482
165 Ga0207688_10056491 3300025901 Bacteria 2205
166 Ga0207680_10002629 3300025903 Bacteria 8389
167 Ga0207685_10069960 3300025905 Bacteria 1419
168 Ga0207705_10249514 3300025909 Bacteria 1353
169 Ga0207654_10059365 3300025911 Bacteria 2230
170 Ga0207707_10315026 3300025912 Bacteria 1351
171 Ga0207695_10239568 3300025913 Bacteria 1716
172 Ga0207671_10003524 3300025914 Bacteria 15535
173 Ga0207671_10235584 3300025914 Bacteria 1437
174 Ga0207693_10000165 3300025915 Bacteria 59717
175 Ga0207693_10004443 3300025915 Bacteria 11851
176 Ga0207693_10031991 3300025915 Bacteria 4156
177 Ga0207693_10059960 3300025915 Bacteria 2981
178 Ga0207693_10076697 3300025915 Bacteria 2618
179 Ga0207663_10027996 3300025916 Bacteria 3292
180 Ga0207663_10034676 3300025916 Bacteria 3020
181 Ga0207660_10022038 3300025917 Bacteria 4289
182 Ga0207662_10149851 3300025918 Bacteria 1483
183 Ga0207657_10059817 3300025919 Bacteria 3271
184 Ga0207652_10001804 3300025921 Bacteria 18558
185 Ga0207652_10108534 3300025921 Bacteria 2460
186 Ga0207652_10285428 3300025921 Bacteria 1489
187 Ga0207681_10193254 3300025923 Bacteria 1558
188 Ga0207687_10002485 3300025927 Bacteria 12525
189 Ga0207687_10008580 3300025927 Bacteria 6682
190 Ga0207687_10141927 3300025927 Bacteria 1823
191 Ga0207687_10155770 3300025927 Bacteria 1748
192 Ga0207700_10043574 3300025928 Bacteria 3297
193 Ga0207700_10108701 3300025928 Bacteria 2227
194 Ga0207664_10000004 3300025929 Bacteria 493014
195 Ga0207664_10005022 3300025929 Bacteria 9001
196 Ga0207664_10061452 3300025929 Bacteria 2997
197 Ga0207664_10133557 3300025929 Bacteria 2092
198 Ga0207690_10001122 3300025932 Bacteria 17093
199 Ga0207690_10027795 3300025932 Bacteria 3578
200 Ga0207706_10014703 3300025933 Bacteria 7090
201 Ga0207706_10408954 3300025933 Bacteria 1176
202 Ga0207709_10035466 3300025935 Bacteria 2949
203 Ga0207669_10005502 3300025937 Bacteria 5690
204 Ga0207704_10016818 3300025938 Bacteria 3771
205 Ga0207704_10139404 3300025938 Bacteria 1694
206 Ga0207704_10144224 3300025938 Bacteria 1670
207 Ga0207691_10077066 3300025940 Bacteria 3004
208 Ga0207711_10000006 3300025941 Bacteria 792692
209 Ga0207689_10296541 3300025942 Bacteria 1340
210 Ga0207661_10017776 3300025944 Bacteria 5269
211 Ga0207661_10213264 3300025944 Bacteria 1703
212 Ga0207661_10575911 3300025944 Bacteria 1032
213 Ga0207679_10116806 3300025945 Bacteria 2116
214 Ga0207679_10150802 3300025945 Bacteria 1891
215 Ga0207712_10001656 3300025961 Bacteria 14972
216 Ga0207712_10092758 3300025961 Bacteria 2227
217 Ga0207668_10021825 3300025972 Bacteria 4088
218 Ga0207668_10163556 3300025972 Bacteria 1737
219 Ga0207640_10000401 3300025981 Bacteria 27504
220 Ga0207658_10003331 3300025986 Bacteria 11404
221 Ga0207658_10050178 3300025986 Bacteria 3069
222 Ga0207677_10101978 3300026023 Bacteria 2114
223 Ga0207703_10055738 3300026035 Bacteria 3217
224 Ga0207678_10000556 3300026067 Bacteria 34074
225 Ga0207678_10160605 3300026067 Bacteria 1919
226 Ga0207708_10059236 3300026075 Bacteria 2922
227 Ga0207702_10050786 3300026078 Bacteria 3501
228 Ga0207702_10212446 3300026078 Bacteria 1799
229 Ga0207648_10098293 3300026089 Bacteria 2563
230 Ga0207675_100010342 3300026118 Bacteria 8744
231 Ga0207675_100167277 3300026118 Bacteria 2100
232 Ga0207698_10015593 3300026142 Bacteria 5093
233 Ga0207428_10133084 3300027907 Bacteria 1902
234 Ga0207428_10190657 3300027907 Bacteria 1545
235 Ga0268266_10000160 3300028379 Bacteria 125999
236 Ga0268265_10000985 3300028380 Bacteria 25857
237 Ga0265319_1000111 3300028563 Bacteria 63232
238 Ga0265318_10014853 3300028577 Bacteria 3258
239 Ga0265322_10013945 3300028654 Bacteria 2326
240 Ga0265336_10000005 3300028666 Bacteria 399349
241 Ga0265338_10000001 3300028800 Bacteria 1177449
242 Ga0265338_10007359 3300028800 Bacteria 13699
243 Ga0265324_10033506 3300029957 Bacteria 1792
244 Ga0265340_10000001 3300031247 Bacteria 1647668
245 Ga0265327_10002568 3300031251 Bacteria 18797
