F459987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 233 | 530 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0701893|Ga0436365_0701893_68_319 |
| Length | 83 |
| Sequence | VTTTVWIAPSATSFSCLCEPCLEHARTHGLLFADALMQASVRGSIPSEIELTRRCAAGHEIVLRRVQRPPSLPRHDERQLVLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 69 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 109 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 117 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 119 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 123 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 136 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 137 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 138 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 139 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 150 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 233 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.98 |
| Metatranscriptomes | 3.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.87 |
| Rhizosphere | 90.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10062197 | 3300005327 | Bacteria | 3042 |
| 2 | Ga0070658_10097813 | 3300005327 | Bacteria | 2423 |
| 3 | Ga0070658_10504240 | 3300005327 | Bacteria | 1045 |
| 4 | Ga0070683_100119475 | 3300005329 | Bacteria | 2489 |
| 5 | Ga0070683_100225128 | 3300005329 | Bacteria | 1782 |
| 6 | Ga0070683_100292981 | 3300005329 | Bacteria | 1548 |
| 7 | Ga0070683_100500572 | 3300005329 | Bacteria | 1161 |
| 8 | Ga0070683_101446541 | 3300005329 | Bacteria | 661 |
| 9 | Ga0070683_101566247 | 3300005329 | Bacteria | 633 |
| 10 | Ga0070680_100153110 | 3300005336 | Bacteria | 1936 |
| 11 | Ga0070680_100300768 | 3300005336 | Bacteria | 1361 |
| 12 | Ga0070680_100852557 | 3300005336 | Bacteria | 785 |
| 13 | Ga0070680_100886019 | 3300005336 | Bacteria | 770 |
| 14 | Ga0070682_100206142 | 3300005337 | Bacteria | 1390 |
| 15 | Ga0070682_101359676 | 3300005337 | Bacteria | 606 |
| 16 | Ga0068868_100591880 | 3300005338 | Bacteria | 982 |
| 17 | Ga0070660_100035792 | 3300005339 | Bacteria | 3759 |
| 18 | Ga0070660_100294433 | 3300005339 | Bacteria | 1329 |
| 19 | Ga0070660_100295845 | 3300005339 | Bacteria | 1326 |
| 20 | Ga0070660_100973497 | 3300005339 | Bacteria | 716 |
| 21 | Ga0070660_101274368 | 3300005339 | Bacteria | 623 |
| 22 | Ga0070660_101555829 | 3300005339 | Bacteria | 562 |
| 23 | Ga0070691_10821502 | 3300005341 | Bacteria | 568 |
| 24 | Ga0070661_100024555 | 3300005344 | Bacteria | 4323 |
| 25 | Ga0070661_100060619 | 3300005344 | Bacteria | 2776 |
| 26 | Ga0070661_100604824 | 3300005344 | Bacteria | 887 |
| 27 | Ga0070661_100943074 | 3300005344 | Bacteria | 714 |
| 28 | Ga0070661_101516816 | 3300005344 | Bacteria | 565 |
| 29 | Ga0070661_101733287 | 3300005344 | Bacteria | 529 |
| 30 | Ga0070659_100743076 | 3300005366 | Bacteria | 850 |
| 31 | Ga0070709_10296964 | 3300005434 | Bacteria | 1179 |
| 32 | Ga0070709_10315465 | 3300005434 | Bacteria | 1146 |
| 33 | Ga0070714_100215125 | 3300005435 | Bacteria | 1764 |
| 34 | Ga0070714_100693894 | 3300005435 | Unclassified | 982 |
| 35 | Ga0070713_100200048 | 3300005436 | Bacteria | 1804 |
| 36 | Ga0070710_10140270 | 3300005437 | Bacteria | 1482 |
| 37 | Ga0070710_10227836 | 3300005437 | Bacteria | 1189 |
| 38 | Ga0070710_10687766 | 3300005437 | Bacteria | 721 |
| 39 | Ga0070711_100013583 | 3300005439 | Bacteria | 5116 |
| 40 | Ga0070711_100889194 | 3300005439 | Bacteria | 760 |
| 41 | Ga0070711_101065228 | 3300005439 | Bacteria | 696 |
| 42 | Ga0070705_100652455 | 3300005440 | Bacteria | 821 |
| 43 | Ga0070708_100804374 | 3300005445 | Bacteria | 884 |
| 44 | Ga0070708_101193281 | 3300005445 | Unclassified | 712 |
| 45 | Ga0070663_101283833 | 3300005455 | Bacteria | 645 |
| 46 | Ga0070663_101308525 | 3300005455 | Bacteria | 640 |
| 47 | Ga0070678_101221127 | 3300005456 | Bacteria | 698 |
| 48 | Ga0070678_101649782 | 3300005456 | Bacteria | 603 |
| 49 | Ga0070662_101666803 | 3300005457 | Bacteria | 551 |
| 50 | Ga0070681_10017798 | 3300005458 | Bacteria | 7100 |
| 51 | Ga0070681_10031962 | 3300005458 | Bacteria | 5284 |
| 52 | Ga0070681_10038129 | 3300005458 | Bacteria | 4819 |
| 53 | Ga0070681_10156281 | 3300005458 | Bacteria | 2205 |
| 54 | Ga0070681_10190537 | 3300005458 | Bacteria | 1970 |
| 55 | Ga0070681_10279109 | 3300005458 | Bacteria | 1581 |
| 56 | Ga0070681_10523078 | 3300005458 | Bacteria | 1100 |
| 57 | Ga0070706_100642987 | 3300005467 | Bacteria | 985 |
| 58 | Ga0070706_101254798 | 3300005467 | Unclassified | 680 |
| 59 | Ga0070707_100986456 | 3300005468 | Bacteria | 808 |
| 60 | Ga0070707_101411751 | 3300005468 | Bacteria | 663 |
| 61 | Ga0070698_100792040 | 3300005471 | Bacteria | 892 |
| 62 | Ga0070699_101510767 | 3300005518 | Bacteria | 616 |
| 63 | Ga0070679_100053210 | 3300005530 | Bacteria | 4030 |
| 64 | Ga0070679_100146636 | 3300005530 | Bacteria | 2337 |
| 65 | Ga0070679_100159613 | 3300005530 | Bacteria | 2229 |
| 66 | Ga0070679_100590826 | 3300005530 | Bacteria | 1054 |
| 67 | Ga0070679_101784731 | 3300005530 | Unclassified | 563 |
| 68 | Ga0070684_100049912 | 3300005535 | Bacteria | 3633 |
| 69 | Ga0070684_100230109 | 3300005535 | Bacteria | 1692 |
| 70 | Ga0070684_100497581 | 3300005535 | Bacteria | 1129 |
| 71 | Ga0070684_100880179 | 3300005535 | Bacteria | 839 |
| 72 | Ga0070684_101035582 | 3300005535 | Bacteria | 770 |
| 73 | Ga0070684_101875798 | 3300005535 | Unclassified | 566 |
| 74 | Ga0070697_101572983 | 3300005536 | Bacteria | 588 |
| 75 | Ga0068853_100139657 | 3300005539 | Bacteria | 2174 |
| 76 | Ga0068853_100261028 | 3300005539 | Bacteria | 1592 |
| 77 | Ga0068853_101766400 | 3300005539 | Bacteria | 600 |
| 78 | Ga0070665_100011253 | 3300005548 | Bacteria | 9048 |
| 79 | Ga0070665_101269717 | 3300005548 | Bacteria | 747 |
| 80 | Ga0068855_100076153 | 3300005563 | Bacteria | 3894 |
| 81 | Ga0068855_100098953 | 3300005563 | Bacteria | 3359 |
| 82 | Ga0068855_100301361 | 3300005563 | Bacteria | 1775 |
| 83 | Ga0068855_100404452 | 3300005563 | Bacteria | 1495 |
| 84 | Ga0068855_100591451 | 3300005563 | Bacteria | 1198 |
| 85 | Ga0068855_100722259 | 3300005563 | Bacteria | 1064 |
| 86 | Ga0068857_100336713 | 3300005577 | Bacteria | 1395 |
| 87 | Ga0068857_101000889 | 3300005577 | Bacteria | 804 |
| 88 | Ga0068854_102033118 | 3300005578 | Bacteria | 530 |
| 89 | Ga0068856_100262134 | 3300005614 | Bacteria | 1744 |
| 90 | Ga0068856_100282119 | 3300005614 | Bacteria | 1678 |
| 91 | Ga0068856_100529565 | 3300005614 | Bacteria | 1199 |
| 92 | Ga0068856_100630588 | 3300005614 | Bacteria | 1092 |
| 93 | Ga0068852_100125770 | 3300005616 | Bacteria | 2354 |
| 94 | Ga0068852_100384479 | 3300005616 | Bacteria | 1377 |
| 95 | Ga0068852_100637197 | 3300005616 | Bacteria | 1072 |
| 96 | Ga0068851_10511552 | 3300005834 | Bacteria | 721 |
| 97 | Ga0068858_102327344 | 3300005842 | Bacteria | 529 |
| 98 | Ga0070717_11219155 | 3300006028 | Bacteria | 685 |
| 99 | Ga0070715_10120062 | 3300006163 | Bacteria | 1252 |
| 100 | Ga0070716_100313804 | 3300006173 | Bacteria | 1096 |
| 101 | Ga0097621_100577141 | 3300006237 | Bacteria | 1026 |
| 102 | Ga0068871_100166588 | 3300006358 | Bacteria | 1887 |
| 103 | Ga0075433_11075021 | 3300006852 | Bacteria | 700 |
| 104 | Ga0075434_100292884 | 3300006871 | Bacteria | 1648 |
| 105 | Ga0075436_100137669 | 3300006914 | Bacteria | 1715 |
| 106 | Ga0075435_100049753 | 3300007076 | Bacteria | 3372 |
| 107 | Ga0105240_10092476 | 3300009093 | Bacteria | 3693 |
| 108 | Ga0105240_10604472 | 3300009093 | Bacteria | 1207 |
| 109 | Ga0105240_10609632 | 3300009093 | Bacteria | 1201 |
| 110 | Ga0105240_11001525 | 3300009093 | Bacteria | 894 |
| 111 | Ga0105240_11411339 | 3300009093 | Bacteria | 732 |
| 112 | Ga0105240_11661589 | 3300009093 | Unclassified | 667 |
| 113 | Ga0105240_11678798 | 3300009093 | Bacteria | 663 |
| 114 | Ga0105245_11015489 | 3300009098 | Bacteria | 874 |
| 115 | Ga0105245_12122064 | 3300009098 | Bacteria | 616 |
| 116 | Ga0105241_10351757 | 3300009174 | Bacteria | 1279 |
| 117 | Ga0105241_10895225 | 3300009174 | Bacteria | 824 |
| 118 | Ga0105241_11118618 | 3300009174 | Bacteria | 742 |
| 119 | Ga0105241_11344072 | 3300009174 | Bacteria | 682 |
| 120 | Ga0105242_10022608 | 3300009176 | Bacteria | 4948 |
| 121 | Ga0105242_12142923 | 3300009176 | Bacteria | 603 |
| 122 | Ga0105242_12318574 | 3300009176 | Bacteria | 583 |
| 123 | Ga0105237_10176046 | 3300009545 | Bacteria | 2139 |
| 124 | Ga0105237_10326609 | 3300009545 | Bacteria | 1538 |
| 125 | Ga0105237_11643281 | 3300009545 | Bacteria | 649 |
| 126 | Ga0105238_10237010 | 3300009551 | Bacteria | 1802 |
| 127 | Ga0105238_10761001 | 3300009551 | Bacteria | 983 |
| 128 | Ga0105238_10899756 | 3300009551 | Bacteria | 903 |
| 129 | Ga0105239_10817819 | 3300010375 | Bacteria | 1068 |
| 130 | Ga0105239_11067906 | 3300010375 | Bacteria | 929 |
| 131 | Ga0157373_10929920 | 3300013100 | Bacteria | 646 |
| 132 | Ga0157370_10015630 | 3300013104 | Bacteria | 7709 |
| 133 | Ga0157370_10036790 | 3300013104 | Bacteria | 4749 |
| 134 | Ga0157370_10177450 | 3300013104 | Bacteria | 1980 |
| 135 | Ga0157370_10249394 | 3300013104 | Bacteria | 1642 |
| 136 | Ga0157370_10438106 | 3300013104 | Bacteria | 1202 |
| 137 | Ga0157370_10942473 | 3300013104 | Bacteria | 783 |
| 138 | Ga0157370_10990745 | 3300013104 | Bacteria | 761 |
| 139 | Ga0157369_10002657 | 3300013105 | Bacteria | 21337 |
| 140 | Ga0157369_10126450 | 3300013105 | Bacteria | 2710 |
| 141 | Ga0157369_10539486 | 3300013105 | Bacteria | 1206 |
| 142 | Ga0157369_10652667 | 3300013105 | Bacteria | 1085 |
| 143 | Ga0157369_10699311 | 3300013105 | Bacteria | 1044 |
| 144 | Ga0157369_11824049 | 3300013105 | Unclassified | 618 |
| 145 | Ga0157369_12352150 | 3300013105 | Bacteria | 540 |
| 146 | Ga0157369_12387206 | 3300013105 | Bacteria | 536 |
| 147 | Ga0157374_10952066 | 3300013296 | Bacteria | 877 |
| 148 | Ga0157378_10202794 | 3300013297 | Bacteria | 1877 |
| 149 | Ga0157378_11109875 | 3300013297 | Bacteria | 828 |
| 150 | Ga0157372_10040317 | 3300013307 | Bacteria | 5157 |
| 151 | Ga0157372_10315109 | 3300013307 | Bacteria | 1821 |
| 152 | Ga0157372_10470703 | 3300013307 | Bacteria | 1465 |
| 153 | Ga0157372_12383447 | 3300013307 | Bacteria | 608 |
| 154 | Ga0157372_12918432 | 3300013307 | Bacteria | 547 |
| 155 | Ga0157372_13034919 | 3300013307 | Unclassified | 536 |
| 156 | Ga0157375_12109058 | 3300013308 | Bacteria | 671 |
| 157 | Ga0182008_10051801 | 3300014497 | Bacteria | 2036 |
| 158 | Ga0182008_10130853 | 3300014497 | Bacteria | 1251 |
| 159 | Ga0182008_10196099 | 3300014497 | Bacteria | 1026 |
| 160 | Ga0182008_10439384 | 3300014497 | Bacteria | 707 |
| 161 | Ga0182008_10598067 | 3300014497 | Bacteria | 619 |
| 162 | Ga0157376_11458542 | 3300014969 | Bacteria | 717 |
| 163 | Ga0182006_1290120 | 3300015261 | Bacteria | 537 |
| 164 | Ga0182007_10124110 | 3300015262 | Bacteria | 865 |
| 165 | Ga0182007_10261022 | 3300015262 | Bacteria | 624 |
| 166 | Ga0197907_11154728 | 3300020069 | Unclassified | 642 |
| 167 | Ga0206356_10212333 | 3300020070 | Bacteria | 1154 |
| 168 | Ga0206356_10602804 | 3300020070 | Bacteria | 1880 |
| 169 | Ga0206356_10900205 | 3300020070 | Bacteria | 726 |
| 170 | Ga0206356_10985006 | 3300020070 | Bacteria | 643 |
| 171 | Ga0206356_11621634 | 3300020070 | Bacteria | 871 |
| 172 | Ga0206356_11651324 | 3300020070 | Unclassified | 850 |
| 173 | Ga0206354_10547085 | 3300020081 | Bacteria | 1172 |
| 174 | Ga0206354_10974966 | 3300020081 | Bacteria | 3062 |
| 175 | Ga0206354_11443079 | 3300020081 | Bacteria | 623 |
| 176 | Ga0206353_10119475 | 3300020082 | Bacteria | 903 |
| 177 | Ga0206353_10181076 | 3300020082 | Bacteria | 771 |
| 178 | Ga0206353_10203657 | 3300020082 | Bacteria | 1800 |
| 179 | Ga0206353_10379293 | 3300020082 | Bacteria | 718 |
| 180 | Ga0206353_10381735 | 3300020082 | Bacteria | 590 |
| 181 | Ga0206353_12046548 | 3300020082 | Bacteria | 746 |
| 182 | Ga0213876_10134117 | 3300021384 | Bacteria | 1317 |
| 183 | Ga0207692_10254480 | 3300025898 | Bacteria | 1054 |
| 184 | Ga0207692_10391886 | 3300025898 | Bacteria | 864 |
| 185 | Ga0207692_10425751 | 3300025898 | Bacteria | 832 |
| 186 | Ga0207685_10166623 | 3300025905 | Bacteria | 1010 |
| 187 | Ga0207685_10551124 | 3300025905 | Bacteria | 613 |
| 188 | Ga0207699_10229628 | 3300025906 | Bacteria | 1271 |
| 189 | Ga0207705_10038581 | 3300025909 | Bacteria | 3420 |
| 190 | Ga0207705_10096962 | 3300025909 | Bacteria | 2165 |
| 191 | Ga0207654_10275734 | 3300025911 | Bacteria | 1136 |
| 192 | Ga0207654_10279964 | 3300025911 | Bacteria | 1128 |
| 193 | Ga0207654_11059716 | 3300025911 | Bacteria | 590 |
| 194 | Ga0207707_10006845 | 3300025912 | Bacteria | 9940 |
| 195 | Ga0207707_10016574 | 3300025912 | Bacteria | 6424 |
| 196 | Ga0207707_10034460 | 3300025912 | Bacteria | 4429 |
| 197 | Ga0207707_10258541 | 3300025912 | Bacteria | 1511 |
| 198 | Ga0207707_10529672 | 3300025912 | Bacteria | 1003 |
| 199 | Ga0207695_10040302 | 3300025913 | Bacteria | 5010 |
| 200 | Ga0207695_10126563 | 3300025913 | Bacteria | 2516 |
| 201 | Ga0207695_10807599 | 3300025913 | Bacteria | 818 |
| 202 | Ga0207695_10887671 | 3300025913 | Bacteria | 771 |
| 203 | Ga0207695_10897261 | 3300025913 | Bacteria | 766 |
| 204 | Ga0207671_10070235 | 3300025914 | Bacteria | 2610 |
| 205 | Ga0207671_10252371 | 3300025914 | Bacteria | 1387 |
| 206 | Ga0207693_10621426 | 3300025915 | Bacteria | 840 |
| 207 | Ga0207663_10008237 | 3300025916 | Bacteria | 5441 |
| 208 | Ga0207663_10358400 | 3300025916 | Bacteria | 1106 |
| 209 | Ga0207663_11554184 | 3300025916 | Bacteria | 533 |
| 210 | Ga0207660_10038517 | 3300025917 | Bacteria | 3338 |
| 211 | Ga0207660_10237079 | 3300025917 | Bacteria | 1436 |
| 212 | Ga0207660_10352203 | 3300025917 | Bacteria | 1180 |
| 213 | Ga0207660_11123413 | 3300025917 | Bacteria | 640 |
| 214 | Ga0207657_10002824 | 3300025919 | Bacteria | 18667 |
| 215 | Ga0207657_10012342 | 3300025919 | Bacteria | 8437 |
| 216 | Ga0207657_10042675 | 3300025919 | Bacteria | 4000 |
| 217 | Ga0207657_10234387 | 3300025919 | Bacteria | 1467 |
| 218 | Ga0207657_10315293 | 3300025919 | Bacteria | 1237 |
| 219 | Ga0207657_10374978 | 3300025919 | Bacteria | 1121 |
| 220 | Ga0207649_10182642 | 3300025920 | Bacteria | 1469 |
| 221 | Ga0207649_10550181 | 3300025920 | Bacteria | 883 |
| 222 | Ga0207649_10865025 | 3300025920 | Bacteria | 708 |
| 223 | Ga0207649_10993820 | 3300025920 | Bacteria | 660 |
| 224 | Ga0207652_10058222 | 3300025921 | Bacteria | 3329 |
| 225 | Ga0207652_10176814 | 3300025921 | Bacteria | 1917 |
| 226 | Ga0207652_10384415 | 3300025921 | Bacteria | 1267 |
| 227 | Ga0207652_10504941 | 3300025921 | Bacteria | 1089 |
| 228 | Ga0207652_11509310 | 3300025921 | Bacteria | 576 |
| 229 | Ga0207646_11573269 | 3300025922 | Bacteria | 568 |
| 230 | Ga0207694_10128491 | 3300025924 | Bacteria | 2029 |
| 231 | Ga0207694_10272545 | 3300025924 | Bacteria | 1388 |
| 232 | Ga0207694_10542028 | 3300025924 | Bacteria | 976 |
| 233 | Ga0207650_11354546 | 3300025925 | Bacteria | 606 |
| 234 | Ga0207700_11901263 | 3300025928 | Bacteria | 521 |
| 235 | Ga0207664_10110404 | 3300025929 | Bacteria | 2287 |
| 236 | Ga0207664_10146145 | 3300025929 | Bacteria | 2005 |
| 237 | Ga0207664_10443211 | 3300025929 | Bacteria | 1158 |
| 238 | Ga0207664_11093410 | 3300025929 | Bacteria | 713 |
| 239 | Ga0207664_11295758 | 3300025929 | Bacteria | 648 |
| 240 | Ga0207686_10026385 | 3300025934 | Bacteria | 3388 |
| 241 | Ga0207686_11797206 | 3300025934 | Bacteria | 507 |
| 242 | Ga0207665_10352578 | 3300025939 | Bacteria | 1111 |
| 243 | Ga0207661_10219213 | 3300025944 | Bacteria | 1681 |
| 244 | Ga0207661_10733126 | 3300025944 | Bacteria | 909 |
| 245 | Ga0207661_11920036 | 3300025944 | Bacteria | 538 |
| 246 | Ga0207679_10856665 | 3300025945 | Bacteria | 830 |
| 247 | Ga0207667_10089901 | 3300025949 | Bacteria | 3173 |
| 248 | Ga0207667_10193033 | 3300025949 | Bacteria | 2089 |
| 249 | Ga0207667_10392924 | 3300025949 | Bacteria | 1412 |
| 250 | Ga0207667_10522619 | 3300025949 | Bacteria | 1202 |
| 251 | Ga0207667_11100607 | 3300025949 | Bacteria | 778 |
| 252 | Ga0207667_11628129 | 3300025949 | Bacteria | 614 |
| 253 | Ga0207667_11923042 | 3300025949 | Bacteria | 553 |
| 254 | Ga0207640_10291217 | 3300025981 | Bacteria | 1287 |
| 255 | Ga0207658_10004832 | 3300025986 | Bacteria | 9316 |
| 256 | Ga0207703_10215430 | 3300026035 | Bacteria | 1714 |
| 257 | Ga0207639_10347792 | 3300026041 | Bacteria | 1323 |
| 258 | Ga0207639_11055905 | 3300026041 | Bacteria | 761 |
| 259 | Ga0207678_10180042 | 3300026067 | Bacteria | 1805 |
| 260 | Ga0207678_11001189 | 3300026067 | Bacteria | 740 |
| 261 | Ga0207702_10737219 | 3300026078 | Bacteria | 972 |
| 262 | Ga0207674_10300614 | 3300026116 | Bacteria | 1554 |
| 263 | Ga0207674_10362945 | 3300026116 | Bacteria | 1400 |
| 264 | Ga0207683_10161621 | 3300026121 | Bacteria | 2025 |
| 265 | Ga0207698_10074300 | 3300026142 | Bacteria | 2711 |
| 266 | Ga0207698_11272475 | 3300026142 | Bacteria | 750 |
| 267 | Ga0268266_10025493 | 3300028379 | Bacteria | 5031 |
| 268 | Ga0268266_11021513 | 3300028379 | Bacteria | 800 |
| 269 | Ga0265334_10293483 | 3300028573 | Unclassified | 557 |
| 270 | Ga0265318_10119073 | 3300028577 | Bacteria | 971 |
| 271 | Ga0265322_10013003 | 3300028654 | Bacteria | 2409 |
| 272 | Ga0265338_10054346 | 3300028800 | Bacteria | 3572 |
| 273 | Ga0265338_11136464 | 3300028800 | Bacteria | 525 |
| 274 | Ga0265330_10063123 | 3300031235 | Bacteria | 1610 |
| 275 | Ga0265325_10146629 | 3300031241 | Bacteria | 1119 |
| 276 | Ga0265339_10041736 | 3300031249 | Bacteria | 2544 |
| 277 | Ga0265331_10145100 | 3300031250 | Bacteria | 1078 |
| 278 | Ga0265331_10168352 | 3300031250 | Bacteria | 992 |
| 279 | Ga0265327_10008869 | 3300031251 | Bacteria | 7391 |
| 280 | Ga0265316_10008441 | 3300031344 | Bacteria | 9562 |
| 281 | Ga0265313_10002660 | 3300031595 | Bacteria | 15177 |
| 282 | Ga0265314_10003929 | 3300031711 | Bacteria | 14127 |
| 283 | Ga0265342_10021116 | 3300031712 | Bacteria | 4164 |
| 284 | Ga0373926_0010942 | 3300035083 | Bacteria | 3046 |
| 285 | Ga0373926_0141747 | 3300035083 | Bacteria | 913 |