246 Ga0265327_10028393 3300031251 Bacteria 3202
247 Ga0307410_10103887 3300031852 Bacteria 2042
248 Ga0307410_10309798 3300031852 Bacteria 1249
249 Ga0307410_10344115 3300031852 Bacteria 1189
250 Ga0307406_10023365 3300031901 Bacteria 3677
251 Ga0307406_10123827 3300031901 Bacteria 1802
252 Ga0307407_10085817 3300031903 Bacteria 1916
253 Ga0307409_100173568 3300031995 Bacteria 1900
254 Ga0307409_100183216 3300031995 Bacteria 1856
255 Ga0307409_100199414 3300031995 Bacteria 1789
256 Ga0307409_100254033 3300031995 Bacteria 1609
257 Ga0307416_100077331 3300032002 Bacteria 2794
258 Ga0307416_100739788 3300032002 Bacteria 1075
259 Ga0307414_10634945 3300032004 Bacteria 961
260 Ga0307411_10052564 3300032005 Bacteria 2664
261 Ga0307411_10460567 3300032005 Bacteria 1066
262 Ga0307415_100006544 3300032126 Bacteria 6298
263 Ga0307415_100016698 3300032126 Bacteria 4382
264 Ga0307415_100103731 3300032126 Bacteria 2093
265 Ga0373939_0055389 3300035114 Bacteria 1245
266 Ga0373953_0144518 3300035117 Bacteria 1018
267 Ga0373956_0094522 3300035119 Bacteria 1382
268 Ga0373935_0133411 3300035692 Bacteria 1671
269 Ga0373937_0006697 3300036401 Bacteria 9941
270 Ga0395900_0098676 3300037418 Bacteria 3001
271 Ga0395898_0010490 3300037466 Bacteria 9686
272 Ga0436364_0315879 3300037853 Bacteria 4376
273 Ga0436364_0651086 3300037853 Bacteria 1913
274 Ga0436364_0848767 3300037853 Bacteria 1411
275 Ga0436364_0988280 3300037853 Bacteria 1831
276 Ga0436364_1092314 3300037853 Bacteria 4133
277 Ga0436364_1132615 3300037853 Bacteria 1723
278 Ga0436364_1141417 3300037853 Bacteria 1235
279 Ga0436364_1396922 3300037853 Bacteria 12005
280 Ga0436364_1497978 3300037853 Bacteria 8386
281 Ga0395901_0151614 3300038443 Bacteria 2436
282 Ga0436365_0096786 3300039437 Bacteria 22201
283 Ga0436365_0163049 3300039437 Bacteria 21631
284 Ga0436365_0178108 3300039437 Bacteria 4405
285 Ga0436365_0383445 3300039437 Bacteria 13228
286 Ga0436365_0769121 3300039437 Bacteria 6262
287 Ga0436365_1099303 3300039437 Bacteria 8307
288 Ga0436365_1299385 3300039437 Bacteria 7931
289 Ga0436365_1335869 3300039437 Bacteria 3340
290 Ga0436365_1431910 3300039437 Bacteria 22184
291 Ga0436365_1880796 3300039437 Bacteria 5914
292 Ga0436365_1933145 3300039437 Bacteria 3583
293 Ga0436363_0326044 3300039450 Bacteria 1422
294 Ga0436363_0431359 3300039450 Bacteria 2681
295 Ga0436363_0712204 3300039450 Bacteria 10061
296 Ga0436363_1081778 3300039450 Bacteria 1722
297 Ga0436363_1324716 3300039450 Bacteria 1906
298 Ga0436363_1581029 3300039450 Bacteria 5619
299 Ga0436363_1644102 3300039450 Bacteria 1859
300 Ga0436362_0135349 3300039453 Bacteria 4236
301 Ga0436362_0553015 3300039453 Bacteria 2215
302 Ga0436362_0891633 3300039453 Bacteria 1620
303 Ga0451837_0043717 3300041494 Bacteria 1555
304 Ga0451853_0473403 3300041512 Bacteria 1001
305 Ga0439463_008741 3300042016 Bacteria 2494
306 Ga0450916_007644 3300042530 Bacteria 1302
307 Ga0466969_0007443 3300044656 Bacteria 5816
308 Ga0466969_0008448 3300044656 Bacteria 5464
309 Ga0466965_0016442 3300044683 Bacteria 3522
310 Ga0466966_0039114 3300044684 Bacteria 3055
311 Ga0466966_0122599 3300044684 Bacteria 1596
312 Ga0466961_0010690 3300044693 Bacteria 5862
313 Ga0466963_0000004 3300044694 Bacteria 102526
314 Ga0466963_0002720 3300044694 Bacteria 9971
315 Ga0466963_0008357 3300044694 Bacteria 6201
316 Ga0466963_0022483 3300044694 Bacteria 3993
317 Ga0466963_0109572 3300044694 Bacteria 1894
318 Ga0466963_0182387 3300044694 Bacteria 1466
319 Ga0466964_0099973 3300044706 Bacteria 1277
320 Ga0466971_0029120 3300044719 Bacteria 2469
321 Ga0466971_0031863 3300044719 Bacteria 2361
322 Ga0466971_0042594 3300044719 Bacteria 2040
323 Ga0466968_0008189 3300044735 Bacteria 3999
324 Ga0466968_0013042 3300044735 Bacteria 3263
325 Ga0466968_0054315 3300044735 Bacteria 1717
326 Ga0466968_0086857 3300044735 Bacteria 1381
327 Ga0466970_0027665 3300044765 Bacteria 2976