| 286 | Ga0373944_0008204 | 3300035089 | Bacteria | 2818 |
| 287 | Ga0373936_0014573 | 3300035113 | Bacteria | 3009 |
| 288 | Ga0373936_0031561 | 3300035113 | Bacteria | 2092 |
| 289 | Ga0373945_0003761 | 3300035116 | Bacteria | 4789 |
| 290 | Ga0373945_0036219 | 3300035116 | Bacteria | 1767 |
| 291 | Ga0373943_0000538 | 3300035170 | Bacteria | 16397 |
| 292 | Ga0373943_0014138 | 3300035170 | Bacteria | 3609 |
| 293 | Ga0373946_0761651 | 3300035171 | Bacteria | 508 |
| 294 | Ga0373924_0485403 | 3300035410 | Bacteria | 555 |
| 295 | Ga0373935_0087987 | 3300035692 | Bacteria | 2029 |
| 296 | Ga0373935_0109829 | 3300035692 | Bacteria | 1829 |
| 297 | Ga0373927_0025083 | 3300035695 | Bacteria | 3898 |
| 298 | Ga0373947_0000066 | 3300035725 | Bacteria | 52968 |
| 299 | Ga0373947_0003591 | 3300035725 | Bacteria | 9146 |
| 300 | Ga0373937_0227948 | 3300036401 | Bacteria | 1754 |
| 301 | Ga0373925_0003351 | 3300037068 | Bacteria | 12427 |
| 302 | Ga0373925_0033365 | 3300037068 | Bacteria | 3793 |
| 303 | Ga0395899_0199877 | 3300037312 | Bacteria | 1394 |
| 304 | Ga0395899_0271593 | 3300037312 | Bacteria | 1156 |
| 305 | Ga0395900_0168172 | 3300037418 | Bacteria | 2233 |
| 306 | Ga0395900_0339514 | 3300037418 | Bacteria | 1478 |
| 307 | Ga0395900_0526595 | 3300037418 | Bacteria | 1129 |
| 308 | Ga0395900_0995215 | 3300037418 | Bacteria | 758 |
| 309 | Ga0395900_1013075 | 3300037418 | Bacteria | 750 |
| 310 | Ga0395900_1735454 | 3300037418 | Bacteria | 535 |
| 311 | Ga0395898_0005527 | 3300037466 | Bacteria | 13639 |
| 312 | Ga0395898_0134482 | 3300037466 | Bacteria | 2367 |
| 313 | Ga0395898_0144583 | 3300037466 | Bacteria | 2276 |
| 314 | Ga0395898_0590784 | 3300037466 | Bacteria | 1053 |
| 315 | Ga0395898_0597639 | 3300037466 | Bacteria | 1046 |
| 316 | Ga0395898_0679479 | 3300037466 | Bacteria | 972 |
| 317 | Ga0395905_0036251 | 3300037471 | Bacteria | 4632 |
| 318 | Ga0436364_1209114 | 3300037853 | Bacteria | 1589 |
| 319 | Ga0395901_0033926 | 3300038443 | Bacteria | 5270 |
| 320 | Ga0395901_0121797 | 3300038443 | Bacteria | 2741 |
| 321 | Ga0395901_0259497 | 3300038443 | Bacteria | 1809 |
| 322 | Ga0395901_0467664 | 3300038443 | Bacteria | 1287 |
| 323 | Ga0395901_0654807 | 3300038443 | Bacteria | 1053 |
| 324 | Ga0395901_1530528 | 3300038443 | Bacteria | 622 |
| 325 | Ga0395901_1715721 | 3300038443 | Bacteria | 579 |
| 326 | Ga0436365_0701893 | 3300039437 | Bacteria | 1069 |
| 327 | Ga0436365_1634939 | 3300039437 | Bacteria | 4555 |
| 328 | Ga0436360_0341402 | 3300039438 | Bacteria | 1642 |
| 329 | Ga0436363_1450105 | 3300039450 | Bacteria | 572 |
| 330 | Ga0436362_0430525 | 3300039453 | Bacteria | 568 |
| 331 | Ga0439448_0245944 | 3300042005 | Bacteria | 631 |
| 332 | Ga0466969_0182511 | 3300044656 | Bacteria | 960 |
| 333 | Ga0466972_0365937 | 3300044658 | Bacteria | 675 |
| 334 | Ga0466972_0506811 | 3300044658 | Bacteria | 568 |
| 335 | Ga0466965_0223203 | 3300044683 | Bacteria | 1005 |
| 336 | Ga0466966_0023644 | 3300044684 | Bacteria | 4023 |
| 337 | Ga0466966_0030664 | 3300044684 | Bacteria | 3488 |
| 338 | Ga0466966_0070743 | 3300044684 | Bacteria | 2187 |
| 339 | Ga0466961_0000424 | 3300044693 | Bacteria | 26980 |
| 340 | Ga0466961_0031926 | 3300044693 | Bacteria | 3385 |
| 341 | Ga0466961_0043938 | 3300044693 | Bacteria | 2861 |
| 342 | Ga0466961_0081722 | 3300044693 | Bacteria | 2044 |
| 343 | Ga0466961_0845817 | 3300044693 | Unclassified | 545 |
| 344 | Ga0466963_0002241 | 3300044694 | Bacteria | 10726 |
| 345 | Ga0466963_0017573 | 3300044694 | Bacteria | 4460 |
| 346 | Ga0466963_0050294 | 3300044694 | Bacteria | 2759 |
| 347 | Ga0466963_0237634 | 3300044694 | Bacteria | 1277 |
| 348 | Ga0466963_0280746 | 3300044694 | Bacteria | 1170 |
| 349 | Ga0466963_0499790 | 3300044694 | Bacteria | 858 |
| 350 | Ga0466964_0002641 | 3300044706 | Bacteria | 6420 |
| 351 | Ga0466964_0185908 | 3300044706 | Bacteria | 988 |
| 352 | Ga0466971_0001169 | 3300044719 | Bacteria | 10913 |
| 353 | Ga0466971_0054512 | 3300044719 | Bacteria | 1802 |
| 354 | Ga0466971_0070049 | 3300044719 | Bacteria | 1592 |
| 355 | Ga0466968_0006432 | 3300044735 | Bacteria | 4428 |
| 356 | Ga0466968_0327035 | 3300044735 | Bacteria | 741 |
| 357 | Ga0466970_0090985 | 3300044765 | Bacteria | 1656 |
| 358 | Ga0466957_0000598 | 3300044842 | Bacteria | 18341 |
| 359 | Ga0466957_0124850 | 3300044842 | Bacteria | 1644 |
| 360 | Ga0466957_0185481 | 3300044842 | Bacteria | 1360 |
| 361 | Ga0466957_0521968 | 3300044842 | Unclassified | 825 |
| 362 | Ga0466957_0744322 | 3300044842 | Unclassified | 694 |
| 363 | Ga0466960_0120950 | 3300044901 | Bacteria | 1371 |
| 364 | Ga0466960_0490225 | 3300044901 | Bacteria | 719 |
| 365 | Ga0466959_0013344 | 3300045049 | Bacteria | 5956 |
| 366 | Ga0466959_0050603 | 3300045049 | Bacteria | 3050 |
| 367 | Ga0466959_0061341 | 3300045049 | Bacteria | 2734 |
| 368 | Ga0466959_0177405 | 3300045049 | Bacteria | 1492 |
| 369 | Ga0466959_0273973 | 3300045049 | Bacteria | 1159 |
| 370 | Ga0451576_0270243 | 3300045051 | Bacteria | 1777 |
| 371 | Ga0466958_0002350 | 3300045836 | Bacteria | 9459 |
| 372 | Ga0466958_0011139 | 3300045836 | Bacteria | 5059 |
| 373 | Ga0466958_0022990 | 3300045836 | Bacteria | 3656 |
| 374 | Ga0466958_0070650 | 3300045836 | Bacteria | 2137 |
| 375 | Ga0466958_0644653 | 3300045836 | Unclassified | 689 |
| 376 | Ga0466958_0829750 | 3300045836 | Bacteria | 603 |
| 377 | Ga0466967_0000221 | 3300045976 | Bacteria | 24435 |
| 378 | Ga0466967_0002137 | 3300045976 | Bacteria | 12121 |
| 379 | Ga0466967_0002877 | 3300045976 | Bacteria | 10952 |
| 380 | Ga0466967_0013743 | 3300045976 | Bacteria | 6272 |
| 381 | Ga0466967_0094365 | 3300045976 | Bacteria | 2724 |
| 382 | Ga0466967_0108376 | 3300045976 | Bacteria | 2549 |
| 383 | Ga0466967_0142539 | 3300045976 | Bacteria | 2233 |
| 384 | Ga0466967_0200384 | 3300045976 | Bacteria | 1890 |
| 385 | Ga0466967_0226024 | 3300045976 | Bacteria | 1780 |
| 386 | Ga0466967_0270845 | 3300045976 | Bacteria | 1627 |
| 387 | Ga0466967_0493690 | 3300045976 | Bacteria | 1200 |
| 388 | Ga0466967_0819939 | 3300045976 | Bacteria | 924 |
| 389 | Ga0466967_0919477 | 3300045976 | Bacteria | 870 |
| 390 | Ga0466967_0946046 | 3300045976 | Bacteria | 857 |
| 391 | Ga0466967_0954055 | 3300045976 | Bacteria | 853 |
| 392 | Ga0466967_1714386 | 3300045976 | Bacteria | 626 |
| 393 | Ga0466967_2030007 | 3300045976 | Bacteria | 572 |
| 394 | Ga0466967_2296544 | 3300045976 | Bacteria | 535 |
| 395 | Ga0495603_0363413 | 3300046455 | Bacteria | 830 |
| 396 | Ga0495629_0000194 | 3300046459 | Bacteria | 54501 |
| 397 | Ga0495641_0000850 | 3300046461 | Bacteria | 26094 |
| 398 | Ga0495651_0025004 | 3300046462 | Bacteria | 4646 |
| 399 | Ga0495651_0037562 | 3300046462 | Bacteria | 3771 |
| 400 | Ga0495653_0026482 | 3300046463 | Bacteria | 4649 |
| 401 | Ga0495582_0000317 | 3300046473 | Bacteria | 26470 |
| 402 | Ga0495582_0066628 | 3300046473 | Bacteria | 1990 |
| 403 | Ga0495605_0050655 | 3300046474 | Bacteria | 2025 |
| 404 | Ga0495639_0001774 | 3300046475 | Bacteria | 9556 |
| 405 | Ga0495662_0053966 | 3300046476 | Bacteria | 1941 |
| 406 | Ga0495664_0022024 | 3300046477 | Bacteria | 3687 |
| 407 | Ga0495664_0251138 | 3300046477 | Bacteria | 1069 |
| 408 | Ga0495594_0103780 | 3300046499 | Bacteria | 1600 |
| 409 | Ga0495608_0043053 | 3300046511 | Bacteria | 3018 |
| 410 | Ga0495608_0067597 | 3300046511 | Bacteria | 2338 |
| 411 | Ga0495618_0044439 | 3300046514 | Bacteria | 2802 |
| 412 | Ga0495628_0045334 | 3300046516 | Bacteria | 3497 |
| 413 | Ga0495630_0069394 | 3300046517 | Bacteria | 2651 |
| 414 | Ga0495630_0117512 | 3300046517 | Bacteria | 2016 |
| 415 | Ga0495666_0117399 | 3300046526 | Bacteria | 1247 |
| 416 | Ga0495652_0160597 | 3300046529 | Bacteria | 1745 |
| 417 | Ga0495665_0030981 | 3300046531 | Bacteria | 2862 |
| 418 | Ga0495586_0148751 | 3300046535 | Bacteria | 1317 |
| 419 | Ga0495587_0084731 | 3300046536 | Bacteria | 1835 |
| 420 | Ga0495645_0028989 | 3300046543 | Bacteria | 4023 |
| 421 | Ga0495667_0023127 | 3300046559 | Bacteria | 4188 |
| 422 | Ga0495667_0137838 | 3300046559 | Bacteria | 1573 |
| 423 | Ga0495667_0816426 | 3300046559 | Bacteria | 574 |
| 424 | Ga0495634_0025218 | 3300046642 | Bacteria | 4165 |
| 425 | Ga0495635_0051537 | 3300046663 | Bacteria | 2835 |
| 426 | Ga0495588_0713411 | 3300046674 | Bacteria | 524 |
| 427 | Ga0495657_0261949 | 3300046675 | Bacteria | 1038 |
| 428 | Ga0495657_0638657 | 3300046675 | Bacteria | 614 |
| 429 | Ga0495599_0061543 | 3300046678 | Bacteria | 2346 |
| 430 | Ga0495646_0607810 | 3300046680 | Bacteria | 555 |
| 431 | Ga0495647_0004994 | 3300046681 | Bacteria | 4345 |
| 432 | Ga0495658_0000224 | 3300046683 | Bacteria | 32518 |
| 433 | Ga0495658_0103528 | 3300046683 | Bacteria | 1702 |
| 434 | Ga0495613_0001177 | 3300046689 | Bacteria | 19969 |
| 435 | Ga0495613_0035864 | 3300046689 | Bacteria | 3679 |
| 436 | Ga0495624_0010250 | 3300046690 | Bacteria | 6460 |
| 437 | Ga0495600_0002823 | 3300046809 | Bacteria | 10102 |
| 438 | Ga0495600_0052183 | 3300046809 | Bacteria | 2670 |
| 439 | Ga0495600_0449906 | 3300046809 | Bacteria | 797 |
| 440 | Ga0495581_0001581 | 3300047315 | Bacteria | 12707 |
| 441 | Ga0495604_0008755 | 3300047317 | Bacteria | 7997 |
| 442 | Ga0495604_0385655 | 3300047317 | Bacteria | 925 |
| 443 | Ga0495674_0260957 | 3300047319 | Bacteria | 1423 |
| 444 | Ga0495674_0403296 | 3300047319 | Bacteria | 1103 |
| 445 | Ga0495676_0002504 | 3300047321 | Bacteria | 16355 |
| 446 | Ga0495676_0049841 | 3300047321 | Bacteria | 3363 |
| 447 | Ga0495680_0006155 | 3300047322 | Bacteria | 11193 |
| 448 | Ga0495680_0930331 | 3300047322 | Bacteria | 560 |
| 449 | Ga0495675_0089447 | 3300047444 | Bacteria | 1933 |
| 450 | Ga0495684_0057953 | 3300047471 | Bacteria | 2951 |
| 451 | Ga0495684_0118247 | 3300047471 | Bacteria | 1997 |
| 452 | Ga0495593_0012213 | 3300047673 | Bacteria | 4910 |
| 453 | Ga0495602_0445319 | 3300048088 | Bacteria | 915 |
| 454 | Ga0495614_0002669 | 3300048089 | Bacteria | 7928 |
| 455 | Ga0495614_0118667 | 3300048089 | Bacteria | 1165 |
| 456 | Ga0496100_0007025 | 3300048903 | Bacteria | 6176 |
| 457 | Ga0496100_0030659 | 3300048903 | Bacteria | 3337 |
| 458 | Ga0496100_0085189 | 3300048903 | Bacteria | 2144 |
| 459 | Ga0496100_0146082 | 3300048903 | Bacteria | 1682 |
| 460 | Ga0496100_0620669 | 3300048903 | Bacteria | 840 |
| 461 | Ga0496101_0005132 | 3300048904 | Bacteria | 8327 |
| 462 | Ga0496101_0026950 | 3300048904 | Bacteria | 3996 |
| 463 | Ga0496101_0094320 | 3300048904 | Bacteria | 2230 |
| 464 | Ga0496101_0106271 | 3300048904 | Bacteria | 2107 |
| 465 | Ga0496102_0050087 | 3300048905 | Bacteria | 3802 |
| 466 | Ga0496102_0206878 | 3300048905 | Bacteria | 1850 |
| 467 | Ga0496102_0322514 | 3300048905 | Bacteria | 1455 |
| 468 | Ga0496102_0476866 | 3300048905 | Bacteria | 1169 |
| 469 | Ga0496102_0721240 | 3300048905 | Bacteria | 920 |
| 470 | Ga0496103_0050432 | 3300048906 | Bacteria | 2575 |
| 471 | Ga0496103_0067591 | 3300048906 | Bacteria | 2232 |
| 472 | Ga0496103_0540089 | 3300048906 | Bacteria | 745 |
| 473 | Ga0496104_0013997 | 3300048907 | Bacteria | 7237 |
| 474 | Ga0496104_0134903 | 3300048907 | Bacteria | 2371 |
| 475 | Ga0496105_0016517 | 3300048908 | Bacteria | 5894 |
| 476 | Ga0496105_0080302 | 3300048908 | Bacteria | 2694 |
| 477 | Ga0496105_0422944 | 3300048908 | Bacteria | 1054 |
| 478 | Ga0496106_0010080 | 3300048909 | Bacteria | 6979 |
| 479 | Ga0496106_0065857 | 3300048909 | Bacteria | 2758 |
| 480 | Ga0496106_0138875 | 3300048909 | Bacteria | 1910 |
| 481 | Ga0496107_0070179 | 3300048910 | Bacteria | 2543 |
| 482 | Ga0496107_0122337 | 3300048910 | Bacteria | 1917 |
| 483 | Ga0496107_0395070 | 3300048910 | Bacteria | 1028 |
| 484 | Ga0496107_0580209 | 3300048910 | Bacteria | 829 |
| 485 | Ga0496108_0039156 | 3300048911 | Bacteria | 3952 |
| 486 | Ga0496109_0025879 | 3300048912 | Bacteria | 5230 |
| 487 | Ga0496110_0357001 | 3300048913 | Bacteria | 1332 |
| 488 | Ga0496111_0022179 | 3300048914 | Bacteria | 4442 |
| 489 | Ga0496111_1352347 | 3300048914 | Bacteria | 500 |
| 490 | Ga0496112_0058996 | 3300048915 | Bacteria | 3781 |
| 491 | Ga0496112_0124519 | 3300048915 | Bacteria | 2548 |
| 492 | Ga0496112_0138139 | 3300048915 | Bacteria | 2407 |
| 493 | Ga0496113_0068055 | 3300048916 | Bacteria | 2702 |
| 494 | Ga0496113_0227936 | 3300048916 | Bacteria | 1485 |
| 495 | Ga0496113_0615543 | 3300048916 | Bacteria | 869 |
| 496 | Ga0496114_0002271 | 3300048917 | Bacteria | 14633 |
| 497 | Ga0496114_0019327 | 3300048917 | Bacteria | 5519 |
| 498 | Ga0496114_0078049 | 3300048917 | Bacteria | 2793 |
| 499 | Ga0496114_0248069 | 3300048917 | Bacteria | 1566 |
| 500 | Ga0496115_0003388 | 3300048918 | Bacteria | 11443 |
| 501 | Ga0496115_0003556 | 3300048918 | Bacteria | 11211 |
| 502 | Ga0496115_0010180 | 3300048918 | Bacteria | 7018 |
| 503 | Ga0501046_0696649 | 3300049580 | Bacteria | 716 |
| 504 | Ga0501047_0481621 | 3300049581 | Bacteria | 1068 |
| 505 | Ga0501067_0000845 | 3300049583 | Bacteria | 16504 |
| 506 | Ga0501067_0170486 | 3300049583 | Bacteria | 1212 |
| 507 | Ga0501068_0486858 | 3300049584 | Bacteria | 799 |
| 508 | Ga0501069_0001111 | 3300049585 | Bacteria | 12988 |
| 509 | Ga0501069_0130380 | 3300049585 | Unclassified | 1439 |
| 510 | Ga0501069_0222881 | 3300049585 | Bacteria | 1096 |
| 511 | Ga0501069_0572757 | 3300049585 | Bacteria | 676 |
| 512 | Ga0501070_0088289 | 3300049586 | Bacteria | 2566 |
| 513 | Ga0501070_0877017 | 3300049586 | Bacteria | 701 |
| 514 | Ga0501074_0069857 | 3300049590 | Bacteria | 2525 |
| 515 | Ga0501081_0629947 | 3300049743 | Bacteria | 803 |
| 516 | Ga0501035_0348460 | 3300049822 | Bacteria | 1240 |
| 517 | Ga0501044_1213376 | 3300049823 | Bacteria | 622 |
| 518 | nmdc:mga0n895_63654_c1 | 3300050512 | Bacteria | 3647 |
| 519 | nmdc:mga0rr50_5367_c1 | 3300050513 | Bacteria | 7637 |
| 520 | nmdc:mga08x19_91593_c1 | 3300050514 | Bacteria | 2007 |
| 521 | Ga0495601_0077459 | 3300053077 | Bacteria | 2129 |
| 522 | Ga0495612_0009638 | 3300053078 | Bacteria | 3912 |
| 523 | Ga0495655_0000869 | 3300053083 | Bacteria | 4720 |
| 524 | Ga0495595_0007508 | 3300053084 | Bacteria | 4466 |
| 525 | Ga0495595_0106303 | 3300053084 | Bacteria | 1358 |
| 526 | Ga0495619_0112832 | 3300053085 | Bacteria | 1858 |
| 527 | Ga0466962_0000257 | 3300061719 | Bacteria | 22422 |
| 528 | Ga0466962_0167721 | 3300061719 | Bacteria | 1068 |
| 529 | Ga0466962_0224272 | 3300061719 | Bacteria | 921 |
| 530 | Ga0530510_0039653 | 3300061734 | Bacteria | 3400 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044842 | Ga0466957_0185481 | Ga0466957_0185481_586_906 | 75 |
| 2 | 3300044694 | Ga0466963_0050294 | Ga0466963_0050294_1064_1384 | 76 |
| 3 | 3300045836 | Ga0466958_0070650 | Ga0466958_0070650_461_781 | 76 |
| 4 | 3300045976 | Ga0466967_0200384 | Ga0466967_0200384_1087_1407 | 76 |
| 5 | 3300061719 | Ga0466962_0167721 | Ga0466962_0167721_581_901 | 76 |
| 6 | 3300037418 | Ga0395900_0526595 | Ga0395900_0526595_834_1076 | 80 |
| 7 | 3300038443 | Ga0395901_0654807 | Ga0395901_0654807_364_606 | 80 |
| 8 | 3300039438 | Ga0436360_0341402 | Ga0436360_0341402_1388_1630 | 80 |
| 9 | 3300005329 | Ga0070683_100292981 | Ga0070683_1002929812 | 82 |
| 10 | 3300005339 | Ga0070660_100035792 | Ga0070660_1000357922 | 82 |
| 11 | 3300005344 | Ga0070661_100943074 | Ga0070661_1009430741 | 82 |
| 12 | 3300005445 | Ga0070708_100804374 | Ga0070708_1008043742 | 82 |
| 13 | 3300005458 | Ga0070681_10031962 | Ga0070681_100319626 | 82 |
| 14 | 3300005467 | Ga0070706_100642987 | Ga0070706_1006429872 | 82 |
| 15 | 3300005467 | Ga0070706_101254798 | Ga0070706_1012547981 | 82 |
| 16 | 3300005530 | Ga0070679_100590826 | Ga0070679_1005908262 | 82 |
| 17 | 3300005535 | Ga0070684_100497581 | Ga0070684_1004975812 | 82 |
| 18 | 3300005834 | Ga0068851_10511552 | Ga0068851_105115523 | 82 |
| 19 | 3300020082 | Ga0206353_10181076 | Ga0206353_101810762 | 82 |
| 20 | 3300020082 | Ga0206353_10381735 | Ga0206353_103817352 | 82 |
| 21 | 3300021384 | Ga0213876_10134117 | Ga0213876_101341172 | 82 |
| 22 | 3300025909 | Ga0207705_10096962 | Ga0207705_100969622 | 82 |
| 23 | 3300025912 | Ga0207707_10016574 | Ga0207707_100165745 | 82 |
| 24 | 3300025919 | Ga0207657_10002824 | Ga0207657_1000282418 | 82 |
| 25 | 3300025920 | Ga0207649_10182642 | Ga0207649_101826423 | 82 |
| 26 | 3300025921 | Ga0207652_10504941 | Ga0207652_105049412 | 82 |
| 27 | 3300037312 | Ga0395899_0199877 | Ga0395899_0199877_959_1207 | 82 |
| 28 | 3300037418 | Ga0395900_0339514 | Ga0395900_0339514_175_432 | 82 |
| 29 | 3300037418 | Ga0395900_0995215 | Ga0395900_0995215_195_443 | 82 |
| 30 | 3300037466 | Ga0395898_0005527 | Ga0395898_0005527_8335_8583 | 82 |
| 31 | 3300037466 | Ga0395898_0679479 | Ga0395898_0679479_110_367 | 82 |
| 32 | 3300037853 | Ga0436364_1209114 | Ga0436364_1209114_381_635 | 82 |
| 33 | 3300038443 | Ga0395901_0259497 | Ga0395901_0259497_634_891 | 82 |
| 34 | 3300038443 | Ga0395901_0467664 | Ga0395901_0467664_845_1093 | 82 |
| 35 | 3300038443 | Ga0395901_1530528 | Ga0395901_1530528_201_458 | 82 |
| 36 | 3300038443 | Ga0395901_1715721 | Ga0395901_1715721_138_389 | 82 |
| 37 | 3300039437 | Ga0436365_0701893 | Ga0436365_0701893_68_319 | 82 |
| 38 | 3300039437 | Ga0436365_1634939 | Ga0436365_1634939_1610_1864 | 82 |
| 39 | 3300039450 | Ga0436363_1450105 | Ga0436363_1450105_49_303 | 82 |
| 40 | 3300039453 | Ga0436362_0430525 | Ga0436362_0430525_198_452 | 82 |
| 41 | 3300045976 | Ga0466967_0954055 | Ga0466967_0954055_594_842 | 82 |
| 42 | 3300048905 | Ga0496102_0050087 | Ga0496102_0050087_1912_2166 | 82 |
| 43 | 3300048906 | Ga0496103_0050432 | Ga0496103_0050432_828_1082 | 82 |
| 44 | 3300048914 | Ga0496111_1352347 | Ga0496111_1352347_113_367 | 82 |
| 45 | 3300048915 | Ga0496112_0124519 | Ga0496112_0124519_1947_2201 | 82 |
| 46 | 3300048916 | Ga0496113_0227936 | Ga0496113_0227936_362_616 | 82 |
| 47 | 3300049580 | Ga0501046_0696649 | Ga0501046_0696649_322_570 | 82 |
| 48 | 3300049581 | Ga0501047_0481621 | Ga0501047_0481621_322_570 | 82 |
| 49 | 3300049585 | Ga0501069_0130380 | Ga0501069_0130380_37_285 | 82 |
| 50 | 3300049586 | Ga0501070_0088289 | Ga0501070_0088289_1728_1976 | 82 |