328 Ga0466957_0002987 3300044842 Bacteria 9181
329 Ga0466957_0027265 3300044842 Bacteria 3394
330 Ga0466957_0066525 3300044842 Bacteria 2222
331 Ga0466957_0274149 3300044842 Bacteria 1127
332 Ga0466959_0015821 3300045049 Bacteria 5504
333 Ga0466959_0030818 3300045049 Bacteria 3971
334 Ga0466959_0033077 3300045049 Bacteria 3826
335 Ga0466959_0071967 3300045049 Bacteria 2503
336 Ga0466959_0088025 3300045049 Bacteria 2233
337 Ga0466959_0090252 3300045049 Bacteria 2201
338 Ga0466959_0099331 3300045049 Bacteria 2084
339 Ga0466959_0117159 3300045049 Bacteria 1896
340 Ga0466959_0216880 3300045049 Bacteria 1328
341 Ga0466959_0282422 3300045049 Bacteria 1139
342 Ga0466958_0005454 3300045836 Bacteria 6849
343 Ga0466958_0007186 3300045836 Bacteria 6104
344 Ga0466958_0016302 3300045836 Bacteria 4277
345 Ga0466958_0034166 3300045836 Bacteria 3032
346 Ga0466958_0044929 3300045836 Bacteria 2663
347 Ga0466958_0065160 3300045836 Bacteria 2223
348 Ga0466958_0133562 3300045836 Bacteria 1559
349 Ga0466967_0000001 3300045976 Bacteria 229823
350 Ga0466967_0009065 3300045976 Bacteria 7357
351 Ga0466967_0014201 3300045976 Bacteria 6193
352 Ga0466967_0035999 3300045976 Bacteria 4221
353 Ga0466967_0041067 3300045976 Bacteria 3985
354 Ga0466967_0071741 3300045976 Bacteria 3102
355 Ga0466967_0095868 3300045976 Bacteria 2705
356 Ga0466967_0096165 3300045976 Bacteria 2701
357 Ga0466967_0229137 3300045976 Bacteria 1768
358 Ga0495592_0017507 3300046454 Bacteria 5444
359 Ga0495629_0199600 3300046459 Bacteria 1383
360 Ga0495653_0024608 3300046463 Bacteria 4849
361 Ga0495605_0141325 3300046474 Bacteria 1080
362 Ga0495662_0005899 3300046476 Bacteria 6126
363 Ga0495608_0000007 3300046511 Bacteria 313495
364 Ga0495628_0007385 3300046516 Bacteria 9516
365 Ga0495644_0000139 3300046523 Bacteria 35023
366 Ga0495644_0036860 3300046523 Bacteria 1845
367 Ga0495642_0132401 3300046528 Bacteria 1074
368 Ga0495652_0005691 3300046529 Bacteria 11671
369 Ga0495587_0194344 3300046536 Bacteria 1148
370 Ga0495598_0001013 3300046537 Bacteria 5389
371 Ga0495667_0014157 3300046559 Bacteria 5384
372 Ga0495656_0000601 3300046615 Bacteria 11590
373 Ga0495634_0000045 3300046642 Bacteria 99087
374 Ga0495635_0005712 3300046663 Bacteria 8668
375 Ga0495657_0000001 3300046675 Bacteria 445641
376 Ga0495657_0002697 3300046675 Bacteria 14830
377 Ga0495623_0020508 3300046679 Bacteria 4272
378 Ga0495646_0034939 3300046680 Bacteria 3119
379 Ga0495658_0093783 3300046683 Bacteria 1782
380 Ga0495600_0001576 3300046809 Bacteria 12681
381 Ga0495581_0234228 3300047315 Bacteria 1074
382 Ga0495604_0002306 3300047317 Bacteria 15292
383 Ga0495674_0012279 3300047319 Bacteria 8074
384 Ga0495672_0071199 3300047320 Bacteria 1968
385 Ga0495680_0008054 3300047322 Bacteria 9607
386 Ga0495675_0000017 3300047444 Bacteria 123394
387 Ga0495675_0156439 3300047444 Bacteria 1406
388 Ga0495684_0002244 3300047471 Bacteria 15475
389 Ga0495602_0034151 3300048088 Bacteria 4762
390 Ga0496100_0000269 3300048903 Bacteria 26417
391 Ga0496100_0000921 3300048903 Bacteria 14030
392 Ga0496101_0070145 3300048904 Bacteria 2566
393 Ga0496102_0001710 3300048905 Bacteria 19219
394 Ga0496102_0305246 3300048905 Bacteria 1500
395 Ga0496102_0470548 3300048905 Bacteria 1178
396 Ga0496103_0000062 3300048906 Bacteria 129593
397 Ga0496104_0000037 3300048907 Bacteria 178518
398 Ga0496104_0050872 3300048907 Bacteria 3909
399 Ga0496105_0065982 3300048908 Bacteria 2987
400 Ga0496106_0085155 3300048909 Bacteria 2433
401 Ga0496106_0338423 3300048909 Bacteria 1208
402 Ga0496107_0074362 3300048910 Bacteria 2472
403 Ga0496107_0104983 3300048910 Bacteria 2074
404 Ga0496108_0376434 3300048911 Bacteria 1240
405 Ga0496109_0350283 3300048912 Bacteria 1395
406 Ga0496110_0001433 3300048913 Bacteria 17249
407 Ga0496111_0000477 3300048914 Bacteria 20473
408 Ga0496113_0029705 3300048916 Bacteria 3951
409 Ga0496113_0095034 3300048916 Bacteria 2303
410 Ga0496113_0157252 3300048916 Bacteria 1796