| 51 | 3300049590 | Ga0501074_0069857 | Ga0501074_0069857_140_388 | 82 |
| 52 | 3300049822 | Ga0501035_0348460 | Ga0501035_0348460_701_949 | 82 |
| 53 | 3300049823 | Ga0501044_1213376 | Ga0501044_1213376_310_558 | 82 |
| 54 | 3300005327 | Ga0070658_10062197 | Ga0070658_100621974 | 83 |
| 55 | 3300005327 | Ga0070658_10097813 | Ga0070658_100978132 | 83 |
| 56 | 3300005327 | Ga0070658_10504240 | Ga0070658_105042402 | 83 |
| 57 | 3300005329 | Ga0070683_100119475 | Ga0070683_1001194755 | 83 |
| 58 | 3300005329 | Ga0070683_100225128 | Ga0070683_1002251283 | 83 |
| 59 | 3300005329 | Ga0070683_100500572 | Ga0070683_1005005723 | 83 |
| 60 | 3300005329 | Ga0070683_101446541 | Ga0070683_1014465411 | 83 |
| 61 | 3300005329 | Ga0070683_101566247 | Ga0070683_1015662472 | 83 |
| 62 | 3300005336 | Ga0070680_100153110 | Ga0070680_1001531103 | 83 |
| 63 | 3300005336 | Ga0070680_100300768 | Ga0070680_1003007683 | 83 |
| 64 | 3300005336 | Ga0070680_100852557 | Ga0070680_1008525572 | 83 |
| 65 | 3300005336 | Ga0070680_100886019 | Ga0070680_1008860192 | 83 |
| 66 | 3300005337 | Ga0070682_100206142 | Ga0070682_1002061422 | 83 |
| 67 | 3300005337 | Ga0070682_101359676 | Ga0070682_1013596761 | 83 |
| 68 | 3300005338 | Ga0068868_100591880 | Ga0068868_1005918802 | 83 |
| 69 | 3300005339 | Ga0070660_100294433 | Ga0070660_1002944332 | 83 |
| 70 | 3300005339 | Ga0070660_100295845 | Ga0070660_1002958451 | 83 |
| 71 | 3300005339 | Ga0070660_100973497 | Ga0070660_1009734972 | 83 |
| 72 | 3300005339 | Ga0070660_101274368 | Ga0070660_1012743682 | 83 |
| 73 | 3300005339 | Ga0070660_101555829 | Ga0070660_1015558291 | 83 |
| 74 | 3300005341 | Ga0070691_10821502 | Ga0070691_108215021 | 83 |
| 75 | 3300005344 | Ga0070661_100024555 | Ga0070661_1000245552 | 83 |
| 76 | 3300005344 | Ga0070661_100060619 | Ga0070661_1000606191 | 83 |
| 77 | 3300005344 | Ga0070661_100604824 | Ga0070661_1006048243 | 83 |
| 78 | 3300005344 | Ga0070661_101516816 | Ga0070661_1015168161 | 83 |
| 79 | 3300005344 | Ga0070661_101733287 | Ga0070661_1017332871 | 83 |
| 80 | 3300005366 | Ga0070659_100743076 | Ga0070659_1007430762 | 83 |
| 81 | 3300005434 | Ga0070709_10296964 | Ga0070709_102969642 | 83 |
| 82 | 3300005434 | Ga0070709_10315465 | Ga0070709_103154653 | 83 |
| 83 | 3300005435 | Ga0070714_100215125 | Ga0070714_1002151253 | 83 |
| 84 | 3300005435 | Ga0070714_100693894 | Ga0070714_1006938941 | 83 |
| 85 | 3300005436 | Ga0070713_100200048 | Ga0070713_1002000482 | 83 |
| 86 | 3300005437 | Ga0070710_10140270 | Ga0070710_101402703 | 83 |
| 87 | 3300005437 | Ga0070710_10227836 | Ga0070710_102278363 | 83 |
| 88 | 3300005437 | Ga0070710_10687766 | Ga0070710_106877662 | 83 |
| 89 | 3300005439 | Ga0070711_100013583 | Ga0070711_1000135839 | 83 |
| 90 | 3300005439 | Ga0070711_100889194 | Ga0070711_1008891942 | 83 |
| 91 | 3300005439 | Ga0070711_101065228 | Ga0070711_1010652281 | 83 |
| 92 | 3300005440 | Ga0070705_100652455 | Ga0070705_1006524553 | 83 |
| 93 | 3300005445 | Ga0070708_101193281 | Ga0070708_1011932812 | 83 |
| 94 | 3300005455 | Ga0070663_101283833 | Ga0070663_1012838332 | 83 |
| 95 | 3300005455 | Ga0070663_101308525 | Ga0070663_1013085252 | 83 |
| 96 | 3300005456 | Ga0070678_101221127 | Ga0070678_1012211272 | 83 |
| 97 | 3300005456 | Ga0070678_101649782 | Ga0070678_1016497821 | 83 |
| 98 | 3300005457 | Ga0070662_101666803 | Ga0070662_1016668032 | 83 |
| 99 | 3300005458 | Ga0070681_10017798 | Ga0070681_100177989 | 83 |
| 100 | 3300005458 | Ga0070681_10038129 | Ga0070681_100381295 | 83 |
| 101 | 3300005458 | Ga0070681_10156281 | Ga0070681_101562812 | 83 |
| 102 | 3300005458 | Ga0070681_10190537 | Ga0070681_101905372 | 83 |
| 103 | 3300005458 | Ga0070681_10279109 | Ga0070681_102791092 | 83 |
| 104 | 3300005458 | Ga0070681_10523078 | Ga0070681_105230782 | 83 |
| 105 | 3300005468 | Ga0070707_100986456 | Ga0070707_1009864562 | 83 |
| 106 | 3300005468 | Ga0070707_101411751 | Ga0070707_1014117512 | 83 |
| 107 | 3300005471 | Ga0070698_100792040 | Ga0070698_1007920401 | 83 |
| 108 | 3300005518 | Ga0070699_101510767 | Ga0070699_1015107672 | 83 |
| 109 | 3300005530 | Ga0070679_100053210 | Ga0070679_1000532102 | 83 |
| 110 | 3300005530 | Ga0070679_100146636 | Ga0070679_1001466363 | 83 |
| 111 | 3300005530 | Ga0070679_100159613 | Ga0070679_1001596131 | 83 |
| 112 | 3300005530 | Ga0070679_101784731 | Ga0070679_1017847312 | 83 |
| 113 | 3300005535 | Ga0070684_100049912 | Ga0070684_1000499123 | 83 |
| 114 | 3300005535 | Ga0070684_100230109 | Ga0070684_1002301093 | 83 |
| 115 | 3300005535 | Ga0070684_100880179 | Ga0070684_1008801792 | 83 |
| 116 | 3300005535 | Ga0070684_101035582 | Ga0070684_1010355822 | 83 |
| 117 | 3300005535 | Ga0070684_101875798 | Ga0070684_1018757981 | 83 |
| 118 | 3300005536 | Ga0070697_101572983 | Ga0070697_1015729832 | 83 |
| 119 | 3300005539 | Ga0068853_100139657 | Ga0068853_1001396573 | 83 |
| 120 | 3300005539 | Ga0068853_100261028 | Ga0068853_1002610282 | 83 |
| 121 | 3300005539 | Ga0068853_101766400 | Ga0068853_1017664002 | 83 |
| 122 | 3300005548 | Ga0070665_100011253 | Ga0070665_10001125310 | 83 |
| 123 | 3300005548 | Ga0070665_101269717 | Ga0070665_1012697172 | 83 |
| 124 | 3300005563 | Ga0068855_100076153 | Ga0068855_1000761537 | 83 |
| 125 | 3300005563 | Ga0068855_100098953 | Ga0068855_1000989536 | 83 |
| 126 | 3300005563 | Ga0068855_100301361 | Ga0068855_1003013612 | 83 |
| 127 | 3300005563 | Ga0068855_100404452 | Ga0068855_1004044522 | 83 |
| 128 | 3300005563 | Ga0068855_100591451 | Ga0068855_1005914512 | 83 |
| 129 | 3300005563 | Ga0068855_100722259 | Ga0068855_1007222592 | 83 |
| 130 | 3300005577 | Ga0068857_100336713 | Ga0068857_1003367132 | 83 |
| 131 | 3300005577 | Ga0068857_101000889 | Ga0068857_1010008893 | 83 |
| 132 | 3300005578 | Ga0068854_102033118 | Ga0068854_1020331181 | 83 |
| 133 | 3300005614 | Ga0068856_100262134 | Ga0068856_1002621343 | 83 |
| 134 | 3300005614 | Ga0068856_100282119 | Ga0068856_1002821192 | 83 |
| 135 | 3300005614 | Ga0068856_100529565 | Ga0068856_1005295653 | 83 |
| 136 | 3300005614 | Ga0068856_100630588 | Ga0068856_1006305882 | 83 |
| 137 | 3300005616 | Ga0068852_100125770 | Ga0068852_1001257703 | 83 |
| 138 | 3300005616 | Ga0068852_100384479 | Ga0068852_1003844793 | 83 |
| 139 | 3300005616 | Ga0068852_100637197 | Ga0068852_1006371972 | 83 |
| 140 | 3300005842 | Ga0068858_102327344 | Ga0068858_1023273441 | 83 |
| 141 | 3300006028 | Ga0070717_11219155 | Ga0070717_112191552 | 83 |
| 142 | 3300006163 | Ga0070715_10120062 | Ga0070715_101200622 | 83 |
| 143 | 3300006173 | Ga0070716_100313804 | Ga0070716_1003138043 | 83 |
| 144 | 3300006237 | Ga0097621_100577141 | Ga0097621_1005771413 | 83 |
| 145 | 3300006358 | Ga0068871_100166588 | Ga0068871_1001665883 | 83 |
| 146 | 3300006852 | Ga0075433_11075021 | Ga0075433_110750212 | 83 |
| 147 | 3300006871 | Ga0075434_100292884 | Ga0075434_1002928842 | 83 |
| 148 | 3300006914 | Ga0075436_100137669 | Ga0075436_1001376692 | 83 |
| 149 | 3300007076 | Ga0075435_100049753 | Ga0075435_1000497532 | 83 |
| 150 | 3300009093 | Ga0105240_10092476 | Ga0105240_100924765 | 83 |
| 151 | 3300009093 | Ga0105240_10604472 | Ga0105240_106044723 | 83 |
| 152 | 3300009093 | Ga0105240_10609632 | Ga0105240_106096322 | 83 |
| 153 | 3300009093 | Ga0105240_11001525 | Ga0105240_110015253 | 83 |
| 154 | 3300009093 | Ga0105240_11411339 | Ga0105240_114113392 | 83 |
| 155 | 3300009093 | Ga0105240_11661589 | Ga0105240_116615892 | 83 |
| 156 | 3300009093 | Ga0105240_11678798 | Ga0105240_116787982 | 83 |
| 157 | 3300009098 | Ga0105245_11015489 | Ga0105245_110154891 | 83 |
| 158 | 3300009098 | Ga0105245_12122064 | Ga0105245_121220642 | 83 |
| 159 | 3300009174 | Ga0105241_10351757 | Ga0105241_103517573 | 83 |
| 160 | 3300009174 | Ga0105241_10895225 | Ga0105241_108952252 | 83 |
| 161 | 3300009174 | Ga0105241_11118618 | Ga0105241_111186183 | 83 |
| 162 | 3300009174 | Ga0105241_11344072 | Ga0105241_113440722 | 83 |
| 163 | 3300009176 | Ga0105242_10022608 | Ga0105242_100226086 | 83 |
| 164 | 3300009176 | Ga0105242_12142923 | Ga0105242_121429232 | 83 |
| 165 | 3300009176 | Ga0105242_12318574 | Ga0105242_123185742 | 83 |
| 166 | 3300009545 | Ga0105237_10176046 | Ga0105237_101760463 | 83 |
| 167 | 3300009545 | Ga0105237_10326609 | Ga0105237_103266092 | 83 |
| 168 | 3300009545 | Ga0105237_11643281 | Ga0105237_116432812 | 83 |
| 169 | 3300009551 | Ga0105238_10237010 | Ga0105238_102370103 | 83 |
| 170 | 3300009551 | Ga0105238_10761001 | Ga0105238_107610013 | 83 |
| 171 | 3300009551 | Ga0105238_10899756 | Ga0105238_108997562 | 83 |
| 172 | 3300010375 | Ga0105239_10817819 | Ga0105239_108178192 | 83 |
| 173 | 3300010375 | Ga0105239_11067906 | Ga0105239_110679062 | 83 |
| 174 | 3300013100 | Ga0157373_10929920 | Ga0157373_109299202 | 83 |
| 175 | 3300013104 | Ga0157370_10015630 | Ga0157370_100156309 | 83 |
| 176 | 3300013104 | Ga0157370_10036790 | Ga0157370_100367906 | 83 |
| 177 | 3300013104 | Ga0157370_10177450 | Ga0157370_101774502 | 83 |
| 178 | 3300013104 | Ga0157370_10249394 | Ga0157370_102493942 | 83 |
| 179 | 3300013104 | Ga0157370_10438106 | Ga0157370_104381063 | 83 |
| 180 | 3300013104 | Ga0157370_10942473 | Ga0157370_109424732 | 83 |
| 181 | 3300013104 | Ga0157370_10990745 | Ga0157370_109907452 | 83 |
| 182 | 3300013105 | Ga0157369_10002657 | Ga0157369_100026578 | 83 |
| 183 | 3300013105 | Ga0157369_10126450 | Ga0157369_101264506 | 83 |
| 184 | 3300013105 | Ga0157369_10539486 | Ga0157369_105394862 | 83 |
| 185 | 3300013105 | Ga0157369_10652667 | Ga0157369_106526672 | 83 |
| 186 | 3300013105 | Ga0157369_10699311 | Ga0157369_106993112 | 83 |
| 187 | 3300013105 | Ga0157369_11824049 | Ga0157369_118240492 | 83 |
| 188 | 3300013105 | Ga0157369_12352150 | Ga0157369_123521502 | 83 |
| 189 | 3300013105 | Ga0157369_12387206 | Ga0157369_123872061 | 83 |
| 190 | 3300013296 | Ga0157374_10952066 | Ga0157374_109520662 | 83 |
| 191 | 3300013297 | Ga0157378_10202794 | Ga0157378_102027943 | 83 |
| 192 | 3300013297 | Ga0157378_11109875 | Ga0157378_111098752 | 83 |
| 193 | 3300013307 | Ga0157372_10040317 | Ga0157372_100403176 | 83 |
| 194 | 3300013307 | Ga0157372_10315109 | Ga0157372_103151093 | 83 |
| 195 | 3300013307 | Ga0157372_10470703 | Ga0157372_104707033 | 83 |
| 196 | 3300013307 | Ga0157372_12383447 | Ga0157372_123834472 | 83 |
| 197 | 3300013307 | Ga0157372_12918432 | Ga0157372_129184322 | 83 |
| 198 | 3300013307 | Ga0157372_13034919 | Ga0157372_130349192 | 83 |
| 199 | 3300013308 | Ga0157375_12109058 | Ga0157375_121090582 | 83 |
| 200 | 3300014497 | Ga0182008_10051801 | Ga0182008_100518011 | 83 |
| 201 | 3300014497 | Ga0182008_10130853 | Ga0182008_101308532 | 83 |
| 202 | 3300014497 | Ga0182008_10196099 | Ga0182008_101960992 | 83 |
| 203 | 3300014497 | Ga0182008_10439384 | Ga0182008_104393842 | 83 |
| 204 | 3300014497 | Ga0182008_10598067 | Ga0182008_105980671 | 83 |
| 205 | 3300014969 | Ga0157376_11458542 | Ga0157376_114585422 | 83 |
| 206 | 3300015261 | Ga0182006_1290120 | Ga0182006_12901202 | 83 |
| 207 | 3300015262 | Ga0182007_10124110 | Ga0182007_101241102 | 83 |
| 208 | 3300015262 | Ga0182007_10261022 | Ga0182007_102610222 | 83 |
| 209 | 3300020069 | Ga0197907_11154728 | Ga0197907_111547282 | 83 |
| 210 | 3300020070 | Ga0206356_10212333 | Ga0206356_102123333 | 83 |
| 211 | 3300020070 | Ga0206356_10602804 | Ga0206356_106028042 | 83 |
| 212 | 3300020070 | Ga0206356_10900205 | Ga0206356_109002053 | 83 |
| 213 | 3300020070 | Ga0206356_10985006 | Ga0206356_109850062 | 83 |
| 214 | 3300020070 | Ga0206356_11621634 | Ga0206356_116216343 | 83 |
| 215 | 3300020070 | Ga0206356_11651324 | Ga0206356_116513243 | 83 |
| 216 | 3300020081 | Ga0206354_10547085 | Ga0206354_105470852 | 83 |
| 217 | 3300020081 | Ga0206354_10974966 | Ga0206354_109749662 | 83 |
| 218 | 3300020081 | Ga0206354_11443079 | Ga0206354_114430792 | 83 |
| 219 | 3300020082 | Ga0206353_10119475 | Ga0206353_101194752 | 83 |
| 220 | 3300020082 | Ga0206353_10203657 | Ga0206353_102036572 | 83 |
| 221 | 3300020082 | Ga0206353_10379293 | Ga0206353_103792932 | 83 |
| 222 | 3300020082 | Ga0206353_12046548 | Ga0206353_120465482 | 83 |
| 223 | 3300025898 | Ga0207692_10254480 | Ga0207692_102544803 | 83 |
| 224 | 3300025898 | Ga0207692_10391886 | Ga0207692_103918861 | 83 |
| 225 | 3300025898 | Ga0207692_10425751 | Ga0207692_104257512 | 83 |
| 226 | 3300025905 | Ga0207685_10166623 | Ga0207685_101666233 | 83 |
| 227 | 3300025905 | Ga0207685_10551124 | Ga0207685_105511242 | 83 |
| 228 | 3300025906 | Ga0207699_10229628 | Ga0207699_102296283 | 83 |
| 229 | 3300025909 | Ga0207705_10038581 | Ga0207705_100385812 | 83 |
| 230 | 3300025911 | Ga0207654_10275734 | Ga0207654_102757342 | 83 |
| 231 | 3300025911 | Ga0207654_10279964 | Ga0207654_102799642 | 83 |
| 232 | 3300025911 | Ga0207654_11059716 | Ga0207654_110597162 | 83 |
| 233 | 3300025912 | Ga0207707_10006845 | Ga0207707_100068455 | 83 |
| 234 | 3300025912 | Ga0207707_10034460 | Ga0207707_100344605 | 83 |
| 235 | 3300025912 | Ga0207707_10258541 | Ga0207707_102585412 | 83 |
| 236 | 3300025912 | Ga0207707_10529672 | Ga0207707_105296723 | 83 |
| 237 | 3300025913 | Ga0207695_10040302 | Ga0207695_100403023 | 83 |
| 238 | 3300025913 | Ga0207695_10126563 | Ga0207695_101265635 | 83 |
| 239 | 3300025913 | Ga0207695_10807599 | Ga0207695_108075992 | 83 |
| 240 | 3300025913 | Ga0207695_10887671 | Ga0207695_108876713 | 83 |
| 241 | 3300025913 | Ga0207695_10897261 | Ga0207695_108972612 | 83 |
| 242 | 3300025914 | Ga0207671_10070235 | Ga0207671_100702353 | 83 |
| 243 | 3300025914 | Ga0207671_10252371 | Ga0207671_102523712 | 83 |
| 244 | 3300025915 | Ga0207693_10621426 | Ga0207693_106214262 | 83 |
| 245 | 3300025916 | Ga0207663_10008237 | Ga0207663_100082373 | 83 |
| 246 | 3300025916 | Ga0207663_10358400 | Ga0207663_103584003 | 83 |
| 247 | 3300025916 | Ga0207663_11554184 | Ga0207663_115541842 | 83 |
| 248 | 3300025917 | Ga0207660_10038517 | Ga0207660_100385173 | 83 |
| 249 | 3300025917 | Ga0207660_10237079 | Ga0207660_102370792 | 83 |
| 250 | 3300025917 | Ga0207660_10352203 | Ga0207660_103522032 | 83 |
| 251 | 3300025917 | Ga0207660_11123413 | Ga0207660_111234132 | 83 |
| 252 | 3300025919 | Ga0207657_10012342 | Ga0207657_100123428 | 83 |
| 253 | 3300025919 | Ga0207657_10042675 | Ga0207657_100426751 | 83 |
| 254 | 3300025919 | Ga0207657_10234387 | Ga0207657_102343873 | 83 |
| 255 | 3300025919 | Ga0207657_10315293 | Ga0207657_103152933 | 83 |
| 256 | 3300025919 | Ga0207657_10374978 | Ga0207657_103749782 | 83 |
| 257 | 3300025920 | Ga0207649_10550181 | Ga0207649_105501813 | 83 |
| 258 | 3300025920 | Ga0207649_10865025 | Ga0207649_108650252 | 83 |
| 259 | 3300025920 | Ga0207649_10993820 | Ga0207649_109938202 | 83 |
| 260 | 3300025921 | Ga0207652_10058222 | Ga0207652_100582225 | 83 |
| 261 | 3300025921 | Ga0207652_10176814 | Ga0207652_101768142 | 83 |
| 262 | 3300025921 | Ga0207652_10384415 | Ga0207652_103844152 | 83 |
| 263 | 3300025921 | Ga0207652_11509310 | Ga0207652_115093102 | 83 |
| 264 | 3300025922 | Ga0207646_11573269 | Ga0207646_115732692 | 83 |
| 265 | 3300025924 | Ga0207694_10128491 | Ga0207694_101284913 | 83 |
| 266 | 3300025924 | Ga0207694_10272545 | Ga0207694_102725453 | 83 |
| 267 | 3300025924 | Ga0207694_10542028 | Ga0207694_105420283 | 83 |
| 268 | 3300025925 | Ga0207650_11354546 | Ga0207650_113545462 | 83 |
| 269 | 3300025928 | Ga0207700_11901263 | Ga0207700_119012632 | 83 |
| 270 | 3300025929 | Ga0207664_10110404 | Ga0207664_101104042 | 83 |
| 271 | 3300025929 | Ga0207664_10146145 | Ga0207664_101461453 | 83 |
| 272 | 3300025929 | Ga0207664_10443211 | Ga0207664_104432112 | 83 |
| 273 | 3300025929 | Ga0207664_11093410 | Ga0207664_110934102 | 83 |
| 274 | 3300025929 | Ga0207664_11295758 | Ga0207664_112957582 | 83 |
| 275 | 3300025934 | Ga0207686_10026385 | Ga0207686_100263853 | 83 |
| 276 | 3300025934 | Ga0207686_11797206 | Ga0207686_117972062 | 83 |
| 277 | 3300025939 | Ga0207665_10352578 | Ga0207665_103525782 | 83 |
| 278 | 3300025944 | Ga0207661_10219213 | Ga0207661_102192133 | 83 |
| 279 | 3300025944 | Ga0207661_10733126 | Ga0207661_107331263 | 83 |
| 280 | 3300025944 | Ga0207661_11920036 | Ga0207661_119200362 | 83 |
| 281 | 3300025945 | Ga0207679_10856665 | Ga0207679_108566651 | 83 |
| 282 | 3300025949 | Ga0207667_10089901 | Ga0207667_100899012 | 83 |
| 283 | 3300025949 | Ga0207667_10193033 | Ga0207667_101930332 | 83 |
| 284 | 3300025949 | Ga0207667_10392924 | Ga0207667_103929243 | 83 |
| 285 | 3300025949 | Ga0207667_10522619 | Ga0207667_105226193 | 83 |
| 286 | 3300025949 | Ga0207667_11100607 | Ga0207667_111006073 | 83 |
| 287 | 3300025949 | Ga0207667_11628129 | Ga0207667_116281292 | 83 |
| 288 | 3300025949 | Ga0207667_11923042 | Ga0207667_119230422 | 83 |
| 289 | 3300025981 | Ga0207640_10291217 | Ga0207640_102912172 | 83 |
| 290 | 3300025986 | Ga0207658_10004832 | Ga0207658_100048328 | 83 |
| 291 | 3300026035 | Ga0207703_10215430 | Ga0207703_102154303 | 83 |
| 292 | 3300026041 | Ga0207639_10347792 | Ga0207639_103477922 | 83 |
| 293 | 3300026041 | Ga0207639_11055905 | Ga0207639_110559053 | 83 |
| 294 | 3300026067 | Ga0207678_10180042 | Ga0207678_101800422 | 83 |
| 295 | 3300026067 | Ga0207678_11001189 | Ga0207678_110011892 | 83 |
| 296 | 3300026078 | Ga0207702_10737219 | Ga0207702_107372192 | 83 |
| 297 | 3300026116 | Ga0207674_10300614 | Ga0207674_103006142 | 83 |
| 298 | 3300026116 | Ga0207674_10362945 | Ga0207674_103629452 | 83 |
| 299 | 3300026121 | Ga0207683_10161621 | Ga0207683_101616212 | 83 |
| 300 | 3300026142 | Ga0207698_10074300 | Ga0207698_100743002 | 83 |
| 301 | 3300026142 | Ga0207698_11272475 | Ga0207698_112724752 | 83 |
| 302 | 3300028379 | Ga0268266_10025493 | Ga0268266_100254937 | 83 |
| 303 | 3300028379 | Ga0268266_11021513 | Ga0268266_110215132 | 83 |
| 304 | 3300028573 | Ga0265334_10293483 | Ga0265334_102934832 | 83 |
| 305 | 3300028577 | Ga0265318_10119073 | Ga0265318_101190733 | 83 |
| 306 | 3300028654 | Ga0265322_10013003 | Ga0265322_100130032 | 83 |
| 307 | 3300028800 | Ga0265338_10054346 | Ga0265338_100543463 | 83 |
| 308 | 3300028800 | Ga0265338_11136464 | Ga0265338_111364641 | 83 |
| 309 | 3300031235 | Ga0265330_10063123 | Ga0265330_100631232 | 83 |
| 310 | 3300031241 | Ga0265325_10146629 | Ga0265325_101466292 | 83 |
| 311 | 3300031249 | Ga0265339_10041736 | Ga0265339_100417361 | 83 |