411 Ga0496114_0438419 3300048917 Bacteria 1157
412 Ga0496115_0000081 3300048918 Bacteria 88048
413 Ga0496115_0000090 3300048918 Bacteria 85349
414 Ga0496116_0000367 3300048919 Bacteria 69349
415 Ga0496117_0009719 3300048920 Bacteria 8887
416 Ga0496118_0000790 3300048921 Bacteria 50676
417 Ga0496118_0037330 3300048921 Bacteria 3912
418 Ga0496119_0002341 3300048922 Bacteria 20874
419 Ga0496119_0004056 3300048922 Bacteria 14778
420 Ga0496120_0098197 3300048923 Bacteria 1553
421 Ga0496121_0002162 3300048924 Bacteria 30763
422 Ga0496121_0016650 3300048924 Bacteria 7571
423 Ga0496121_0040895 3300048924 Bacteria 4060
424 Ga0496121_0198000 3300048924 Bacteria 1434
425 Ga0496124_0196735 3300048927 Bacteria 1537
426 Ga0496125_0073971 3300048928 Bacteria 2645
427 Ga0496126_0027031 3300048929 Bacteria 5490
428 Ga0496126_0252759 3300048929 Bacteria 1468
429 Ga0501031_0047727 3300049568 Bacteria 2791
430 Ga0501031_0167185 3300049568 Bacteria 1437
431 Ga0501032_0001897 3300049569 Bacteria 16499
432 Ga0501033_0000261 3300049570 Bacteria 50442
433 Ga0501036_0002292 3300049572 Bacteria 14969
434 Ga0501036_0059464 3300049572 Bacteria 3238
435 Ga0501037_0000221 3300049573 Bacteria 49689
436 Ga0501038_0004617 3300049574 Bacteria 12815
437 Ga0501039_0019809 3300049575 Bacteria 5158
438 Ga0501039_0124590 3300049575 Bacteria 2021
439 Ga0501040_0048415 3300049576 Bacteria 2905
440 Ga0501040_0060391 3300049576 Bacteria 2605
441 Ga0501040_0110371 3300049576 Bacteria 1923
442 Ga0501040_0182099 3300049576 Bacteria 1489
443 Ga0501042_0028197 3300049578 Bacteria 3953
444 Ga0501042_0039379 3300049578 Bacteria 3358
445 Ga0501042_0040931 3300049578 Bacteria 3293
446 Ga0501042_0047612 3300049578 Bacteria 3057
447 Ga0501042_0076637 3300049578 Bacteria 2394
448 Ga0501042_0103910 3300049578 Bacteria 2044
449 Ga0501043_0000237 3300049579 Bacteria 49809
450 Ga0501043_0158429 3300049579 Bacteria 1770
451 Ga0501046_0002692 3300049580 Bacteria 16551
452 Ga0501046_0180437 3300049580 Bacteria 1579
453 Ga0501047_0000376 3300049581 Bacteria 50385
454 Ga0501047_0069023 3300049581 Bacteria 3404
455 Ga0501048_0002330 3300049582 Bacteria 14491
456 Ga0501048_0081923 3300049582 Bacteria 2276
457 Ga0501068_0016210 3300049584 Bacteria 4294
458 Ga0501069_0023793 3300049585 Bacteria 3339
459 Ga0501070_0000178 3300049586 Bacteria 59157
460 Ga0501070_0064650 3300049586 Bacteria 3029
461 Ga0501070_0191492 3300049586 Bacteria 1681
462 Ga0501071_0194906 3300049587 Bacteria 1520
463 Ga0501072_0050936 3300049588 Bacteria 3260
464 Ga0501072_0066678 3300049588 Bacteria 2840
465 Ga0501072_0406568 3300049588 Bacteria 1080
466 Ga0501073_0003937 3300049589 Bacteria 11142
467 Ga0501074_0013390 3300049590 Bacteria 5963
468 Ga0501074_0185361 3300049590 Bacteria 1484
469 Ga0501074_0212861 3300049590 Bacteria 1376
470 Ga0501074_0308865 3300049590 Bacteria 1123
471 Ga0501075_0000827 3300049591 Bacteria 19460
472 Ga0501075_0028071 3300049591 Bacteria 4152
473 Ga0501075_0096287 3300049591 Bacteria 2246
474 Ga0501075_0125001 3300049591 Bacteria 1958
475 Ga0501075_0315337 3300049591 Bacteria 1192
476 Ga0501076_0087067 3300049592 Bacteria 2511
477 Ga0501076_0201424 3300049592 Bacteria 1625
478 Ga0501079_0030176 3300049741 Bacteria 4166
479 Ga0501079_0043992 3300049741 Bacteria 3447
480 Ga0501079_0109107 3300049741 Bacteria 2149
481 Ga0501079_0284641 3300049741 Bacteria 1292
482 Ga0501080_0004200 3300049742 Bacteria 12780
483 Ga0501083_0001923 3300049744 Bacteria 14284
484 Ga0501083_0061334 3300049744 Bacteria 2510
485 Ga0501083_0256263 3300049744 Bacteria 1138
486 Ga0501035_0000616 3300049822 Bacteria 39216
487 Ga0501044_0000416 3300049823 Bacteria 52684
488 Ga0501044_0064238 3300049823 Bacteria 3748
489 Ga0501045_0014009 3300049824 Bacteria 5676
490 Ga0501045_0033173 3300049824 Bacteria 3744
491 Ga0501045_0039133 3300049824 Bacteria 3450
492 nmdc:mga0yw44_142049_c1 3300050492 Bacteria 1561
493 nmdc:mga05p37_18077_c1 3300050507 Bacteria 8516
494 nmdc:mga05p37_282481_c1 3300050507 Bacteria 1979
495 nmdc:mga05p37_566109_c1 3300050507 Bacteria 1290
496 nmdc:mga05p37_633226_c1 3300050507 Bacteria 1201
497 nmdc:mga05p37_728268_c1 3300050507 Bacteria 1097
498 nmdc:mga05p37_885153_c1 3300050507 Bacteria 965
499 nmdc:mga09592_12088_c1 3300050508 Bacteria 7025
500 nmdc:mga0qj67_153636_c1 3300050509 Bacteria 1867
501 nmdc:mga0qj67_15849_c1 3300050509 Bacteria 5708
502 nmdc:mga0qj67_281892_c1 3300050509 Bacteria 1347
503 nmdc:mga06r32_109511_c1 3300050510 Bacteria 2716
504 nmdc:mga06r32_53906_c1 3300050510 Bacteria 3855
505 nmdc:mga08y16_34134_c1 3300050511 Bacteria 5344
506 nmdc:mga08y16_76243_c1 3300050511 Bacteria 3495
507 nmdc:mga0a205_13_c1 3300050515 Bacteria 111131
508 nmdc:mga0a205_261888_c1 3300050515 Bacteria 1607
509 Ga0495601_0000706 3300053077 Bacteria 17904
510 Ga0495612_0004277 3300053078 Bacteria 5931
511 Ga0495595_0000002 3300053084 Bacteria 445641
512 Ga0495595_0001620 3300053084 Bacteria 8793
513 Ga0495619_0000053 3300053085 Bacteria 98761
514 Ga0495619_0000081 3300053085 Bacteria 72034
515 Ga0495619_0008086 3300053085 Bacteria 6656
516 Ga0495619_0008132 3300053085 Bacteria 6637
517 Ga0500566_0137014 3300053094 Bacteria 1303
518 Ga0500658_0042596 3300053134 Bacteria 1825
519 Ga0500568_0066254 3300053139 Bacteria 1389
520 Ga0501084_0023860 3300054114 Bacteria 5102
521 Ga0501084_0042650 3300054114 Bacteria 3795
522 Ga0501084_0121578 3300054114 Bacteria 2195
523 Ga0501082_0014662 3300060353 Bacteria 6753
524 Ga0501082_0034176 3300060353 Bacteria 4386
525 Ga0501082_0088988 3300060353 Bacteria 2665
526 Ga0466962_0003074 3300061719 Bacteria 7952
527 Ga0466962_0008409 3300061719 Bacteria 4945
528 Ga0466962_0065469 3300061719 Bacteria 1736
529 Ga0466962_0096567 3300061719 Bacteria 1417
530 Ga0530510_0069308 3300061734 Bacteria 2559
531 Ga0207665_10094038
532 JGI24748J21848_1000359
533 JGI24034J26672_10000242
534 JGI24742J22300_10007271
535 JGI25407J50210_10000115
536 JGI25407J50210_10006170
537 Ga0070658_10176447
538 Ga0070683_100107710
539 Ga0070683_100383936
540 Ga0070683_100504748
541 Ga0068869_100339050
542 Ga0070680_100006520
543 Ga0070682_100000011
544 Ga0068868_100138614
545 Ga0070691_10000002
546 Ga0070691_10002018
547 Ga0070691_10095794
548 Ga0070692_10003975
549 Ga0070668_100001786
550 Ga0070668_100004153
551 Ga0070669_100206168
552 Ga0070674_100001881
553 Ga0070659_100000511
554 Ga0070659_100044738
555 Ga0070659_100236196
556 Ga0070667_100025574
557 Ga0070714_100000112
558 Ga0070714_100006988
559 Ga0070714_100015590
560 Ga0070714_100131860
561 Ga0070713_100144531
562 Ga0070710_10000004
563 Ga0070701_10117326
564 Ga0070711_100046290
565 Ga0070711_100079309
566 Ga0070711_100405906
567 Ga0070705_100013524
568 Ga0070705_100440534
569 Ga0070700_100016636
570 Ga0070663_100007717
571 Ga0070663_100168373
572 Ga0070681_10008103
573 Ga0068867_100038031
574 Ga0070707_100374822
575 Ga0070679_100004961
576 Ga0070679_100102093
577 Ga0070684_100038935
578 Ga0070704_100247658
579 Ga0070664_100013012
580 Ga0070664_100133952
581 Ga0068854_100000113
582 Ga0068854_100099415
583 Ga0068856_100049110
584 Ga0068856_100108324
585 Ga0070702_100026749
586 Ga0070702_100159641
587 Ga0068852_100065971
588 Ga0068866_10119726
589 Ga0068861_100019001
590 Ga0068861_100138922
591 Ga0068851_10054356
592 Ga0068860_100112001
593 Ga0068862_100002034
594 Ga0081455_10017937
595 Ga0081455_10048913
596 Ga0081455_10118599
597 Ga0081538_10000143
598 Ga0081538_10000621
599 Ga0081538_10001370
600 Ga0081538_10002815
601 Ga0081538_10008799
602 Ga0081538_10011511
603 Ga0081538_10012442
604 Ga0081538_10017737
605 Ga0081538_10017998
606 Ga0081538_10020034
607 Ga0081538_10034807
608 Ga0081538_10045466
609 Ga0081539_10013226
610 Ga0070717_10000001
611 Ga0070717_10044817
612 Ga0070717_10052820
613 Ga0070717_10062770
614 Ga0070717_10064372
615 Ga0070717_10192972
616 Ga0070712_100000022