| 312 | 3300031250 | Ga0265331_10145100 | Ga0265331_101451002 | 83 |
| 313 | 3300031250 | Ga0265331_10168352 | Ga0265331_101683522 | 83 |
| 314 | 3300031251 | Ga0265327_10008869 | Ga0265327_100088698 | 83 |
| 315 | 3300031344 | Ga0265316_10008441 | Ga0265316_1000844111 | 83 |
| 316 | 3300031595 | Ga0265313_10002660 | Ga0265313_1000266014 | 83 |
| 317 | 3300031711 | Ga0265314_10003929 | Ga0265314_1000392910 | 83 |
| 318 | 3300031712 | Ga0265342_10021116 | Ga0265342_100211163 | 83 |
| 319 | 3300035083 | Ga0373926_0010942 | Ga0373926_0010942_2438_2689 | 83 |
| 320 | 3300035083 | Ga0373926_0141747 | Ga0373926_0141747_101_352 | 83 |
| 321 | 3300035089 | Ga0373944_0008204 | Ga0373944_0008204_66_317 | 83 |
| 322 | 3300035113 | Ga0373936_0014573 | Ga0373936_0014573_2288_2539 | 83 |
| 323 | 3300035113 | Ga0373936_0031561 | Ga0373936_0031561_83_334 | 83 |
| 324 | 3300035116 | Ga0373945_0003761 | Ga0373945_0003761_2417_2668 | 83 |
| 325 | 3300035116 | Ga0373945_0036219 | Ga0373945_0036219_1326_1577 | 83 |
| 326 | 3300035170 | Ga0373943_0000538 | Ga0373943_0000538_11446_11697 | 83 |
| 327 | 3300035170 | Ga0373943_0014138 | Ga0373943_0014138_2581_2832 | 83 |
| 328 | 3300035171 | Ga0373946_0761651 | Ga0373946_0761651_143_394 | 83 |
| 329 | 3300035410 | Ga0373924_0485403 | Ga0373924_0485403_246_497 | 83 |
| 330 | 3300035692 | Ga0373935_0087987 | Ga0373935_0087987_472_723 | 83 |
| 331 | 3300035692 | Ga0373935_0109829 | Ga0373935_0109829_922_1173 | 83 |
| 332 | 3300035695 | Ga0373927_0025083 | Ga0373927_0025083_473_724 | 83 |
| 333 | 3300035725 | Ga0373947_0000066 | Ga0373947_0000066_12001_12252 | 83 |
| 334 | 3300035725 | Ga0373947_0003591 | Ga0373947_0003591_5954_6205 | 83 |
| 335 | 3300036401 | Ga0373937_0227948 | Ga0373937_0227948_1063_1317 | 83 |
| 336 | 3300037068 | Ga0373925_0003351 | Ga0373925_0003351_7102_7353 | 83 |
| 337 | 3300037068 | Ga0373925_0033365 | Ga0373925_0033365_555_806 | 83 |
| 338 | 3300037312 | Ga0395899_0271593 | Ga0395899_0271593_87_338 | 83 |
| 339 | 3300037418 | Ga0395900_0168172 | Ga0395900_0168172_764_1015 | 83 |
| 340 | 3300037418 | Ga0395900_1013075 | Ga0395900_1013075_443_694 | 83 |
| 341 | 3300037418 | Ga0395900_1735454 | Ga0395900_1735454_177_428 | 83 |
| 342 | 3300037466 | Ga0395898_0134482 | Ga0395898_0134482_955_1206 | 83 |
| 343 | 3300037466 | Ga0395898_0144583 | Ga0395898_0144583_738_989 | 83 |
| 344 | 3300037466 | Ga0395898_0590784 | Ga0395898_0590784_745_996 | 83 |
| 345 | 3300037466 | Ga0395898_0597639 | Ga0395898_0597639_519_770 | 83 |
| 346 | 3300037471 | Ga0395905_0036251 | Ga0395905_0036251_1333_1584 | 83 |
| 347 | 3300038443 | Ga0395901_0033926 | Ga0395901_0033926_4519_4770 | 83 |
| 348 | 3300038443 | Ga0395901_0121797 | Ga0395901_0121797_1832_2083 | 83 |
| 349 | 3300042005 | Ga0439448_0245944 | Ga0439448_0245944_325_588 | 83 |
| 350 | 3300044656 | Ga0466969_0182511 | Ga0466969_0182511_222_479 | 83 |
| 351 | 3300044658 | Ga0466972_0365937 | Ga0466972_0365937_230_484 | 83 |
| 352 | 3300044658 | Ga0466972_0506811 | Ga0466972_0506811_71_331 | 83 |
| 353 | 3300044683 | Ga0466965_0223203 | Ga0466965_0223203_225_485 | 83 |
| 354 | 3300044684 | Ga0466966_0023644 | Ga0466966_0023644_53_313 | 83 |
| 355 | 3300044684 | Ga0466966_0030664 | Ga0466966_0030664_1483_1734 | 83 |
| 356 | 3300044684 | Ga0466966_0070743 | Ga0466966_0070743_158_412 | 83 |
| 357 | 3300044693 | Ga0466961_0000424 | Ga0466961_0000424_5039_5293 | 83 |
| 358 | 3300044693 | Ga0466961_0031926 | Ga0466961_0031926_2155_2406 | 83 |
| 359 | 3300044693 | Ga0466961_0043938 | Ga0466961_0043938_2014_2271 | 83 |
| 360 | 3300044693 | Ga0466961_0081722 | Ga0466961_0081722_1688_1948 | 83 |
| 361 | 3300044693 | Ga0466961_0845817 | Ga0466961_0845817_238_501 | 83 |
| 362 | 3300044694 | Ga0466963_0002241 | Ga0466963_0002241_3622_3873 | 83 |
| 363 | 3300044694 | Ga0466963_0017573 | Ga0466963_0017573_1375_1632 | 83 |
| 364 | 3300044694 | Ga0466963_0237634 | Ga0466963_0237634_574_828 | 83 |
| 365 | 3300044694 | Ga0466963_0280746 | Ga0466963_0280746_26_283 | 83 |
| 366 | 3300044694 | Ga0466963_0499790 | Ga0466963_0499790_362_622 | 83 |
| 367 | 3300044706 | Ga0466964_0002641 | Ga0466964_0002641_5937_6188 | 83 |
| 368 | 3300044706 | Ga0466964_0185908 | Ga0466964_0185908_213_467 | 83 |
| 369 | 3300044719 | Ga0466971_0001169 | Ga0466971_0001169_3889_4143 | 83 |
| 370 | 3300044719 | Ga0466971_0054512 | Ga0466971_0054512_1041_1301 | 83 |
| 371 | 3300044719 | Ga0466971_0070049 | Ga0466971_0070049_84_404 | 83 |
| 372 | 3300044735 | Ga0466968_0006432 | Ga0466968_0006432_1813_2070 | 83 |
| 373 | 3300044735 | Ga0466968_0327035 | Ga0466968_0327035_139_399 | 83 |
| 374 | 3300044765 | Ga0466970_0090985 | Ga0466970_0090985_55_309 | 83 |
| 375 | 3300044842 | Ga0466957_0000598 | Ga0466957_0000598_18032_18286 | 83 |
| 376 | 3300044842 | Ga0466957_0124850 | Ga0466957_0124850_136_390 | 83 |
| 377 | 3300044842 | Ga0466957_0521968 | Ga0466957_0521968_430_690 | 83 |
| 378 | 3300044842 | Ga0466957_0744322 | Ga0466957_0744322_309_563 | 83 |
| 379 | 3300044901 | Ga0466960_0120950 | Ga0466960_0120950_933_1199 | 83 |
| 380 | 3300044901 | Ga0466960_0490225 | Ga0466960_0490225_381_641 | 83 |
| 381 | 3300045049 | Ga0466959_0013344 | Ga0466959_0013344_4774_5025 | 83 |
| 382 | 3300045049 | Ga0466959_0050603 | Ga0466959_0050603_2141_2395 | 83 |
| 383 | 3300045049 | Ga0466959_0061341 | Ga0466959_0061341_2205_2465 | 83 |
| 384 | 3300045049 | Ga0466959_0177405 | Ga0466959_0177405_706_969 | 83 |
| 385 | 3300045049 | Ga0466959_0273973 | Ga0466959_0273973_142_399 | 83 |
| 386 | 3300045051 | Ga0451576_0270243 | Ga0451576_0270243_994_1254 | 83 |
| 387 | 3300045836 | Ga0466958_0002350 | Ga0466958_0002350_8514_8768 | 83 |
| 388 | 3300045836 | Ga0466958_0011139 | Ga0466958_0011139_1393_1653 | 83 |
| 389 | 3300045836 | Ga0466958_0022990 | Ga0466958_0022990_3010_3270 | 83 |
| 390 | 3300045836 | Ga0466958_0644653 | Ga0466958_0644653_98_355 | 83 |
| 391 | 3300045836 | Ga0466958_0829750 | Ga0466958_0829750_299_553 | 83 |
| 392 | 3300045976 | Ga0466967_0000221 | Ga0466967_0000221_1404_1655 | 83 |
| 393 | 3300045976 | Ga0466967_0002137 | Ga0466967_0002137_6399_6650 | 83 |
| 394 | 3300045976 | Ga0466967_0002877 | Ga0466967_0002877_1732_1986 | 83 |
| 395 | 3300045976 | Ga0466967_0013743 | Ga0466967_0013743_3744_3998 | 83 |
| 396 | 3300045976 | Ga0466967_0094365 | Ga0466967_0094365_2310_2567 | 83 |
| 397 | 3300045976 | Ga0466967_0108376 | Ga0466967_0108376_345_602 | 83 |
| 398 | 3300045976 | Ga0466967_0142539 | Ga0466967_0142539_141_395 | 83 |
| 399 | 3300045976 | Ga0466967_0226024 | Ga0466967_0226024_1087_1353 | 83 |
| 400 | 3300045976 | Ga0466967_0270845 | Ga0466967_0270845_827_1087 | 83 |
| 401 | 3300045976 | Ga0466967_0493690 | Ga0466967_0493690_657_908 | 83 |
| 402 | 3300045976 | Ga0466967_0819939 | Ga0466967_0819939_279_530 | 83 |
| 403 | 3300045976 | Ga0466967_0919477 | Ga0466967_0919477_106_363 | 83 |
| 404 | 3300045976 | Ga0466967_0946046 | Ga0466967_0946046_347_619 | 83 |
| 405 | 3300045976 | Ga0466967_1714386 | Ga0466967_1714386_35_286 | 83 |
| 406 | 3300045976 | Ga0466967_2030007 | Ga0466967_2030007_291_548 | 83 |
| 407 | 3300045976 | Ga0466967_2296544 | Ga0466967_2296544_265_516 | 83 |
| 408 | 3300046455 | Ga0495603_0363413 | Ga0495603_0363413_248_499 | 83 |
| 409 | 3300046459 | Ga0495629_0000194 | Ga0495629_0000194_1582_1833 | 83 |
| 410 | 3300046461 | Ga0495641_0000850 | Ga0495641_0000850_22202_22453 | 83 |
| 411 | 3300046462 | Ga0495651_0025004 | Ga0495651_0025004_4065_4316 | 83 |
| 412 | 3300046462 | Ga0495651_0037562 | Ga0495651_0037562_1304_1558 | 83 |
| 413 | 3300046463 | Ga0495653_0026482 | Ga0495653_0026482_736_987 | 83 |
| 414 | 3300046473 | Ga0495582_0000317 | Ga0495582_0000317_16861_17112 | 83 |
| 415 | 3300046473 | Ga0495582_0066628 | Ga0495582_0066628_959_1210 | 83 |
| 416 | 3300046474 | Ga0495605_0050655 | Ga0495605_0050655_1608_1862 | 83 |
| 417 | 3300046475 | Ga0495639_0001774 | Ga0495639_0001774_6710_6961 | 83 |
| 418 | 3300046476 | Ga0495662_0053966 | Ga0495662_0053966_758_1009 | 83 |
| 419 | 3300046477 | Ga0495664_0022024 | Ga0495664_0022024_3184_3438 | 83 |
| 420 | 3300046477 | Ga0495664_0251138 | Ga0495664_0251138_724_975 | 83 |
| 421 | 3300046499 | Ga0495594_0103780 | Ga0495594_0103780_1071_1322 | 83 |
| 422 | 3300046511 | Ga0495608_0043053 | Ga0495608_0043053_2446_2700 | 83 |
| 423 | 3300046511 | Ga0495608_0067597 | Ga0495608_0067597_1118_1369 | 83 |
| 424 | 3300046514 | Ga0495618_0044439 | Ga0495618_0044439_2481_2732 | 83 |
| 425 | 3300046516 | Ga0495628_0045334 | Ga0495628_0045334_213_464 | 83 |
| 426 | 3300046517 | Ga0495630_0069394 | Ga0495630_0069394_1893_2144 | 83 |
| 427 | 3300046517 | Ga0495630_0117512 | Ga0495630_0117512_1657_1908 | 83 |
| 428 | 3300046526 | Ga0495666_0117399 | Ga0495666_0117399_813_1064 | 83 |
| 429 | 3300046529 | Ga0495652_0160597 | Ga0495652_0160597_828_1079 | 83 |
| 430 | 3300046531 | Ga0495665_0030981 | Ga0495665_0030981_1216_1467 | 83 |
| 431 | 3300046535 | Ga0495586_0148751 | Ga0495586_0148751_100_351 | 83 |
| 432 | 3300046536 | Ga0495587_0084731 | Ga0495587_0084731_774_1025 | 83 |