617 Ga0070712_100039185
618 Ga0070712_100153885
619 Ga0070712_100209839
620 Ga0070712_100299770
621 Ga0075367_10094777
622 Ga0075428_100075486
623 Ga0075428_100316636
624 Ga0075430_100002402
625 Ga0075430_100157477
626 Ga0075430_100222660
627 Ga0075430_100295506
628 Ga0075431_100006364
629 Ga0075433_10000002
630 Ga0075434_100146149
631 Ga0075429_100012966
632 Ga0075429_100020471
633 Ga0068865_100053911
634 Ga0068865_100400819
635 Ga0105240_10022224
636 Ga0111539_10122527
637 Ga0111539_10145486
638 Ga0105245_10016370
639 Ga0105245_10025138
640 Ga0105245_10113121
641 Ga0105245_10450093
642 Ga0114129_10003484
643 Ga0114129_10185003
644 Ga0114129_10425024
645 Ga0114129_10661760
646 Ga0114129_10721999
647 Ga0105243_10009996
648 Ga0105242_10168189
649 Ga0105248_10000020
650 Ga0105237_10015588
651 Ga0105237_10391128
652 Ga0105238_10172024
653 Ga0105249_10003965
654 Ga0105249_10022075
655 Ga0105239_10162205
656 Ga0105239_10335205
657 Ga0105246_10040592
658 Ga0105246_10150446
659 Ga0157371_10142792
660 Ga0157370_10007260
661 Ga0157369_10044580
662 Ga0157369_10155501
663 Ga0163162_10509855
664 Ga0157372_10000060
665 Ga0157372_10385596
666 Ga0157372_10606878
667 Ga0157375_10373334
668 Ga0163163_10194553
669 Ga0157377_10073069
670 Ga0157376_10014568
671 Ga0157376_10102789
672 Ga0206356_10625664
673 Ga0206354_10289258
674 Ga0206353_10750617
675 Ga0206353_11358559
676 Ga0213873_10014599
677 Ga0213873_10018783
678 Ga0213874_10001577
679 Ga0213874_10039317
680 Ga0213876_10001623
681 Ga0213876_10006022
682 Ga0213876_10011780
683 Ga0213876_10018565
684 Ga0213876_10027503
685 Ga0213876_10027860
686 Ga0213875_10006603
687 Ga0213875_10019322
688 Ga0213875_10032152
689 Ga0213875_10038991
690 Ga0213875_10093214
691 Ga0207656_10004378
692 Ga0207692_10000002
693 Ga0207692_10009787
694 Ga0207642_10095115
695 Ga0207688_10056491
696 Ga0207680_10002629
697 Ga0207685_10069960
698 Ga0207705_10249514
699 Ga0207654_10059365
700 Ga0207707_10315026
701 Ga0207695_10239568
702 Ga0207671_10003524
703 Ga0207671_10235584
704 Ga0207693_10000165
705 Ga0207693_10004443
706 Ga0207693_10031991
707 Ga0207693_10059960
708 Ga0207693_10076697
709 Ga0207663_10027996
710 Ga0207663_10034676
711 Ga0207660_10022038
712 Ga0207662_10149851
713 Ga0207657_10059817
714 Ga0207652_10001804
715 Ga0207652_10108534
716 Ga0207652_10285428
717 Ga0207681_10193254
718 Ga0207687_10002485
719 Ga0207687_10008580
720 Ga0207687_10141927
721 Ga0207687_10155770
722 Ga0207700_10043574
723 Ga0207700_10108701
724 Ga0207664_10000004
725 Ga0207664_10005022
726 Ga0207664_10061452
727 Ga0207664_10133557
728 Ga0207690_10001122
729 Ga0207690_10027795
730 Ga0207706_10014703
731 Ga0207706_10408954
732 Ga0207709_10035466
733 Ga0207669_10005502
734 Ga0207704_10016818
735 Ga0207704_10139404
736 Ga0207704_10144224
737 Ga0207691_10077066
738 Ga0207711_10000006
739 Ga0207689_10296541
740 Ga0207661_10017776
741 Ga0207661_10213264
742 Ga0207661_10575911
743 Ga0207679_10116806
744 Ga0207679_10150802
745 Ga0207712_10001656
746 Ga0207712_10092758
747 Ga0207668_10021825
748 Ga0207668_10163556
749 Ga0207640_10000401
750 Ga0207658_10003331
751 Ga0207658_10050178
752 Ga0207677_10101978
753 Ga0207703_10055738
754 Ga0207678_10000556
755 Ga0207678_10160605
756 Ga0207708_10059236
757 Ga0207702_10050786
758 Ga0207702_10212446
759 Ga0207648_10098293
760 Ga0207675_100010342
761 Ga0207675_100167277
762 Ga0207698_10015593
763 Ga0207428_10133084
764 Ga0207428_10190657
765 Ga0268266_10000160
766 Ga0268265_10000985
767 Ga0265319_1000111
768 Ga0265318_10014853
769 Ga0265322_10013945
770 Ga0265336_10000005
771 Ga0265338_10000001
772 Ga0265338_10007359
773 Ga0265324_10033506
774 Ga0265340_10000001
775 Ga0265327_10002568
776 Ga0265327_10028393
777 Ga0307410_10103887
778 Ga0307410_10309798
779 Ga0307410_10344115
780 Ga0307406_10023365
781 Ga0307406_10123827
782 Ga0307407_10085817
783 Ga0307409_100173568
784 Ga0307409_100183216
785 Ga0307409_100199414
786 Ga0307409_100254033
787 Ga0307416_100077331
788 Ga0307416_100739788
789 Ga0307414_10634945
790 Ga0307411_10052564
791 Ga0307411_10460567
792 Ga0307415_100006544
793 Ga0307415_100016698
794 Ga0307415_100103731
795 Ga0373939_0055389
796 Ga0373953_0144518
797 Ga0373956_0094522
798 Ga0373935_0133411
799 Ga0373937_0006697
800 Ga0395900_0098676
801 Ga0395898_0010490
802 Ga0436364_0315879
803 Ga0436364_0651086
804 Ga0436364_0848767
805 Ga0436364_0988280
806 Ga0436364_1092314
807 Ga0436364_1132615
808 Ga0436364_1141417
809 Ga0436364_1396922
810 Ga0436364_1497978
811 Ga0395901_0151614
812 Ga0436365_0096786
813 Ga0436365_0163049
814 Ga0436365_0178108
815 Ga0436365_0383445
816 Ga0436365_0769121
817 Ga0436365_1099303
818 Ga0436365_1299385
819 Ga0436365_1335869
820 Ga0436365_1431910
821 Ga0436365_1880796
822 Ga0436365_1933145
823 Ga0436363_0326044
824 Ga0436363_0431359
825 Ga0436363_0712204
826 Ga0436363_1081778
827 Ga0436363_1324716
828 Ga0436363_1581029
829 Ga0436363_1644102
830 Ga0436362_0135349
831 Ga0436362_0553015
832 Ga0436362_0891633
833 Ga0451837_0043717
834 Ga0451853_0473403
835 Ga0439463_008741
836 Ga0450916_007644
837 Ga0466969_0007443
838 Ga0466969_0008448
839 Ga0466965_0016442
840 Ga0466966_0039114
841 Ga0466966_0122599
842 Ga0466961_0010690
843 Ga0466963_0000004
844 Ga0466963_0002720
845 Ga0466963_0008357
846 Ga0466963_0022483
847 Ga0466963_0109572
848 Ga0466963_0182387
849 Ga0466964_0099973
850 Ga0466971_0029120
851 Ga0466971_0031863
852 Ga0466971_0042594
853 Ga0466968_0008189
854 Ga0466968_0013042
855 Ga0466968_0054315
856 Ga0466968_0086857
857 Ga0466970_0027665
858 Ga0466957_0002987
859 Ga0466957_0027265
860 Ga0466957_0066525
861 Ga0466957_0274149
862 Ga0466959_0015821
863 Ga0466959_0030818
864 Ga0466959_0033077
865 Ga0466959_0071967
866 Ga0466959_0088025
867 Ga0466959_0090252
868 Ga0466959_0099331
869 Ga0466959_0117159
870 Ga0466959_0216880
871 Ga0466959_0282422
872 Ga0466958_0005454
873 Ga0466958_0007186
874 Ga0466958_0016302
875 Ga0466958_0034166
876 Ga0466958_0044929
877 Ga0466958_0065160
878 Ga0466958_0133562
879 Ga0466967_0000001
880 Ga0466967_0009065
881 Ga0466967_0014201
882 Ga0466967_0035999
883 Ga0466967_0041067
884 Ga0466967_0071741
885 Ga0466967_0095868
886 Ga0466967_0096165
887 Ga0466967_0229137
888 Ga0495592_0017507
889 Ga0495629_0199600
890 Ga0495653_0024608
891 Ga0495605_0141325
892 Ga0495662_0005899
893 Ga0495608_0000007
894 Ga0495628_0007385
895 Ga0495644_0000139
896 Ga0495644_0036860
897 Ga0495642_0132401
898 Ga0495652_0005691
899 Ga0495587_0194344
900 Ga0495598_0001013
901 Ga0495667_0014157
902 Ga0495656_0000601
903 Ga0495634_0000045
904 Ga0495635_0005712
905 Ga0495657_0000001
906 Ga0495657_0002697
907 Ga0495623_0020508
908 Ga0495646_0034939
909 Ga0495658_0093783
910 Ga0495600_0001576
911 Ga0495581_0234228
912 Ga0495604_0002306
913 Ga0495674_0012279
914 Ga0495672_0071199
915 Ga0495680_0008054
916 Ga0495675_0000017
917 Ga0495675_0156439
918 Ga0495684_0002244
919 Ga0495602_0034151
920 Ga0496100_0000269
921 Ga0496100_0000921
922 Ga0496101_0070145
923 Ga0496102_0001710
924 Ga0496102_0305246
925 Ga0496102_0470548
926 Ga0496103_0000062
927 Ga0496104_0000037
928 Ga0496104_0050872
929 Ga0496105_0065982
930 Ga0496106_0085155
931 Ga0496106_0338423
932 Ga0496107_0074362
933 Ga0496107_0104983
934 Ga0496108_0376434
935 Ga0496109_0350283
936 Ga0496110_0001433
937 Ga0496111_0000477
938 Ga0496113_0029705
939 Ga0496113_0095034
940 Ga0496113_0157252
941 Ga0496114_0438419
942 Ga0496115_0000081
943 Ga0496115_0000090
944 Ga0496116_0000367
945 Ga0496117_0009719
946 Ga0496118_0000790
947 Ga0496118_0037330
948 Ga0496119_0002341
949 Ga0496119_0004056
950 Ga0496120_0098197
951 Ga0496121_0002162
952 Ga0496121_0016650
953 Ga0496121_0040895
954 Ga0496121_0198000
955 Ga0496124_0196735
956 Ga0496125_0073971
957 Ga0496126_0027031
958 Ga0496126_0252759
959 Ga0501031_0047727
960 Ga0501031_0167185
961 Ga0501032_0001897
962 Ga0501033_0000261
963 Ga0501036_0002292
964 Ga0501036_0059464
965 Ga0501037_0000221
966 Ga0501038_0004617
967 Ga0501039_0019809
968 Ga0501039_0124590
969 Ga0501040_0048415
970 Ga0501040_0060391
971 Ga0501040_0110371
972 Ga0501040_0182099
973 Ga0501042_0028197
974 Ga0501042_0039379
975 Ga0501042_0040931
976 Ga0501042_0047612
977 Ga0501042_0076637
978 Ga0501042_0103910
979 Ga0501043_0000237
980 Ga0501043_0158429
981 Ga0501046_0002692
982 Ga0501046_0180437
983 Ga0501047_0000376
984 Ga0501047_0069023
985 Ga0501048_0002330
986 Ga0501048_0081923
987 Ga0501068_0016210
988 Ga0501069_0023793
989 Ga0501070_0000178
990 Ga0501070_0064650
991 Ga0501070_0191492
992 Ga0501071_0194906
993 Ga0501072_0050936
994 Ga0501072_0066678
995 Ga0501072_0406568
996 Ga0501073_0003937
997 Ga0501074_0013390
998 Ga0501074_0185361
999 Ga0501074_0212861
1000 Ga0501074_0308865
1001 Ga0501075_0000827
1002 Ga0501075_0028071
1003 Ga0501075_0096287
1004 Ga0501075_0125001
1005 Ga0501075_0315337
1006 Ga0501076_0087067
1007 Ga0501076_0201424
1008 Ga0501079_0030176
1009 Ga0501079_0043992
1010 Ga0501079_0109107
1011 Ga0501079_0284641
1012 Ga0501080_0004200
1013 Ga0501083_0001923
1014 Ga0501083_0061334
1015 Ga0501083_0256263
1016 Ga0501035_0000616
1017 Ga0501044_0000416
1018 Ga0501044_0064238
1019 Ga0501045_0014009
1020 Ga0501045_0033173
1021 Ga0501045_0039133
1022 nmdc:mga0yw44_142049_c1
1023 nmdc:mga05p37_18077_c1
1024 nmdc:mga05p37_282481_c1
1025 nmdc:mga05p37_566109_c1
1026 nmdc:mga05p37_633226_c1
1027 nmdc:mga05p37_728268_c1
1028 nmdc:mga05p37_885153_c1
1029 nmdc:mga09592_12088_c1
1030 nmdc:mga0qj67_153636_c1
1031 nmdc:mga0qj67_15849_c1
1032 nmdc:mga0qj67_281892_c1
1033 nmdc:mga06r32_109511_c1
1034 nmdc:mga06r32_53906_c1
1035 nmdc:mga08y16_34134_c1
1036 nmdc:mga08y16_76243_c1
1037 nmdc:mga0a205_13_c1
1038 nmdc:mga0a205_261888_c1
1039 Ga0495601_0000706
1040 Ga0495612_0004277
1041 Ga0495595_0000002
1042 Ga0495595_0001620
1043 Ga0495619_0000053
1044 Ga0495619_0000081
1045 Ga0495619_0008086
1046 Ga0495619_0008132
1047 Ga0500566_0137014
1048 Ga0500658_0042596
1049 Ga0500568_0066254
1050 Ga0501084_0023860
1051 Ga0501084_0042650
1052 Ga0501084_0121578
1053 Ga0501082_0014662
1054 Ga0501082_0034176
1055 Ga0501082_0088988
1056 Ga0466962_0003074
1057 Ga0466962_0008409
1058 Ga0466962_0065469
1059 Ga0466962_0096567
1060 Ga0530510_0069308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

28

277

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4llt-assembly1.cif.gz_B crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site 0.8916 5 273
3krf-assembly1.cif.gz_D mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (i) 0.8857 1 273
4lfg-assembly1.cif.gz_B crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, fully liganded complex; 0.8853 5 268
3krf-assembly1.cif.gz_D mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (i) 0.8827 1 273
7my7-assembly2.cif.gz_CCC se-crte n-term his-tag structure 0.8793 5 197
ID Description Score Start End Superfamily
af_A0A0P0V0B7_118_416_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.876 5 273 1.10.600.10
1rqjB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8709 4 273 1.10.600.10
3q1oD00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8692 5 270 1.10.600.10
5h9dB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8685 5 273 1.10.600.10
af_A0A0P0V0B7_118_416_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.8611 5 273 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7S3W5M2-F1-model_v4 Geranylgeranyl pyrophosphate synthase 0.9635 5 121 GO:0004659
GO:0008299
AF-A0A496P6U8-F1-model_v4 Polyprenyl synthetase family protein 0.9543 5 134 GO:0004659
GO:0008299
AF-W1WTB7-F1-model_v4 Polyprenyl synthetase 0.9537 148 273 GO:0004659
GO:0008299
AF-T1A846-F1-model_v4 Geranylgeranyl pyrophosphate synthase 0.9517 148 273 GO:0004659
GO:0008299
AF-A0A7W0RXY8-F1-model_v4 Polyprenyl synthetase family protein 0.9488 1 273 GO:0004659
GO:0005737
GO:0008299

Map