| 433 | 3300046543 | Ga0495645_0028989 | Ga0495645_0028989_3082_3333 | 83 |
| 434 | 3300046559 | Ga0495667_0023127 | Ga0495667_0023127_3871_4122 | 83 |
| 435 | 3300046559 | Ga0495667_0137838 | Ga0495667_0137838_1301_1555 | 83 |
| 436 | 3300046559 | Ga0495667_0816426 | Ga0495667_0816426_132_383 | 83 |
| 437 | 3300046642 | Ga0495634_0025218 | Ga0495634_0025218_3185_3436 | 83 |
| 438 | 3300046663 | Ga0495635_0051537 | Ga0495635_0051537_2382_2633 | 83 |
| 439 | 3300046674 | Ga0495588_0713411 | Ga0495588_0713411_192_443 | 83 |
| 440 | 3300046675 | Ga0495657_0261949 | Ga0495657_0261949_17_271 | 83 |
| 441 | 3300046675 | Ga0495657_0638657 | Ga0495657_0638657_269_520 | 83 |
| 442 | 3300046678 | Ga0495599_0061543 | Ga0495599_0061543_508_759 | 83 |
| 443 | 3300046680 | Ga0495646_0607810 | Ga0495646_0607810_182_436 | 83 |
| 444 | 3300046681 | Ga0495647_0004994 | Ga0495647_0004994_2701_2952 | 83 |
| 445 | 3300046683 | Ga0495658_0000224 | Ga0495658_0000224_9094_9345 | 83 |
| 446 | 3300046683 | Ga0495658_0103528 | Ga0495658_0103528_558_809 | 83 |
| 447 | 3300046689 | Ga0495613_0001177 | Ga0495613_0001177_756_1007 | 83 |
| 448 | 3300046689 | Ga0495613_0035864 | Ga0495613_0035864_959_1210 | 83 |
| 449 | 3300046690 | Ga0495624_0010250 | Ga0495624_0010250_594_845 | 83 |
| 450 | 3300046809 | Ga0495600_0002823 | Ga0495600_0002823_9757_10008 | 83 |
| 451 | 3300046809 | Ga0495600_0052183 | Ga0495600_0052183_226_477 | 83 |
| 452 | 3300046809 | Ga0495600_0449906 | Ga0495600_0449906_38_292 | 83 |
| 453 | 3300047315 | Ga0495581_0001581 | Ga0495581_0001581_6840_7091 | 83 |
| 454 | 3300047317 | Ga0495604_0008755 | Ga0495604_0008755_5894_6145 | 83 |
| 455 | 3300047317 | Ga0495604_0385655 | Ga0495604_0385655_343_597 | 83 |
| 456 | 3300047319 | Ga0495674_0260957 | Ga0495674_0260957_45_296 | 83 |
| 457 | 3300047319 | Ga0495674_0403296 | Ga0495674_0403296_45_296 | 83 |
| 458 | 3300047321 | Ga0495676_0002504 | Ga0495676_0002504_380_631 | 83 |
| 459 | 3300047321 | Ga0495676_0049841 | Ga0495676_0049841_1113_1364 | 83 |
| 460 | 3300047322 | Ga0495680_0006155 | Ga0495680_0006155_4115_4366 | 83 |
| 461 | 3300047322 | Ga0495680_0930331 | Ga0495680_0930331_225_503 | 83 |
| 462 | 3300047444 | Ga0495675_0089447 | Ga0495675_0089447_1288_1539 | 83 |
| 463 | 3300047471 | Ga0495684_0057953 | Ga0495684_0057953_1985_2236 | 83 |
| 464 | 3300047471 | Ga0495684_0118247 | Ga0495684_0118247_152_403 | 83 |
| 465 | 3300047673 | Ga0495593_0012213 | Ga0495593_0012213_1743_1994 | 83 |
| 466 | 3300048088 | Ga0495602_0445319 | Ga0495602_0445319_245_499 | 83 |
| 467 | 3300048089 | Ga0495614_0002669 | Ga0495614_0002669_7335_7586 | 83 |
| 468 | 3300048089 | Ga0495614_0118667 | Ga0495614_0118667_621_872 | 83 |
| 469 | 3300048903 | Ga0496100_0007025 | Ga0496100_0007025_329_586 | 83 |
| 470 | 3300048903 | Ga0496100_0030659 | Ga0496100_0030659_181_447 | 83 |
| 471 | 3300048903 | Ga0496100_0085189 | Ga0496100_0085189_1701_1952 | 83 |
| 472 | 3300048903 | Ga0496100_0146082 | Ga0496100_0146082_507_758 | 83 |
| 473 | 3300048903 | Ga0496100_0620669 | Ga0496100_0620669_120_419 | 83 |
| 474 | 3300048904 | Ga0496101_0005132 | Ga0496101_0005132_110_367 | 83 |
| 475 | 3300048904 | Ga0496101_0026950 | Ga0496101_0026950_485_784 | 83 |
| 476 | 3300048904 | Ga0496101_0094320 | Ga0496101_0094320_607_873 | 83 |
| 477 | 3300048904 | Ga0496101_0106271 | Ga0496101_0106271_1157_1408 | 83 |
| 478 | 3300048905 | Ga0496102_0206878 | Ga0496102_0206878_559_858 | 83 |
| 479 | 3300048905 | Ga0496102_0322514 | Ga0496102_0322514_99_350 | 83 |
| 480 | 3300048905 | Ga0496102_0476866 | Ga0496102_0476866_288_539 | 83 |
| 481 | 3300048905 | Ga0496102_0721240 | Ga0496102_0721240_190_441 | 83 |
| 482 | 3300048906 | Ga0496103_0067591 | Ga0496103_0067591_1241_1540 | 83 |
| 483 | 3300048906 | Ga0496103_0540089 | Ga0496103_0540089_97_348 | 83 |
| 484 | 3300048907 | Ga0496104_0013997 | Ga0496104_0013997_1558_1830 | 83 |
| 485 | 3300048907 | Ga0496104_0134903 | Ga0496104_0134903_1370_1621 | 83 |
| 486 | 3300048908 | Ga0496105_0016517 | Ga0496105_0016517_5576_5848 | 83 |
| 487 | 3300048908 | Ga0496105_0080302 | Ga0496105_0080302_2309_2560 | 83 |
| 488 | 3300048908 | Ga0496105_0422944 | Ga0496105_0422944_593_844 | 83 |
| 489 | 3300048909 | Ga0496106_0010080 | Ga0496106_0010080_4655_4921 | 83 |
| 490 | 3300048909 | Ga0496106_0065857 | Ga0496106_0065857_373_630 | 83 |
| 491 | 3300048909 | Ga0496106_0138875 | Ga0496106_0138875_1146_1445 | 83 |
| 492 | 3300048910 | Ga0496107_0070179 | Ga0496107_0070179_2176_2448 | 83 |
| 493 | 3300048910 | Ga0496107_0122337 | Ga0496107_0122337_1358_1624 | 83 |
| 494 | 3300048910 | Ga0496107_0395070 | Ga0496107_0395070_607_858 | 83 |
| 495 | 3300048910 | Ga0496107_0580209 | Ga0496107_0580209_46_345 | 83 |
| 496 | 3300048911 | Ga0496108_0039156 | Ga0496108_0039156_2408_2665 | 83 |
| 497 | 3300048912 | Ga0496109_0025879 | Ga0496109_0025879_1207_1479 | 83 |
| 498 | 3300048913 | Ga0496110_0357001 | Ga0496110_0357001_718_975 | 83 |
| 499 | 3300048914 | Ga0496111_0022179 | Ga0496111_0022179_1766_2023 | 83 |
| 500 | 3300048915 | Ga0496112_0058996 | Ga0496112_0058996_2403_2654 | 83 |
| 501 | 3300048915 | Ga0496112_0138139 | Ga0496112_0138139_646_918 | 83 |
| 502 | 3300048916 | Ga0496113_0068055 | Ga0496113_0068055_965_1222 | 83 |
| 503 | 3300048916 | Ga0496113_0615543 | Ga0496113_0615543_409_693 | 83 |
| 504 | 3300048917 | Ga0496114_0002271 | Ga0496114_0002271_11474_11725 | 83 |
| 505 | 3300048917 | Ga0496114_0019327 | Ga0496114_0019327_577_834 | 83 |
| 506 | 3300048917 | Ga0496114_0078049 | Ga0496114_0078049_739_990 | 83 |
| 507 | 3300048917 | Ga0496114_0248069 | Ga0496114_0248069_1160_1459 | 83 |
| 508 | 3300048918 | Ga0496115_0003388 | Ga0496115_0003388_5065_5322 | 83 |
| 509 | 3300048918 | Ga0496115_0003556 | Ga0496115_0003556_7332_7583 | 83 |
| 510 | 3300048918 | Ga0496115_0010180 | Ga0496115_0010180_5374_5625 | 83 |
| 511 | 3300049583 | Ga0501067_0000845 | Ga0501067_0000845_950_1201 | 83 |
| 512 | 3300049583 | Ga0501067_0170486 | Ga0501067_0170486_122_373 | 83 |
| 513 | 3300049584 | Ga0501068_0486858 | Ga0501068_0486858_82_333 | 83 |
| 514 | 3300049585 | Ga0501069_0001111 | Ga0501069_0001111_2426_2677 | 83 |
| 515 | 3300049585 | Ga0501069_0222881 | Ga0501069_0222881_99_350 | 83 |
| 516 | 3300049585 | Ga0501069_0572757 | Ga0501069_0572757_362_613 | 83 |
| 517 | 3300049586 | Ga0501070_0877017 | Ga0501070_0877017_297_548 | 83 |
| 518 | 3300049743 | Ga0501081_0629947 | Ga0501081_0629947_409_660 | 83 |
| 519 | 3300050512 | nmdc:mga0n895_63654_c1 | nmdc:mga0n895_63654_c1_1081_1347 | 83 |
| 520 | 3300050513 | nmdc:mga0rr50_5367_c1 | nmdc:mga0rr50_5367_c1_2521_2787 | 83 |
| 521 | 3300050514 | nmdc:mga08x19_91593_c1 | nmdc:mga08x19_91593_c1_496_762 | 83 |
| 522 | 3300053077 | Ga0495601_0077459 | Ga0495601_0077459_1621_1872 | 83 |
| 523 | 3300053078 | Ga0495612_0009638 | Ga0495612_0009638_2242_2493 | 83 |
| 524 | 3300053083 | Ga0495655_0000869 | Ga0495655_0000869_897_1151 | 83 |
| 525 | 3300053084 | Ga0495595_0007508 | Ga0495595_0007508_2027_2278 | 83 |
| 526 | 3300053084 | Ga0495595_0106303 | Ga0495595_0106303_772_1026 | 83 |
| 527 | 3300053085 | Ga0495619_0112832 | Ga0495619_0112832_52_303 | 83 |
| 528 | 3300061719 | Ga0466962_0000257 | Ga0466962_0000257_19449_19703 | 83 |
| 529 | 3300061719 | Ga0466962_0224272 | Ga0466962_0224272_408_668 | 83 |
| 530 | 3300061734 | Ga0530510_0039653 | Ga0530510_0039653_2894_3145 | 83 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xmo-assembly1.cif.gz_A | the crystal structure of lmo2642 | 0.9498 | 50 | 65 |
| 7xv0-assembly1.cif.gz_A | crystal structure of rpa70n-blmp1 fusion | 0.8242 | 50 | 66 |
| 4ipg-assembly1.cif.gz_A | structure of the n-terminal domain of rpa70, e7r, e100r mutant | 0.8157 | 50 | 66 |
| 7zd7-assembly1.cif.gz_A | crystal structure of the r24e/e352t double mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations | 0.8153 | 49 | 64 |
| 5eay-assembly1.cif.gz_B | crystal structure of a dna2 peptide in complex with rpa 70n | 0.7995 | 50 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xmoA01 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.9498 | 50 | 65 | 3.60.21.10 |
| 3sk1A02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8512 | 50 | 66 | 3.30.720.110 |
| af_Q8IIN5_1_445_1.10.1370.30 | Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; | 0.7385 | 48 | 67 | 1.10.1370.30 |
| af_I1NGP4_33_562_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7359 | 41 | 68 | 3.50.50.60 |
| af_Q9C8U5_24_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7355 | 50 | 65 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538J393-F1-model_v4 | Uncharacterized protein | 0.9414 | 2 | 65 |
|
| AF-A0A7Y6CF62-F1-model_v4 | Uncharacterized protein | 0.9109 | 2 | 71 |
|
| AF-A0A134A868-F1-model_v4 | NIF system FeS cluster assembly NifU N-terminal domain-containing protein | 0.9027 | 11 | 43 |
|
| AF-A0A7W1GJJ4-F1-model_v4 | Uncharacterized protein | 0.8957 | 2 | 71 |
|
| AF-A0A7W0P8V5-F1-model_v4 | Uncharacterized protein | 0.8915 | 2 | 68 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar