F459987

General Info

Members Datasets Scaffolds Average Seq Length
530 233 530 84

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0701893|Ga0436365_0701893_68_319
Length 83
Sequence VTTTVWIAPSATSFSCLCEPCLEHARTHGLLFADALMQASVRGSIPSEIELTRRCAAGHEIVLRRVQRPPSLPRHDERQLVLQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 3.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.87
Rhizosphere 90.19
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10062197 3300005327 Bacteria 3042
2 Ga0070658_10097813 3300005327 Bacteria 2423
3 Ga0070658_10504240 3300005327 Bacteria 1045
4 Ga0070683_100119475 3300005329 Bacteria 2489
5 Ga0070683_100225128 3300005329 Bacteria 1782
6 Ga0070683_100292981 3300005329 Bacteria 1548
7 Ga0070683_100500572 3300005329 Bacteria 1161
8 Ga0070683_101446541 3300005329 Bacteria 661
9 Ga0070683_101566247 3300005329 Bacteria 633
10 Ga0070680_100153110 3300005336 Bacteria 1936
11 Ga0070680_100300768 3300005336 Bacteria 1361
12 Ga0070680_100852557 3300005336 Bacteria 785
13 Ga0070680_100886019 3300005336 Bacteria 770
14 Ga0070682_100206142 3300005337 Bacteria 1390
15 Ga0070682_101359676 3300005337 Bacteria 606
16 Ga0068868_100591880 3300005338 Bacteria 982
17 Ga0070660_100035792 3300005339 Bacteria 3759
18 Ga0070660_100294433 3300005339 Bacteria 1329
19 Ga0070660_100295845 3300005339 Bacteria 1326
20 Ga0070660_100973497 3300005339 Bacteria 716
21 Ga0070660_101274368 3300005339 Bacteria 623
22 Ga0070660_101555829 3300005339 Bacteria 562
23 Ga0070691_10821502 3300005341 Bacteria 568
24 Ga0070661_100024555 3300005344 Bacteria 4323
25 Ga0070661_100060619 3300005344 Bacteria 2776
26 Ga0070661_100604824 3300005344 Bacteria 887
27 Ga0070661_100943074 3300005344 Bacteria 714
28 Ga0070661_101516816 3300005344 Bacteria 565
29 Ga0070661_101733287 3300005344 Bacteria 529
30 Ga0070659_100743076 3300005366 Bacteria 850
31 Ga0070709_10296964 3300005434 Bacteria 1179
32 Ga0070709_10315465 3300005434 Bacteria 1146
33 Ga0070714_100215125 3300005435 Bacteria 1764
34 Ga0070714_100693894 3300005435 Unclassified 982
35 Ga0070713_100200048 3300005436 Bacteria 1804
36 Ga0070710_10140270 3300005437 Bacteria 1482
37 Ga0070710_10227836 3300005437 Bacteria 1189
38 Ga0070710_10687766 3300005437 Bacteria 721
39 Ga0070711_100013583 3300005439 Bacteria 5116
40 Ga0070711_100889194 3300005439 Bacteria 760
41 Ga0070711_101065228 3300005439 Bacteria 696
42 Ga0070705_100652455 3300005440 Bacteria 821
43 Ga0070708_100804374 3300005445 Bacteria 884
44 Ga0070708_101193281 3300005445 Unclassified 712
45 Ga0070663_101283833 3300005455 Bacteria 645
46 Ga0070663_101308525 3300005455 Bacteria 640
47 Ga0070678_101221127 3300005456 Bacteria 698
48 Ga0070678_101649782 3300005456 Bacteria 603
49 Ga0070662_101666803 3300005457 Bacteria 551
50 Ga0070681_10017798 3300005458 Bacteria 7100
51 Ga0070681_10031962 3300005458 Bacteria 5284
52 Ga0070681_10038129 3300005458 Bacteria 4819
53 Ga0070681_10156281 3300005458 Bacteria 2205
54 Ga0070681_10190537 3300005458 Bacteria 1970
55 Ga0070681_10279109 3300005458 Bacteria 1581
56 Ga0070681_10523078 3300005458 Bacteria 1100
57 Ga0070706_100642987 3300005467 Bacteria 985
58 Ga0070706_101254798 3300005467 Unclassified 680
59 Ga0070707_100986456 3300005468 Bacteria 808
60 Ga0070707_101411751 3300005468 Bacteria 663
61 Ga0070698_100792040 3300005471 Bacteria 892
62 Ga0070699_101510767 3300005518 Bacteria 616
63 Ga0070679_100053210 3300005530 Bacteria 4030
64 Ga0070679_100146636 3300005530 Bacteria 2337
65 Ga0070679_100159613 3300005530 Bacteria 2229
66 Ga0070679_100590826 3300005530 Bacteria 1054
67 Ga0070679_101784731 3300005530 Unclassified 563
68 Ga0070684_100049912 3300005535 Bacteria 3633
69 Ga0070684_100230109 3300005535 Bacteria 1692
70 Ga0070684_100497581 3300005535 Bacteria 1129
71 Ga0070684_100880179 3300005535 Bacteria 839
72 Ga0070684_101035582 3300005535 Bacteria 770
73 Ga0070684_101875798 3300005535 Unclassified 566
74 Ga0070697_101572983 3300005536 Bacteria 588
75 Ga0068853_100139657 3300005539 Bacteria 2174
76 Ga0068853_100261028 3300005539 Bacteria 1592
77 Ga0068853_101766400 3300005539 Bacteria 600
78 Ga0070665_100011253 3300005548 Bacteria 9048
79 Ga0070665_101269717 3300005548 Bacteria 747
80 Ga0068855_100076153 3300005563 Bacteria 3894
81 Ga0068855_100098953 3300005563 Bacteria 3359
82 Ga0068855_100301361 3300005563 Bacteria 1775
83 Ga0068855_100404452 3300005563 Bacteria 1495
84 Ga0068855_100591451 3300005563 Bacteria 1198
85 Ga0068855_100722259 3300005563 Bacteria 1064
86 Ga0068857_100336713 3300005577 Bacteria 1395
87 Ga0068857_101000889 3300005577 Bacteria 804
88 Ga0068854_102033118 3300005578 Bacteria 530
89 Ga0068856_100262134 3300005614 Bacteria 1744
90 Ga0068856_100282119 3300005614 Bacteria 1678
91 Ga0068856_100529565 3300005614 Bacteria 1199
92 Ga0068856_100630588 3300005614 Bacteria 1092
93 Ga0068852_100125770 3300005616 Bacteria 2354
94 Ga0068852_100384479 3300005616 Bacteria 1377
95 Ga0068852_100637197 3300005616 Bacteria 1072
96 Ga0068851_10511552 3300005834 Bacteria 721
97 Ga0068858_102327344 3300005842 Bacteria 529
98 Ga0070717_11219155 3300006028 Bacteria 685
99 Ga0070715_10120062 3300006163 Bacteria 1252
100 Ga0070716_100313804 3300006173 Bacteria 1096
101 Ga0097621_100577141 3300006237 Bacteria 1026
102 Ga0068871_100166588 3300006358 Bacteria 1887
103 Ga0075433_11075021 3300006852 Bacteria 700
104 Ga0075434_100292884 3300006871 Bacteria 1648
105 Ga0075436_100137669 3300006914 Bacteria 1715
106 Ga0075435_100049753 3300007076 Bacteria 3372
107 Ga0105240_10092476 3300009093 Bacteria 3693
108 Ga0105240_10604472 3300009093 Bacteria 1207
109 Ga0105240_10609632 3300009093 Bacteria 1201
110 Ga0105240_11001525 3300009093 Bacteria 894
111 Ga0105240_11411339 3300009093 Bacteria 732
112 Ga0105240_11661589 3300009093 Unclassified 667
113 Ga0105240_11678798 3300009093 Bacteria 663
114 Ga0105245_11015489 3300009098 Bacteria 874
115 Ga0105245_12122064 3300009098 Bacteria 616
116 Ga0105241_10351757 3300009174 Bacteria 1279
117 Ga0105241_10895225 3300009174 Bacteria 824
118 Ga0105241_11118618 3300009174 Bacteria 742
119 Ga0105241_11344072 3300009174 Bacteria 682
120 Ga0105242_10022608 3300009176 Bacteria 4948
121 Ga0105242_12142923 3300009176 Bacteria 603
122 Ga0105242_12318574 3300009176 Bacteria 583
123 Ga0105237_10176046 3300009545 Bacteria 2139
124 Ga0105237_10326609 3300009545 Bacteria 1538
125 Ga0105237_11643281 3300009545 Bacteria 649
126 Ga0105238_10237010 3300009551 Bacteria 1802
127 Ga0105238_10761001 3300009551 Bacteria 983
128 Ga0105238_10899756 3300009551 Bacteria 903
129 Ga0105239_10817819 3300010375 Bacteria 1068
130 Ga0105239_11067906 3300010375 Bacteria 929
131 Ga0157373_10929920 3300013100 Bacteria 646
132 Ga0157370_10015630 3300013104 Bacteria 7709
133 Ga0157370_10036790 3300013104 Bacteria 4749
134 Ga0157370_10177450 3300013104 Bacteria 1980
135 Ga0157370_10249394 3300013104 Bacteria 1642
136 Ga0157370_10438106 3300013104 Bacteria 1202
137 Ga0157370_10942473 3300013104 Bacteria 783
138 Ga0157370_10990745 3300013104 Bacteria 761
139 Ga0157369_10002657 3300013105 Bacteria 21337
140 Ga0157369_10126450 3300013105 Bacteria 2710
141 Ga0157369_10539486 3300013105 Bacteria 1206
142 Ga0157369_10652667 3300013105 Bacteria 1085
143 Ga0157369_10699311 3300013105 Bacteria 1044
144 Ga0157369_11824049 3300013105 Unclassified 618
145 Ga0157369_12352150 3300013105 Bacteria 540
146 Ga0157369_12387206 3300013105 Bacteria 536
147 Ga0157374_10952066 3300013296 Bacteria 877
148 Ga0157378_10202794 3300013297 Bacteria 1877
149 Ga0157378_11109875 3300013297 Bacteria 828
150 Ga0157372_10040317 3300013307 Bacteria 5157
151 Ga0157372_10315109 3300013307 Bacteria 1821
152 Ga0157372_10470703 3300013307 Bacteria 1465
153 Ga0157372_12383447 3300013307 Bacteria 608
154 Ga0157372_12918432 3300013307 Bacteria 547
155 Ga0157372_13034919 3300013307 Unclassified 536
156 Ga0157375_12109058 3300013308 Bacteria 671
157 Ga0182008_10051801 3300014497 Bacteria 2036
158 Ga0182008_10130853 3300014497 Bacteria 1251
159 Ga0182008_10196099 3300014497 Bacteria 1026
160 Ga0182008_10439384 3300014497 Bacteria 707
161 Ga0182008_10598067 3300014497 Bacteria 619
162 Ga0157376_11458542 3300014969 Bacteria 717
163 Ga0182006_1290120 3300015261 Bacteria 537
164 Ga0182007_10124110 3300015262 Bacteria 865
165 Ga0182007_10261022 3300015262 Bacteria 624
166 Ga0197907_11154728 3300020069 Unclassified 642
167 Ga0206356_10212333 3300020070 Bacteria 1154
168 Ga0206356_10602804 3300020070 Bacteria 1880
169 Ga0206356_10900205 3300020070 Bacteria 726
170 Ga0206356_10985006 3300020070 Bacteria 643
171 Ga0206356_11621634 3300020070 Bacteria 871
172 Ga0206356_11651324 3300020070 Unclassified 850
173 Ga0206354_10547085 3300020081 Bacteria 1172
174 Ga0206354_10974966 3300020081 Bacteria 3062
175 Ga0206354_11443079 3300020081 Bacteria 623
176 Ga0206353_10119475 3300020082 Bacteria 903
177 Ga0206353_10181076 3300020082 Bacteria 771
178 Ga0206353_10203657 3300020082 Bacteria 1800
179 Ga0206353_10379293 3300020082 Bacteria 718
180 Ga0206353_10381735 3300020082 Bacteria 590
181 Ga0206353_12046548 3300020082 Bacteria 746
182 Ga0213876_10134117 3300021384 Bacteria 1317
183 Ga0207692_10254480 3300025898 Bacteria 1054
184 Ga0207692_10391886 3300025898 Bacteria 864
185 Ga0207692_10425751 3300025898 Bacteria 832
186 Ga0207685_10166623 3300025905 Bacteria 1010
187 Ga0207685_10551124 3300025905 Bacteria 613
188 Ga0207699_10229628 3300025906 Bacteria 1271
189 Ga0207705_10038581 3300025909 Bacteria 3420
190 Ga0207705_10096962 3300025909 Bacteria 2165
191 Ga0207654_10275734 3300025911 Bacteria 1136
192 Ga0207654_10279964 3300025911 Bacteria 1128
193 Ga0207654_11059716 3300025911 Bacteria 590
194 Ga0207707_10006845 3300025912 Bacteria 9940
195 Ga0207707_10016574 3300025912 Bacteria 6424
196 Ga0207707_10034460 3300025912 Bacteria 4429
197 Ga0207707_10258541 3300025912 Bacteria 1511
198 Ga0207707_10529672 3300025912 Bacteria 1003
199 Ga0207695_10040302 3300025913 Bacteria 5010
200 Ga0207695_10126563 3300025913 Bacteria 2516
201 Ga0207695_10807599 3300025913 Bacteria 818
202 Ga0207695_10887671 3300025913 Bacteria 771
203 Ga0207695_10897261 3300025913 Bacteria 766
204 Ga0207671_10070235 3300025914 Bacteria 2610
205 Ga0207671_10252371 3300025914 Bacteria 1387
206 Ga0207693_10621426 3300025915 Bacteria 840
207 Ga0207663_10008237 3300025916 Bacteria 5441
208 Ga0207663_10358400 3300025916 Bacteria 1106
209 Ga0207663_11554184 3300025916 Bacteria 533
210 Ga0207660_10038517 3300025917 Bacteria 3338
211 Ga0207660_10237079 3300025917 Bacteria 1436
212 Ga0207660_10352203 3300025917 Bacteria 1180
213 Ga0207660_11123413 3300025917 Bacteria 640
214 Ga0207657_10002824 3300025919 Bacteria 18667
215 Ga0207657_10012342 3300025919 Bacteria 8437
216 Ga0207657_10042675 3300025919 Bacteria 4000
217 Ga0207657_10234387 3300025919 Bacteria 1467
218 Ga0207657_10315293 3300025919 Bacteria 1237
219 Ga0207657_10374978 3300025919 Bacteria 1121
220 Ga0207649_10182642 3300025920 Bacteria 1469
221 Ga0207649_10550181 3300025920 Bacteria 883
222 Ga0207649_10865025 3300025920 Bacteria 708
223 Ga0207649_10993820 3300025920 Bacteria 660
224 Ga0207652_10058222 3300025921 Bacteria 3329
225 Ga0207652_10176814 3300025921 Bacteria 1917
226 Ga0207652_10384415 3300025921 Bacteria 1267
227 Ga0207652_10504941 3300025921 Bacteria 1089
228 Ga0207652_11509310 3300025921 Bacteria 576
229 Ga0207646_11573269 3300025922 Bacteria 568
230 Ga0207694_10128491 3300025924 Bacteria 2029
231 Ga0207694_10272545 3300025924 Bacteria 1388
232 Ga0207694_10542028 3300025924 Bacteria 976
233 Ga0207650_11354546 3300025925 Bacteria 606
234 Ga0207700_11901263 3300025928 Bacteria 521
235 Ga0207664_10110404 3300025929 Bacteria 2287
236 Ga0207664_10146145 3300025929 Bacteria 2005
237 Ga0207664_10443211 3300025929 Bacteria 1158
238 Ga0207664_11093410 3300025929 Bacteria 713
239 Ga0207664_11295758 3300025929 Bacteria 648
240 Ga0207686_10026385 3300025934 Bacteria 3388
241 Ga0207686_11797206 3300025934 Bacteria 507
242 Ga0207665_10352578 3300025939 Bacteria 1111
243 Ga0207661_10219213 3300025944 Bacteria 1681
244 Ga0207661_10733126 3300025944 Bacteria 909
245 Ga0207661_11920036 3300025944 Bacteria 538
246 Ga0207679_10856665 3300025945 Bacteria 830
247 Ga0207667_10089901 3300025949 Bacteria 3173
248 Ga0207667_10193033 3300025949 Bacteria 2089
249 Ga0207667_10392924 3300025949 Bacteria 1412
250 Ga0207667_10522619 3300025949 Bacteria 1202
251 Ga0207667_11100607 3300025949 Bacteria 778
252 Ga0207667_11628129 3300025949 Bacteria 614
253 Ga0207667_11923042 3300025949 Bacteria 553
254 Ga0207640_10291217 3300025981 Bacteria 1287
255 Ga0207658_10004832 3300025986 Bacteria 9316
256 Ga0207703_10215430 3300026035 Bacteria 1714
257 Ga0207639_10347792 3300026041 Bacteria 1323
258 Ga0207639_11055905 3300026041 Bacteria 761
259 Ga0207678_10180042 3300026067 Bacteria 1805
260 Ga0207678_11001189 3300026067 Bacteria 740
261 Ga0207702_10737219 3300026078 Bacteria 972
262 Ga0207674_10300614 3300026116 Bacteria 1554
263 Ga0207674_10362945 3300026116 Bacteria 1400
264 Ga0207683_10161621 3300026121 Bacteria 2025
265 Ga0207698_10074300 3300026142 Bacteria 2711
266 Ga0207698_11272475 3300026142 Bacteria 750
267 Ga0268266_10025493 3300028379 Bacteria 5031
268 Ga0268266_11021513 3300028379 Bacteria 800
269 Ga0265334_10293483 3300028573 Unclassified 557
270 Ga0265318_10119073 3300028577 Bacteria 971
271 Ga0265322_10013003 3300028654 Bacteria 2409
272 Ga0265338_10054346 3300028800 Bacteria 3572
273 Ga0265338_11136464 3300028800 Bacteria 525
274 Ga0265330_10063123 3300031235 Bacteria 1610
275 Ga0265325_10146629 3300031241 Bacteria 1119
276 Ga0265339_10041736 3300031249 Bacteria 2544
277 Ga0265331_10145100 3300031250 Bacteria 1078
278 Ga0265331_10168352 3300031250 Bacteria 992
279 Ga0265327_10008869 3300031251 Bacteria 7391
280 Ga0265316_10008441 3300031344 Bacteria 9562
281 Ga0265313_10002660 3300031595 Bacteria 15177
282 Ga0265314_10003929 3300031711 Bacteria 14127
283 Ga0265342_10021116 3300031712 Bacteria 4164
284 Ga0373926_0010942 3300035083 Bacteria 3046
285 Ga0373926_0141747 3300035083 Bacteria 913
286 Ga0373944_0008204 3300035089 Bacteria 2818
287 Ga0373936_0014573 3300035113 Bacteria 3009
288 Ga0373936_0031561 3300035113 Bacteria 2092
289 Ga0373945_0003761 3300035116 Bacteria 4789
290 Ga0373945_0036219 3300035116 Bacteria 1767
291 Ga0373943_0000538 3300035170 Bacteria 16397
292 Ga0373943_0014138 3300035170 Bacteria 3609
293 Ga0373946_0761651 3300035171 Bacteria 508
294 Ga0373924_0485403 3300035410 Bacteria 555
295 Ga0373935_0087987 3300035692 Bacteria 2029
296 Ga0373935_0109829 3300035692 Bacteria 1829
297 Ga0373927_0025083 3300035695 Bacteria 3898
298 Ga0373947_0000066 3300035725 Bacteria 52968
299 Ga0373947_0003591 3300035725 Bacteria 9146
300 Ga0373937_0227948 3300036401 Bacteria 1754
301 Ga0373925_0003351 3300037068 Bacteria 12427
302 Ga0373925_0033365 3300037068 Bacteria 3793
303 Ga0395899_0199877 3300037312 Bacteria 1394
304 Ga0395899_0271593 3300037312 Bacteria 1156
305 Ga0395900_0168172 3300037418 Bacteria 2233
306 Ga0395900_0339514 3300037418 Bacteria 1478
307 Ga0395900_0526595 3300037418 Bacteria 1129
308 Ga0395900_0995215 3300037418 Bacteria 758
309 Ga0395900_1013075 3300037418 Bacteria 750
310 Ga0395900_1735454 3300037418 Bacteria 535
311 Ga0395898_0005527 3300037466 Bacteria 13639
312 Ga0395898_0134482 3300037466 Bacteria 2367
313 Ga0395898_0144583 3300037466 Bacteria 2276
314 Ga0395898_0590784 3300037466 Bacteria 1053
315 Ga0395898_0597639 3300037466 Bacteria 1046
316 Ga0395898_0679479 3300037466 Bacteria 972
317 Ga0395905_0036251 3300037471 Bacteria 4632
318 Ga0436364_1209114 3300037853 Bacteria 1589
319 Ga0395901_0033926 3300038443 Bacteria 5270
320 Ga0395901_0121797 3300038443 Bacteria 2741
321 Ga0395901_0259497 3300038443 Bacteria 1809
322 Ga0395901_0467664 3300038443 Bacteria 1287
323 Ga0395901_0654807 3300038443 Bacteria 1053
324 Ga0395901_1530528 3300038443 Bacteria 622
325 Ga0395901_1715721 3300038443 Bacteria 579
326 Ga0436365_0701893 3300039437 Bacteria 1069
327 Ga0436365_1634939 3300039437 Bacteria 4555
328 Ga0436360_0341402 3300039438 Bacteria 1642
329 Ga0436363_1450105 3300039450 Bacteria 572
330 Ga0436362_0430525 3300039453 Bacteria 568
331 Ga0439448_0245944 3300042005 Bacteria 631
332 Ga0466969_0182511 3300044656 Bacteria 960
333 Ga0466972_0365937 3300044658 Bacteria 675
334 Ga0466972_0506811 3300044658 Bacteria 568
335 Ga0466965_0223203 3300044683 Bacteria 1005
336 Ga0466966_0023644 3300044684 Bacteria 4023
337 Ga0466966_0030664 3300044684 Bacteria 3488
338 Ga0466966_0070743 3300044684 Bacteria 2187
339 Ga0466961_0000424 3300044693 Bacteria 26980
340 Ga0466961_0031926 3300044693 Bacteria 3385
341 Ga0466961_0043938 3300044693 Bacteria 2861
342 Ga0466961_0081722 3300044693 Bacteria 2044
343 Ga0466961_0845817 3300044693 Unclassified 545
344 Ga0466963_0002241 3300044694 Bacteria 10726
345 Ga0466963_0017573 3300044694 Bacteria 4460
346 Ga0466963_0050294 3300044694 Bacteria 2759
347 Ga0466963_0237634 3300044694 Bacteria 1277
348 Ga0466963_0280746 3300044694 Bacteria 1170
349 Ga0466963_0499790 3300044694 Bacteria 858
350 Ga0466964_0002641 3300044706 Bacteria 6420
351 Ga0466964_0185908 3300044706 Bacteria 988
352 Ga0466971_0001169 3300044719 Bacteria 10913
353 Ga0466971_0054512 3300044719 Bacteria 1802
354 Ga0466971_0070049 3300044719 Bacteria 1592
355 Ga0466968_0006432 3300044735 Bacteria 4428
356 Ga0466968_0327035 3300044735 Bacteria 741
357 Ga0466970_0090985 3300044765 Bacteria 1656
358 Ga0466957_0000598 3300044842 Bacteria 18341
359 Ga0466957_0124850 3300044842 Bacteria 1644
360 Ga0466957_0185481 3300044842 Bacteria 1360
361 Ga0466957_0521968 3300044842 Unclassified 825
362 Ga0466957_0744322 3300044842 Unclassified 694
363 Ga0466960_0120950 3300044901 Bacteria 1371
364 Ga0466960_0490225 3300044901 Bacteria 719
365 Ga0466959_0013344 3300045049 Bacteria 5956
366 Ga0466959_0050603 3300045049 Bacteria 3050
367 Ga0466959_0061341 3300045049 Bacteria 2734
368 Ga0466959_0177405 3300045049 Bacteria 1492
369 Ga0466959_0273973 3300045049 Bacteria 1159
370 Ga0451576_0270243 3300045051 Bacteria 1777
371 Ga0466958_0002350 3300045836 Bacteria 9459
372 Ga0466958_0011139 3300045836 Bacteria 5059
373 Ga0466958_0022990 3300045836 Bacteria 3656
374 Ga0466958_0070650 3300045836 Bacteria 2137
375 Ga0466958_0644653 3300045836 Unclassified 689
376 Ga0466958_0829750 3300045836 Bacteria 603
377 Ga0466967_0000221 3300045976 Bacteria 24435
378 Ga0466967_0002137 3300045976 Bacteria 12121
379 Ga0466967_0002877 3300045976 Bacteria 10952
380 Ga0466967_0013743 3300045976 Bacteria 6272
381 Ga0466967_0094365 3300045976 Bacteria 2724
382 Ga0466967_0108376 3300045976 Bacteria 2549
383 Ga0466967_0142539 3300045976 Bacteria 2233
384 Ga0466967_0200384 3300045976 Bacteria 1890
385 Ga0466967_0226024 3300045976 Bacteria 1780
386 Ga0466967_0270845 3300045976 Bacteria 1627
387 Ga0466967_0493690 3300045976 Bacteria 1200
388 Ga0466967_0819939 3300045976 Bacteria 924
389 Ga0466967_0919477 3300045976 Bacteria 870
390 Ga0466967_0946046 3300045976 Bacteria 857
391 Ga0466967_0954055 3300045976 Bacteria 853
392 Ga0466967_1714386 3300045976 Bacteria 626
393 Ga0466967_2030007 3300045976 Bacteria 572
394 Ga0466967_2296544 3300045976 Bacteria 535
395 Ga0495603_0363413 3300046455 Bacteria 830
396 Ga0495629_0000194 3300046459 Bacteria 54501
397 Ga0495641_0000850 3300046461 Bacteria 26094
398 Ga0495651_0025004 3300046462 Bacteria 4646
399 Ga0495651_0037562 3300046462 Bacteria 3771
400 Ga0495653_0026482 3300046463 Bacteria 4649
401 Ga0495582_0000317 3300046473 Bacteria 26470
402 Ga0495582_0066628 3300046473 Bacteria 1990
403 Ga0495605_0050655 3300046474 Bacteria 2025
404 Ga0495639_0001774 3300046475 Bacteria 9556
405 Ga0495662_0053966 3300046476 Bacteria 1941
406 Ga0495664_0022024 3300046477 Bacteria 3687
407 Ga0495664_0251138 3300046477 Bacteria 1069
408 Ga0495594_0103780 3300046499 Bacteria 1600
409 Ga0495608_0043053 3300046511 Bacteria 3018
410 Ga0495608_0067597 3300046511 Bacteria 2338
411 Ga0495618_0044439 3300046514 Bacteria 2802
412 Ga0495628_0045334 3300046516 Bacteria 3497
413 Ga0495630_0069394 3300046517 Bacteria 2651
414 Ga0495630_0117512 3300046517 Bacteria 2016
415 Ga0495666_0117399 3300046526 Bacteria 1247
416 Ga0495652_0160597 3300046529 Bacteria 1745
417 Ga0495665_0030981 3300046531 Bacteria 2862
418 Ga0495586_0148751 3300046535 Bacteria 1317
419 Ga0495587_0084731 3300046536 Bacteria 1835
420 Ga0495645_0028989 3300046543 Bacteria 4023
421 Ga0495667_0023127 3300046559 Bacteria 4188
422 Ga0495667_0137838 3300046559 Bacteria 1573
423 Ga0495667_0816426 3300046559 Bacteria 574
424 Ga0495634_0025218 3300046642 Bacteria 4165
425 Ga0495635_0051537 3300046663 Bacteria 2835
426 Ga0495588_0713411 3300046674 Bacteria 524
427 Ga0495657_0261949 3300046675 Bacteria 1038
428 Ga0495657_0638657 3300046675 Bacteria 614
429 Ga0495599_0061543 3300046678 Bacteria 2346
430 Ga0495646_0607810 3300046680 Bacteria 555
431 Ga0495647_0004994 3300046681 Bacteria 4345
432 Ga0495658_0000224 3300046683 Bacteria 32518
433 Ga0495658_0103528 3300046683 Bacteria 1702
434 Ga0495613_0001177 3300046689 Bacteria 19969
435 Ga0495613_0035864 3300046689 Bacteria 3679
436 Ga0495624_0010250 3300046690 Bacteria 6460
437 Ga0495600_0002823 3300046809 Bacteria 10102
438 Ga0495600_0052183 3300046809 Bacteria 2670
439 Ga0495600_0449906 3300046809 Bacteria 797
440 Ga0495581_0001581 3300047315 Bacteria 12707
441 Ga0495604_0008755 3300047317 Bacteria 7997
442 Ga0495604_0385655 3300047317 Bacteria 925
443 Ga0495674_0260957 3300047319 Bacteria 1423
444 Ga0495674_0403296 3300047319 Bacteria 1103
445 Ga0495676_0002504 3300047321 Bacteria 16355
446 Ga0495676_0049841 3300047321 Bacteria 3363
447 Ga0495680_0006155 3300047322 Bacteria 11193
448 Ga0495680_0930331 3300047322 Bacteria 560
449 Ga0495675_0089447 3300047444 Bacteria 1933
450 Ga0495684_0057953 3300047471 Bacteria 2951
451 Ga0495684_0118247 3300047471 Bacteria 1997
452 Ga0495593_0012213 3300047673 Bacteria 4910
453 Ga0495602_0445319 3300048088 Bacteria 915
454 Ga0495614_0002669 3300048089 Bacteria 7928
455 Ga0495614_0118667 3300048089 Bacteria 1165
456 Ga0496100_0007025 3300048903 Bacteria 6176
457 Ga0496100_0030659 3300048903 Bacteria 3337
458 Ga0496100_0085189 3300048903 Bacteria 2144
459 Ga0496100_0146082 3300048903 Bacteria 1682
460 Ga0496100_0620669 3300048903 Bacteria 840
461 Ga0496101_0005132 3300048904 Bacteria 8327
462 Ga0496101_0026950 3300048904 Bacteria 3996
463 Ga0496101_0094320 3300048904 Bacteria 2230
464 Ga0496101_0106271 3300048904 Bacteria 2107
465 Ga0496102_0050087 3300048905 Bacteria 3802
466 Ga0496102_0206878 3300048905 Bacteria 1850
467 Ga0496102_0322514 3300048905 Bacteria 1455
468 Ga0496102_0476866 3300048905 Bacteria 1169
469 Ga0496102_0721240 3300048905 Bacteria 920
470 Ga0496103_0050432 3300048906 Bacteria 2575
471 Ga0496103_0067591 3300048906 Bacteria 2232
472 Ga0496103_0540089 3300048906 Bacteria 745
473 Ga0496104_0013997 3300048907 Bacteria 7237
474 Ga0496104_0134903 3300048907 Bacteria 2371
475 Ga0496105_0016517 3300048908 Bacteria 5894
476 Ga0496105_0080302 3300048908 Bacteria 2694
477 Ga0496105_0422944 3300048908 Bacteria 1054
478 Ga0496106_0010080 3300048909 Bacteria 6979
479 Ga0496106_0065857 3300048909 Bacteria 2758
480 Ga0496106_0138875 3300048909 Bacteria 1910
481 Ga0496107_0070179 3300048910 Bacteria 2543
482 Ga0496107_0122337 3300048910 Bacteria 1917
483 Ga0496107_0395070 3300048910 Bacteria 1028
484 Ga0496107_0580209 3300048910 Bacteria 829
485 Ga0496108_0039156 3300048911 Bacteria 3952
486 Ga0496109_0025879 3300048912 Bacteria 5230
487 Ga0496110_0357001 3300048913 Bacteria 1332
488 Ga0496111_0022179 3300048914 Bacteria 4442
489 Ga0496111_1352347 3300048914 Bacteria 500
490 Ga0496112_0058996 3300048915 Bacteria 3781
491 Ga0496112_0124519 3300048915 Bacteria 2548
492 Ga0496112_0138139 3300048915 Bacteria 2407
493 Ga0496113_0068055 3300048916 Bacteria 2702
494 Ga0496113_0227936 3300048916 Bacteria 1485
495 Ga0496113_0615543 3300048916 Bacteria 869
496 Ga0496114_0002271 3300048917 Bacteria 14633
497 Ga0496114_0019327 3300048917 Bacteria 5519
498 Ga0496114_0078049 3300048917 Bacteria 2793
499 Ga0496114_0248069 3300048917 Bacteria 1566
500 Ga0496115_0003388 3300048918 Bacteria 11443
501 Ga0496115_0003556 3300048918 Bacteria 11211
502 Ga0496115_0010180 3300048918 Bacteria 7018
503 Ga0501046_0696649 3300049580 Bacteria 716
504 Ga0501047_0481621 3300049581 Bacteria 1068
505 Ga0501067_0000845 3300049583 Bacteria 16504
506 Ga0501067_0170486 3300049583 Bacteria 1212
507 Ga0501068_0486858 3300049584 Bacteria 799
508 Ga0501069_0001111 3300049585 Bacteria 12988
509 Ga0501069_0130380 3300049585 Unclassified 1439
510 Ga0501069_0222881 3300049585 Bacteria 1096
511 Ga0501069_0572757 3300049585 Bacteria 676
512 Ga0501070_0088289 3300049586 Bacteria 2566
513 Ga0501070_0877017 3300049586 Bacteria 701
514 Ga0501074_0069857 3300049590 Bacteria 2525
515 Ga0501081_0629947 3300049743 Bacteria 803
516 Ga0501035_0348460 3300049822 Bacteria 1240
517 Ga0501044_1213376 3300049823 Bacteria 622
518 nmdc:mga0n895_63654_c1 3300050512 Bacteria 3647
519 nmdc:mga0rr50_5367_c1 3300050513 Bacteria 7637
520 nmdc:mga08x19_91593_c1 3300050514 Bacteria 2007
521 Ga0495601_0077459 3300053077 Bacteria 2129
522 Ga0495612_0009638 3300053078 Bacteria 3912
523 Ga0495655_0000869 3300053083 Bacteria 4720
524 Ga0495595_0007508 3300053084 Bacteria 4466
525 Ga0495595_0106303 3300053084 Bacteria 1358
526 Ga0495619_0112832 3300053085 Bacteria 1858
527 Ga0466962_0000257 3300061719 Bacteria 22422
528 Ga0466962_0167721 3300061719 Bacteria 1068
529 Ga0466962_0224272 3300061719 Bacteria 921
530 Ga0530510_0039653 3300061734 Bacteria 3400

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0185481 Ga0466957_0185481_586_906 75
2 3300044694 Ga0466963_0050294 Ga0466963_0050294_1064_1384 76
3 3300045836 Ga0466958_0070650 Ga0466958_0070650_461_781 76
4 3300045976 Ga0466967_0200384 Ga0466967_0200384_1087_1407 76
5 3300061719 Ga0466962_0167721 Ga0466962_0167721_581_901 76
6 3300037418 Ga0395900_0526595 Ga0395900_0526595_834_1076 80
7 3300038443 Ga0395901_0654807 Ga0395901_0654807_364_606 80
8 3300039438 Ga0436360_0341402 Ga0436360_0341402_1388_1630 80
9 3300005329 Ga0070683_100292981 Ga0070683_1002929812 82
10 3300005339 Ga0070660_100035792 Ga0070660_1000357922 82
11 3300005344 Ga0070661_100943074 Ga0070661_1009430741 82
12 3300005445 Ga0070708_100804374 Ga0070708_1008043742 82
13 3300005458 Ga0070681_10031962 Ga0070681_100319626 82
14 3300005467 Ga0070706_100642987 Ga0070706_1006429872 82
15 3300005467 Ga0070706_101254798 Ga0070706_1012547981 82
16 3300005530 Ga0070679_100590826 Ga0070679_1005908262 82
17 3300005535 Ga0070684_100497581 Ga0070684_1004975812 82
18 3300005834 Ga0068851_10511552 Ga0068851_105115523 82
19 3300020082 Ga0206353_10181076 Ga0206353_101810762 82
20 3300020082 Ga0206353_10381735 Ga0206353_103817352 82
21 3300021384 Ga0213876_10134117 Ga0213876_101341172 82
22 3300025909 Ga0207705_10096962 Ga0207705_100969622 82
23 3300025912 Ga0207707_10016574 Ga0207707_100165745 82
24 3300025919 Ga0207657_10002824 Ga0207657_1000282418 82
25 3300025920 Ga0207649_10182642 Ga0207649_101826423 82
26 3300025921 Ga0207652_10504941 Ga0207652_105049412 82
27 3300037312 Ga0395899_0199877 Ga0395899_0199877_959_1207 82
28 3300037418 Ga0395900_0339514 Ga0395900_0339514_175_432 82
29 3300037418 Ga0395900_0995215 Ga0395900_0995215_195_443 82
30 3300037466 Ga0395898_0005527 Ga0395898_0005527_8335_8583 82
31 3300037466 Ga0395898_0679479 Ga0395898_0679479_110_367 82
32 3300037853 Ga0436364_1209114 Ga0436364_1209114_381_635 82
33 3300038443 Ga0395901_0259497 Ga0395901_0259497_634_891 82
34 3300038443 Ga0395901_0467664 Ga0395901_0467664_845_1093 82
35 3300038443 Ga0395901_1530528 Ga0395901_1530528_201_458 82
36 3300038443 Ga0395901_1715721 Ga0395901_1715721_138_389 82
37 3300039437 Ga0436365_0701893 Ga0436365_0701893_68_319 82
38 3300039437 Ga0436365_1634939 Ga0436365_1634939_1610_1864 82
39 3300039450 Ga0436363_1450105 Ga0436363_1450105_49_303 82
40 3300039453 Ga0436362_0430525 Ga0436362_0430525_198_452 82
41 3300045976 Ga0466967_0954055 Ga0466967_0954055_594_842 82
42 3300048905 Ga0496102_0050087 Ga0496102_0050087_1912_2166 82
43 3300048906 Ga0496103_0050432 Ga0496103_0050432_828_1082 82
44 3300048914 Ga0496111_1352347 Ga0496111_1352347_113_367 82
45 3300048915 Ga0496112_0124519 Ga0496112_0124519_1947_2201 82
46 3300048916 Ga0496113_0227936 Ga0496113_0227936_362_616 82
47 3300049580 Ga0501046_0696649 Ga0501046_0696649_322_570 82
48 3300049581 Ga0501047_0481621 Ga0501047_0481621_322_570 82
49 3300049585 Ga0501069_0130380 Ga0501069_0130380_37_285 82
50 3300049586 Ga0501070_0088289 Ga0501070_0088289_1728_1976 82
51 3300049590 Ga0501074_0069857 Ga0501074_0069857_140_388 82
52 3300049822 Ga0501035_0348460 Ga0501035_0348460_701_949 82
53 3300049823 Ga0501044_1213376 Ga0501044_1213376_310_558 82
54 3300005327 Ga0070658_10062197 Ga0070658_100621974 83
55 3300005327 Ga0070658_10097813 Ga0070658_100978132 83
56 3300005327 Ga0070658_10504240 Ga0070658_105042402 83
57 3300005329 Ga0070683_100119475 Ga0070683_1001194755 83
58 3300005329 Ga0070683_100225128 Ga0070683_1002251283 83
59 3300005329 Ga0070683_100500572 Ga0070683_1005005723 83
60 3300005329 Ga0070683_101446541 Ga0070683_1014465411 83
61 3300005329 Ga0070683_101566247 Ga0070683_1015662472 83
62 3300005336 Ga0070680_100153110 Ga0070680_1001531103 83
63 3300005336 Ga0070680_100300768 Ga0070680_1003007683 83
64 3300005336 Ga0070680_100852557 Ga0070680_1008525572 83
65 3300005336 Ga0070680_100886019 Ga0070680_1008860192 83
66 3300005337 Ga0070682_100206142 Ga0070682_1002061422 83
67 3300005337 Ga0070682_101359676 Ga0070682_1013596761 83
68 3300005338 Ga0068868_100591880 Ga0068868_1005918802 83
69 3300005339 Ga0070660_100294433 Ga0070660_1002944332 83
70 3300005339 Ga0070660_100295845 Ga0070660_1002958451 83
71 3300005339 Ga0070660_100973497 Ga0070660_1009734972 83
72 3300005339 Ga0070660_101274368 Ga0070660_1012743682 83
73 3300005339 Ga0070660_101555829 Ga0070660_1015558291 83
74 3300005341 Ga0070691_10821502 Ga0070691_108215021 83
75 3300005344 Ga0070661_100024555 Ga0070661_1000245552 83
76 3300005344 Ga0070661_100060619 Ga0070661_1000606191 83
77 3300005344 Ga0070661_100604824 Ga0070661_1006048243 83
78 3300005344 Ga0070661_101516816 Ga0070661_1015168161 83
79 3300005344 Ga0070661_101733287 Ga0070661_1017332871 83
80 3300005366 Ga0070659_100743076 Ga0070659_1007430762 83
81 3300005434 Ga0070709_10296964 Ga0070709_102969642 83
82 3300005434 Ga0070709_10315465 Ga0070709_103154653 83
83 3300005435 Ga0070714_100215125 Ga0070714_1002151253 83
84 3300005435 Ga0070714_100693894 Ga0070714_1006938941 83
85 3300005436 Ga0070713_100200048 Ga0070713_1002000482 83
86 3300005437 Ga0070710_10140270 Ga0070710_101402703 83
87 3300005437 Ga0070710_10227836 Ga0070710_102278363 83
88 3300005437 Ga0070710_10687766 Ga0070710_106877662 83
89 3300005439 Ga0070711_100013583 Ga0070711_1000135839 83
90 3300005439 Ga0070711_100889194 Ga0070711_1008891942 83
91 3300005439 Ga0070711_101065228 Ga0070711_1010652281 83
92 3300005440 Ga0070705_100652455 Ga0070705_1006524553 83
93 3300005445 Ga0070708_101193281 Ga0070708_1011932812 83
94 3300005455 Ga0070663_101283833 Ga0070663_1012838332 83
95 3300005455 Ga0070663_101308525 Ga0070663_1013085252 83
96 3300005456 Ga0070678_101221127 Ga0070678_1012211272 83
97 3300005456 Ga0070678_101649782 Ga0070678_1016497821 83
98 3300005457 Ga0070662_101666803 Ga0070662_1016668032 83
99 3300005458 Ga0070681_10017798 Ga0070681_100177989 83
100 3300005458 Ga0070681_10038129 Ga0070681_100381295 83
101 3300005458 Ga0070681_10156281 Ga0070681_101562812 83
102 3300005458 Ga0070681_10190537 Ga0070681_101905372 83
103 3300005458 Ga0070681_10279109 Ga0070681_102791092 83
104 3300005458 Ga0070681_10523078 Ga0070681_105230782 83
105 3300005468 Ga0070707_100986456 Ga0070707_1009864562 83
106 3300005468 Ga0070707_101411751 Ga0070707_1014117512 83
107 3300005471 Ga0070698_100792040 Ga0070698_1007920401 83
108 3300005518 Ga0070699_101510767 Ga0070699_1015107672 83
109 3300005530 Ga0070679_100053210 Ga0070679_1000532102 83
110 3300005530 Ga0070679_100146636 Ga0070679_1001466363 83
111 3300005530 Ga0070679_100159613 Ga0070679_1001596131 83
112 3300005530 Ga0070679_101784731 Ga0070679_1017847312 83
113 3300005535 Ga0070684_100049912 Ga0070684_1000499123 83
114 3300005535 Ga0070684_100230109 Ga0070684_1002301093 83
115 3300005535 Ga0070684_100880179 Ga0070684_1008801792 83
116 3300005535 Ga0070684_101035582 Ga0070684_1010355822 83
117 3300005535 Ga0070684_101875798 Ga0070684_1018757981 83
118 3300005536 Ga0070697_101572983 Ga0070697_1015729832 83
119 3300005539 Ga0068853_100139657 Ga0068853_1001396573 83
120 3300005539 Ga0068853_100261028 Ga0068853_1002610282 83
121 3300005539 Ga0068853_101766400 Ga0068853_1017664002 83
122 3300005548 Ga0070665_100011253 Ga0070665_10001125310 83
123 3300005548 Ga0070665_101269717 Ga0070665_1012697172 83
124 3300005563 Ga0068855_100076153 Ga0068855_1000761537 83
125 3300005563 Ga0068855_100098953 Ga0068855_1000989536 83
126 3300005563 Ga0068855_100301361 Ga0068855_1003013612 83
127 3300005563 Ga0068855_100404452 Ga0068855_1004044522 83
128 3300005563 Ga0068855_100591451 Ga0068855_1005914512 83
129 3300005563 Ga0068855_100722259 Ga0068855_1007222592 83
130 3300005577 Ga0068857_100336713 Ga0068857_1003367132 83
131 3300005577 Ga0068857_101000889 Ga0068857_1010008893 83
132 3300005578 Ga0068854_102033118 Ga0068854_1020331181 83
133 3300005614 Ga0068856_100262134 Ga0068856_1002621343 83
134 3300005614 Ga0068856_100282119 Ga0068856_1002821192 83
135 3300005614 Ga0068856_100529565 Ga0068856_1005295653 83
136 3300005614 Ga0068856_100630588 Ga0068856_1006305882 83
137 3300005616 Ga0068852_100125770 Ga0068852_1001257703 83
138 3300005616 Ga0068852_100384479 Ga0068852_1003844793 83
139 3300005616 Ga0068852_100637197 Ga0068852_1006371972 83
140 3300005842 Ga0068858_102327344 Ga0068858_1023273441 83
141 3300006028 Ga0070717_11219155 Ga0070717_112191552 83
142 3300006163 Ga0070715_10120062 Ga0070715_101200622 83
143 3300006173 Ga0070716_100313804 Ga0070716_1003138043 83
144 3300006237 Ga0097621_100577141 Ga0097621_1005771413 83
145 3300006358 Ga0068871_100166588 Ga0068871_1001665883 83
146 3300006852 Ga0075433_11075021 Ga0075433_110750212 83
147 3300006871 Ga0075434_100292884 Ga0075434_1002928842 83
148 3300006914 Ga0075436_100137669 Ga0075436_1001376692 83
149 3300007076 Ga0075435_100049753 Ga0075435_1000497532 83
150 3300009093 Ga0105240_10092476 Ga0105240_100924765 83
151 3300009093 Ga0105240_10604472 Ga0105240_106044723 83
152 3300009093 Ga0105240_10609632 Ga0105240_106096322 83
153 3300009093 Ga0105240_11001525 Ga0105240_110015253 83
154 3300009093 Ga0105240_11411339 Ga0105240_114113392 83
155 3300009093 Ga0105240_11661589 Ga0105240_116615892 83
156 3300009093 Ga0105240_11678798 Ga0105240_116787982 83
157 3300009098 Ga0105245_11015489 Ga0105245_110154891 83
158 3300009098 Ga0105245_12122064 Ga0105245_121220642 83
159 3300009174 Ga0105241_10351757 Ga0105241_103517573 83
160 3300009174 Ga0105241_10895225 Ga0105241_108952252 83
161 3300009174 Ga0105241_11118618 Ga0105241_111186183 83
162 3300009174 Ga0105241_11344072 Ga0105241_113440722 83
163 3300009176 Ga0105242_10022608 Ga0105242_100226086 83
164 3300009176 Ga0105242_12142923 Ga0105242_121429232 83
165 3300009176 Ga0105242_12318574 Ga0105242_123185742 83
166 3300009545 Ga0105237_10176046 Ga0105237_101760463 83
167 3300009545 Ga0105237_10326609 Ga0105237_103266092 83
168 3300009545 Ga0105237_11643281 Ga0105237_116432812 83
169 3300009551 Ga0105238_10237010 Ga0105238_102370103 83
170 3300009551 Ga0105238_10761001 Ga0105238_107610013 83
171 3300009551 Ga0105238_10899756 Ga0105238_108997562 83
172 3300010375 Ga0105239_10817819 Ga0105239_108178192 83
173 3300010375 Ga0105239_11067906 Ga0105239_110679062 83
174 3300013100 Ga0157373_10929920 Ga0157373_109299202 83
175 3300013104 Ga0157370_10015630 Ga0157370_100156309 83
176 3300013104 Ga0157370_10036790 Ga0157370_100367906 83
177 3300013104 Ga0157370_10177450 Ga0157370_101774502 83
178 3300013104 Ga0157370_10249394 Ga0157370_102493942 83
179 3300013104 Ga0157370_10438106 Ga0157370_104381063 83
180 3300013104 Ga0157370_10942473 Ga0157370_109424732 83
181 3300013104 Ga0157370_10990745 Ga0157370_109907452 83
182 3300013105 Ga0157369_10002657 Ga0157369_100026578 83
183 3300013105 Ga0157369_10126450 Ga0157369_101264506 83
184 3300013105 Ga0157369_10539486 Ga0157369_105394862 83
185 3300013105 Ga0157369_10652667 Ga0157369_106526672 83
186 3300013105 Ga0157369_10699311 Ga0157369_106993112 83
187 3300013105 Ga0157369_11824049 Ga0157369_118240492 83
188 3300013105 Ga0157369_12352150 Ga0157369_123521502 83
189 3300013105 Ga0157369_12387206 Ga0157369_123872061 83
190 3300013296 Ga0157374_10952066 Ga0157374_109520662 83
191 3300013297 Ga0157378_10202794 Ga0157378_102027943 83
192 3300013297 Ga0157378_11109875 Ga0157378_111098752 83
193 3300013307 Ga0157372_10040317 Ga0157372_100403176 83
194 3300013307 Ga0157372_10315109 Ga0157372_103151093 83
195 3300013307 Ga0157372_10470703 Ga0157372_104707033 83
196 3300013307 Ga0157372_12383447 Ga0157372_123834472 83
197 3300013307 Ga0157372_12918432 Ga0157372_129184322 83
198 3300013307 Ga0157372_13034919 Ga0157372_130349192 83
199 3300013308 Ga0157375_12109058 Ga0157375_121090582 83
200 3300014497 Ga0182008_10051801 Ga0182008_100518011 83
201 3300014497 Ga0182008_10130853 Ga0182008_101308532 83
202 3300014497 Ga0182008_10196099 Ga0182008_101960992 83
203 3300014497 Ga0182008_10439384 Ga0182008_104393842 83
204 3300014497 Ga0182008_10598067 Ga0182008_105980671 83
205 3300014969 Ga0157376_11458542 Ga0157376_114585422 83
206 3300015261 Ga0182006_1290120 Ga0182006_12901202 83
207 3300015262 Ga0182007_10124110 Ga0182007_101241102 83
208 3300015262 Ga0182007_10261022 Ga0182007_102610222 83
209 3300020069 Ga0197907_11154728 Ga0197907_111547282 83
210 3300020070 Ga0206356_10212333 Ga0206356_102123333 83
211 3300020070 Ga0206356_10602804 Ga0206356_106028042 83
212 3300020070 Ga0206356_10900205 Ga0206356_109002053 83
213 3300020070 Ga0206356_10985006 Ga0206356_109850062 83
214 3300020070 Ga0206356_11621634 Ga0206356_116216343 83
215 3300020070 Ga0206356_11651324 Ga0206356_116513243 83
216 3300020081 Ga0206354_10547085 Ga0206354_105470852 83
217 3300020081 Ga0206354_10974966 Ga0206354_109749662 83
218 3300020081 Ga0206354_11443079 Ga0206354_114430792 83
219 3300020082 Ga0206353_10119475 Ga0206353_101194752 83
220 3300020082 Ga0206353_10203657 Ga0206353_102036572 83
221 3300020082 Ga0206353_10379293 Ga0206353_103792932 83
222 3300020082 Ga0206353_12046548 Ga0206353_120465482 83
223 3300025898 Ga0207692_10254480 Ga0207692_102544803 83
224 3300025898 Ga0207692_10391886 Ga0207692_103918861 83
225 3300025898 Ga0207692_10425751 Ga0207692_104257512 83
226 3300025905 Ga0207685_10166623 Ga0207685_101666233 83
227 3300025905 Ga0207685_10551124 Ga0207685_105511242 83
228 3300025906 Ga0207699_10229628 Ga0207699_102296283 83
229 3300025909 Ga0207705_10038581 Ga0207705_100385812 83
230 3300025911 Ga0207654_10275734 Ga0207654_102757342 83
231 3300025911 Ga0207654_10279964 Ga0207654_102799642 83
232 3300025911 Ga0207654_11059716 Ga0207654_110597162 83
233 3300025912 Ga0207707_10006845 Ga0207707_100068455 83
234 3300025912 Ga0207707_10034460 Ga0207707_100344605 83
235 3300025912 Ga0207707_10258541 Ga0207707_102585412 83
236 3300025912 Ga0207707_10529672 Ga0207707_105296723 83
237 3300025913 Ga0207695_10040302 Ga0207695_100403023 83
238 3300025913 Ga0207695_10126563 Ga0207695_101265635 83
239 3300025913 Ga0207695_10807599 Ga0207695_108075992 83
240 3300025913 Ga0207695_10887671 Ga0207695_108876713 83
241 3300025913 Ga0207695_10897261 Ga0207695_108972612 83
242 3300025914 Ga0207671_10070235 Ga0207671_100702353 83
243 3300025914 Ga0207671_10252371 Ga0207671_102523712 83
244 3300025915 Ga0207693_10621426 Ga0207693_106214262 83
245 3300025916 Ga0207663_10008237 Ga0207663_100082373 83
246 3300025916 Ga0207663_10358400 Ga0207663_103584003 83
247 3300025916 Ga0207663_11554184 Ga0207663_115541842 83
248 3300025917 Ga0207660_10038517 Ga0207660_100385173 83
249 3300025917 Ga0207660_10237079 Ga0207660_102370792 83
250 3300025917 Ga0207660_10352203 Ga0207660_103522032 83
251 3300025917 Ga0207660_11123413 Ga0207660_111234132 83
252 3300025919 Ga0207657_10012342 Ga0207657_100123428 83
253 3300025919 Ga0207657_10042675 Ga0207657_100426751 83
254 3300025919 Ga0207657_10234387 Ga0207657_102343873 83
255 3300025919 Ga0207657_10315293 Ga0207657_103152933 83
256 3300025919 Ga0207657_10374978 Ga0207657_103749782 83
257 3300025920 Ga0207649_10550181 Ga0207649_105501813 83
258 3300025920 Ga0207649_10865025 Ga0207649_108650252 83
259 3300025920 Ga0207649_10993820 Ga0207649_109938202 83
260 3300025921 Ga0207652_10058222 Ga0207652_100582225 83
261 3300025921 Ga0207652_10176814 Ga0207652_101768142 83
262 3300025921 Ga0207652_10384415 Ga0207652_103844152 83
263 3300025921 Ga0207652_11509310 Ga0207652_115093102 83
264 3300025922 Ga0207646_11573269 Ga0207646_115732692 83
265 3300025924 Ga0207694_10128491 Ga0207694_101284913 83
266 3300025924 Ga0207694_10272545 Ga0207694_102725453 83
267 3300025924 Ga0207694_10542028 Ga0207694_105420283 83
268 3300025925 Ga0207650_11354546 Ga0207650_113545462 83
269 3300025928 Ga0207700_11901263 Ga0207700_119012632 83
270 3300025929 Ga0207664_10110404 Ga0207664_101104042 83
271 3300025929 Ga0207664_10146145 Ga0207664_101461453 83
272 3300025929 Ga0207664_10443211 Ga0207664_104432112 83
273 3300025929 Ga0207664_11093410 Ga0207664_110934102 83
274 3300025929 Ga0207664_11295758 Ga0207664_112957582 83
275 3300025934 Ga0207686_10026385 Ga0207686_100263853 83
276 3300025934 Ga0207686_11797206 Ga0207686_117972062 83
277 3300025939 Ga0207665_10352578 Ga0207665_103525782 83
278 3300025944 Ga0207661_10219213 Ga0207661_102192133 83
279 3300025944 Ga0207661_10733126 Ga0207661_107331263 83
280 3300025944 Ga0207661_11920036 Ga0207661_119200362 83
281 3300025945 Ga0207679_10856665 Ga0207679_108566651 83
282 3300025949 Ga0207667_10089901 Ga0207667_100899012 83
283 3300025949 Ga0207667_10193033 Ga0207667_101930332 83
284 3300025949 Ga0207667_10392924 Ga0207667_103929243 83
285 3300025949 Ga0207667_10522619 Ga0207667_105226193 83
286 3300025949 Ga0207667_11100607 Ga0207667_111006073 83
287 3300025949 Ga0207667_11628129 Ga0207667_116281292 83
288 3300025949 Ga0207667_11923042 Ga0207667_119230422 83
289 3300025981 Ga0207640_10291217 Ga0207640_102912172 83
290 3300025986 Ga0207658_10004832 Ga0207658_100048328 83
291 3300026035 Ga0207703_10215430 Ga0207703_102154303 83
292 3300026041 Ga0207639_10347792 Ga0207639_103477922 83
293 3300026041 Ga0207639_11055905 Ga0207639_110559053 83
294 3300026067 Ga0207678_10180042 Ga0207678_101800422 83
295 3300026067 Ga0207678_11001189 Ga0207678_110011892 83
296 3300026078 Ga0207702_10737219 Ga0207702_107372192 83
297 3300026116 Ga0207674_10300614 Ga0207674_103006142 83
298 3300026116 Ga0207674_10362945 Ga0207674_103629452 83
299 3300026121 Ga0207683_10161621 Ga0207683_101616212 83
300 3300026142 Ga0207698_10074300 Ga0207698_100743002 83
301 3300026142 Ga0207698_11272475 Ga0207698_112724752 83
302 3300028379 Ga0268266_10025493 Ga0268266_100254937 83
303 3300028379 Ga0268266_11021513 Ga0268266_110215132 83
304 3300028573 Ga0265334_10293483 Ga0265334_102934832 83
305 3300028577 Ga0265318_10119073 Ga0265318_101190733 83
306 3300028654 Ga0265322_10013003 Ga0265322_100130032 83
307 3300028800 Ga0265338_10054346 Ga0265338_100543463 83
308 3300028800 Ga0265338_11136464 Ga0265338_111364641 83
309 3300031235 Ga0265330_10063123 Ga0265330_100631232 83
310 3300031241 Ga0265325_10146629 Ga0265325_101466292 83
311 3300031249 Ga0265339_10041736 Ga0265339_100417361 83
312 3300031250 Ga0265331_10145100 Ga0265331_101451002 83
313 3300031250 Ga0265331_10168352 Ga0265331_101683522 83
314 3300031251 Ga0265327_10008869 Ga0265327_100088698 83
315 3300031344 Ga0265316_10008441 Ga0265316_1000844111 83
316 3300031595 Ga0265313_10002660 Ga0265313_1000266014 83
317 3300031711 Ga0265314_10003929 Ga0265314_1000392910 83
318 3300031712 Ga0265342_10021116 Ga0265342_100211163 83
319 3300035083 Ga0373926_0010942 Ga0373926_0010942_2438_2689 83
320 3300035083 Ga0373926_0141747 Ga0373926_0141747_101_352 83
321 3300035089 Ga0373944_0008204 Ga0373944_0008204_66_317 83
322 3300035113 Ga0373936_0014573 Ga0373936_0014573_2288_2539 83
323 3300035113 Ga0373936_0031561 Ga0373936_0031561_83_334 83
324 3300035116 Ga0373945_0003761 Ga0373945_0003761_2417_2668 83
325 3300035116 Ga0373945_0036219 Ga0373945_0036219_1326_1577 83
326 3300035170 Ga0373943_0000538 Ga0373943_0000538_11446_11697 83
327 3300035170 Ga0373943_0014138 Ga0373943_0014138_2581_2832 83
328 3300035171 Ga0373946_0761651 Ga0373946_0761651_143_394 83
329 3300035410 Ga0373924_0485403 Ga0373924_0485403_246_497 83
330 3300035692 Ga0373935_0087987 Ga0373935_0087987_472_723 83
331 3300035692 Ga0373935_0109829 Ga0373935_0109829_922_1173 83
332 3300035695 Ga0373927_0025083 Ga0373927_0025083_473_724 83
333 3300035725 Ga0373947_0000066 Ga0373947_0000066_12001_12252 83
334 3300035725 Ga0373947_0003591 Ga0373947_0003591_5954_6205 83
335 3300036401 Ga0373937_0227948 Ga0373937_0227948_1063_1317 83
336 3300037068 Ga0373925_0003351 Ga0373925_0003351_7102_7353 83
337 3300037068 Ga0373925_0033365 Ga0373925_0033365_555_806 83
338 3300037312 Ga0395899_0271593 Ga0395899_0271593_87_338 83
339 3300037418 Ga0395900_0168172 Ga0395900_0168172_764_1015 83
340 3300037418 Ga0395900_1013075 Ga0395900_1013075_443_694 83
341 3300037418 Ga0395900_1735454 Ga0395900_1735454_177_428 83
342 3300037466 Ga0395898_0134482 Ga0395898_0134482_955_1206 83
343 3300037466 Ga0395898_0144583 Ga0395898_0144583_738_989 83
344 3300037466 Ga0395898_0590784 Ga0395898_0590784_745_996 83
345 3300037466 Ga0395898_0597639 Ga0395898_0597639_519_770 83
346 3300037471 Ga0395905_0036251 Ga0395905_0036251_1333_1584 83
347 3300038443 Ga0395901_0033926 Ga0395901_0033926_4519_4770 83
348 3300038443 Ga0395901_0121797 Ga0395901_0121797_1832_2083 83
349 3300042005 Ga0439448_0245944 Ga0439448_0245944_325_588 83
350 3300044656 Ga0466969_0182511 Ga0466969_0182511_222_479 83
351 3300044658 Ga0466972_0365937 Ga0466972_0365937_230_484 83
352 3300044658 Ga0466972_0506811 Ga0466972_0506811_71_331 83
353 3300044683 Ga0466965_0223203 Ga0466965_0223203_225_485 83
354 3300044684 Ga0466966_0023644 Ga0466966_0023644_53_313 83
355 3300044684 Ga0466966_0030664 Ga0466966_0030664_1483_1734 83
356 3300044684 Ga0466966_0070743 Ga0466966_0070743_158_412 83
357 3300044693 Ga0466961_0000424 Ga0466961_0000424_5039_5293 83
358 3300044693 Ga0466961_0031926 Ga0466961_0031926_2155_2406 83
359 3300044693 Ga0466961_0043938 Ga0466961_0043938_2014_2271 83
360 3300044693 Ga0466961_0081722 Ga0466961_0081722_1688_1948 83
361 3300044693 Ga0466961_0845817 Ga0466961_0845817_238_501 83
362 3300044694 Ga0466963_0002241 Ga0466963_0002241_3622_3873 83
363 3300044694 Ga0466963_0017573 Ga0466963_0017573_1375_1632 83
364 3300044694 Ga0466963_0237634 Ga0466963_0237634_574_828 83
365 3300044694 Ga0466963_0280746 Ga0466963_0280746_26_283 83
366 3300044694 Ga0466963_0499790 Ga0466963_0499790_362_622 83
367 3300044706 Ga0466964_0002641 Ga0466964_0002641_5937_6188 83
368 3300044706 Ga0466964_0185908 Ga0466964_0185908_213_467 83
369 3300044719 Ga0466971_0001169 Ga0466971_0001169_3889_4143 83
370 3300044719 Ga0466971_0054512 Ga0466971_0054512_1041_1301 83
371 3300044719 Ga0466971_0070049 Ga0466971_0070049_84_404 83
372 3300044735 Ga0466968_0006432 Ga0466968_0006432_1813_2070 83
373 3300044735 Ga0466968_0327035 Ga0466968_0327035_139_399 83
374 3300044765 Ga0466970_0090985 Ga0466970_0090985_55_309 83
375 3300044842 Ga0466957_0000598 Ga0466957_0000598_18032_18286 83
376 3300044842 Ga0466957_0124850 Ga0466957_0124850_136_390 83
377 3300044842 Ga0466957_0521968 Ga0466957_0521968_430_690 83
378 3300044842 Ga0466957_0744322 Ga0466957_0744322_309_563 83
379 3300044901 Ga0466960_0120950 Ga0466960_0120950_933_1199 83
380 3300044901 Ga0466960_0490225 Ga0466960_0490225_381_641 83
381 3300045049 Ga0466959_0013344 Ga0466959_0013344_4774_5025 83
382 3300045049 Ga0466959_0050603 Ga0466959_0050603_2141_2395 83
383 3300045049 Ga0466959_0061341 Ga0466959_0061341_2205_2465 83
384 3300045049 Ga0466959_0177405 Ga0466959_0177405_706_969 83
385 3300045049 Ga0466959_0273973 Ga0466959_0273973_142_399 83
386 3300045051 Ga0451576_0270243 Ga0451576_0270243_994_1254 83
387 3300045836 Ga0466958_0002350 Ga0466958_0002350_8514_8768 83
388 3300045836 Ga0466958_0011139 Ga0466958_0011139_1393_1653 83
389 3300045836 Ga0466958_0022990 Ga0466958_0022990_3010_3270 83
390 3300045836 Ga0466958_0644653 Ga0466958_0644653_98_355 83
391 3300045836 Ga0466958_0829750 Ga0466958_0829750_299_553 83
392 3300045976 Ga0466967_0000221 Ga0466967_0000221_1404_1655 83
393 3300045976 Ga0466967_0002137 Ga0466967_0002137_6399_6650 83
394 3300045976 Ga0466967_0002877 Ga0466967_0002877_1732_1986 83
395 3300045976 Ga0466967_0013743 Ga0466967_0013743_3744_3998 83
396 3300045976 Ga0466967_0094365 Ga0466967_0094365_2310_2567 83
397 3300045976 Ga0466967_0108376 Ga0466967_0108376_345_602 83
398 3300045976 Ga0466967_0142539 Ga0466967_0142539_141_395 83
399 3300045976 Ga0466967_0226024 Ga0466967_0226024_1087_1353 83
400 3300045976 Ga0466967_0270845 Ga0466967_0270845_827_1087 83
401 3300045976 Ga0466967_0493690 Ga0466967_0493690_657_908 83
402 3300045976 Ga0466967_0819939 Ga0466967_0819939_279_530 83
403 3300045976 Ga0466967_0919477 Ga0466967_0919477_106_363 83
404 3300045976 Ga0466967_0946046 Ga0466967_0946046_347_619 83
405 3300045976 Ga0466967_1714386 Ga0466967_1714386_35_286 83
406 3300045976 Ga0466967_2030007 Ga0466967_2030007_291_548 83
407 3300045976 Ga0466967_2296544 Ga0466967_2296544_265_516 83
408 3300046455 Ga0495603_0363413 Ga0495603_0363413_248_499 83
409 3300046459 Ga0495629_0000194 Ga0495629_0000194_1582_1833 83
410 3300046461 Ga0495641_0000850 Ga0495641_0000850_22202_22453 83
411 3300046462 Ga0495651_0025004 Ga0495651_0025004_4065_4316 83
412 3300046462 Ga0495651_0037562 Ga0495651_0037562_1304_1558 83
413 3300046463 Ga0495653_0026482 Ga0495653_0026482_736_987 83
414 3300046473 Ga0495582_0000317 Ga0495582_0000317_16861_17112 83
415 3300046473 Ga0495582_0066628 Ga0495582_0066628_959_1210 83
416 3300046474 Ga0495605_0050655 Ga0495605_0050655_1608_1862 83
417 3300046475 Ga0495639_0001774 Ga0495639_0001774_6710_6961 83
418 3300046476 Ga0495662_0053966 Ga0495662_0053966_758_1009 83
419 3300046477 Ga0495664_0022024 Ga0495664_0022024_3184_3438 83
420 3300046477 Ga0495664_0251138 Ga0495664_0251138_724_975 83
421 3300046499 Ga0495594_0103780 Ga0495594_0103780_1071_1322 83
422 3300046511 Ga0495608_0043053 Ga0495608_0043053_2446_2700 83
423 3300046511 Ga0495608_0067597 Ga0495608_0067597_1118_1369 83
424 3300046514 Ga0495618_0044439 Ga0495618_0044439_2481_2732 83
425 3300046516 Ga0495628_0045334 Ga0495628_0045334_213_464 83
426 3300046517 Ga0495630_0069394 Ga0495630_0069394_1893_2144 83
427 3300046517 Ga0495630_0117512 Ga0495630_0117512_1657_1908 83
428 3300046526 Ga0495666_0117399 Ga0495666_0117399_813_1064 83
429 3300046529 Ga0495652_0160597 Ga0495652_0160597_828_1079 83
430 3300046531 Ga0495665_0030981 Ga0495665_0030981_1216_1467 83
431 3300046535 Ga0495586_0148751 Ga0495586_0148751_100_351 83
432 3300046536 Ga0495587_0084731 Ga0495587_0084731_774_1025 83
433 3300046543 Ga0495645_0028989 Ga0495645_0028989_3082_3333 83
434 3300046559 Ga0495667_0023127 Ga0495667_0023127_3871_4122 83
435 3300046559 Ga0495667_0137838 Ga0495667_0137838_1301_1555 83
436 3300046559 Ga0495667_0816426 Ga0495667_0816426_132_383 83
437 3300046642 Ga0495634_0025218 Ga0495634_0025218_3185_3436 83
438 3300046663 Ga0495635_0051537 Ga0495635_0051537_2382_2633 83
439 3300046674 Ga0495588_0713411 Ga0495588_0713411_192_443 83
440 3300046675 Ga0495657_0261949 Ga0495657_0261949_17_271 83
441 3300046675 Ga0495657_0638657 Ga0495657_0638657_269_520 83
442 3300046678 Ga0495599_0061543 Ga0495599_0061543_508_759 83
443 3300046680 Ga0495646_0607810 Ga0495646_0607810_182_436 83
444 3300046681 Ga0495647_0004994 Ga0495647_0004994_2701_2952 83
445 3300046683 Ga0495658_0000224 Ga0495658_0000224_9094_9345 83
446 3300046683 Ga0495658_0103528 Ga0495658_0103528_558_809 83
447 3300046689 Ga0495613_0001177 Ga0495613_0001177_756_1007 83
448 3300046689 Ga0495613_0035864 Ga0495613_0035864_959_1210 83
449 3300046690 Ga0495624_0010250 Ga0495624_0010250_594_845 83
450 3300046809 Ga0495600_0002823 Ga0495600_0002823_9757_10008 83
451 3300046809 Ga0495600_0052183 Ga0495600_0052183_226_477 83
452 3300046809 Ga0495600_0449906 Ga0495600_0449906_38_292 83
453 3300047315 Ga0495581_0001581 Ga0495581_0001581_6840_7091 83
454 3300047317 Ga0495604_0008755 Ga0495604_0008755_5894_6145 83
455 3300047317 Ga0495604_0385655 Ga0495604_0385655_343_597 83
456 3300047319 Ga0495674_0260957 Ga0495674_0260957_45_296 83
457 3300047319 Ga0495674_0403296 Ga0495674_0403296_45_296 83
458 3300047321 Ga0495676_0002504 Ga0495676_0002504_380_631 83
459 3300047321 Ga0495676_0049841 Ga0495676_0049841_1113_1364 83
460 3300047322 Ga0495680_0006155 Ga0495680_0006155_4115_4366 83
461 3300047322 Ga0495680_0930331 Ga0495680_0930331_225_503 83
462 3300047444 Ga0495675_0089447 Ga0495675_0089447_1288_1539 83
463 3300047471 Ga0495684_0057953 Ga0495684_0057953_1985_2236 83
464 3300047471 Ga0495684_0118247 Ga0495684_0118247_152_403 83
465 3300047673 Ga0495593_0012213 Ga0495593_0012213_1743_1994 83
466 3300048088 Ga0495602_0445319 Ga0495602_0445319_245_499 83
467 3300048089 Ga0495614_0002669 Ga0495614_0002669_7335_7586 83
468 3300048089 Ga0495614_0118667 Ga0495614_0118667_621_872 83
469 3300048903 Ga0496100_0007025 Ga0496100_0007025_329_586 83
470 3300048903 Ga0496100_0030659 Ga0496100_0030659_181_447 83
471 3300048903 Ga0496100_0085189 Ga0496100_0085189_1701_1952 83
472 3300048903 Ga0496100_0146082 Ga0496100_0146082_507_758 83
473 3300048903 Ga0496100_0620669 Ga0496100_0620669_120_419 83
474 3300048904 Ga0496101_0005132 Ga0496101_0005132_110_367 83
475 3300048904 Ga0496101_0026950 Ga0496101_0026950_485_784 83
476 3300048904 Ga0496101_0094320 Ga0496101_0094320_607_873 83
477 3300048904 Ga0496101_0106271 Ga0496101_0106271_1157_1408 83
478 3300048905 Ga0496102_0206878 Ga0496102_0206878_559_858 83
479 3300048905 Ga0496102_0322514 Ga0496102_0322514_99_350 83
480 3300048905 Ga0496102_0476866 Ga0496102_0476866_288_539 83
481 3300048905 Ga0496102_0721240 Ga0496102_0721240_190_441 83
482 3300048906 Ga0496103_0067591 Ga0496103_0067591_1241_1540 83
483 3300048906 Ga0496103_0540089 Ga0496103_0540089_97_348 83
484 3300048907 Ga0496104_0013997 Ga0496104_0013997_1558_1830 83
485 3300048907 Ga0496104_0134903 Ga0496104_0134903_1370_1621 83
486 3300048908 Ga0496105_0016517 Ga0496105_0016517_5576_5848 83
487 3300048908 Ga0496105_0080302 Ga0496105_0080302_2309_2560 83
488 3300048908 Ga0496105_0422944 Ga0496105_0422944_593_844 83
489 3300048909 Ga0496106_0010080 Ga0496106_0010080_4655_4921 83
490 3300048909 Ga0496106_0065857 Ga0496106_0065857_373_630 83
491 3300048909 Ga0496106_0138875 Ga0496106_0138875_1146_1445 83
492 3300048910 Ga0496107_0070179 Ga0496107_0070179_2176_2448 83
493 3300048910 Ga0496107_0122337 Ga0496107_0122337_1358_1624 83
494 3300048910 Ga0496107_0395070 Ga0496107_0395070_607_858 83
495 3300048910 Ga0496107_0580209 Ga0496107_0580209_46_345 83
496 3300048911 Ga0496108_0039156 Ga0496108_0039156_2408_2665 83
497 3300048912 Ga0496109_0025879 Ga0496109_0025879_1207_1479 83
498 3300048913 Ga0496110_0357001 Ga0496110_0357001_718_975 83
499 3300048914 Ga0496111_0022179 Ga0496111_0022179_1766_2023 83
500 3300048915 Ga0496112_0058996 Ga0496112_0058996_2403_2654 83
501 3300048915 Ga0496112_0138139 Ga0496112_0138139_646_918 83
502 3300048916 Ga0496113_0068055 Ga0496113_0068055_965_1222 83
503 3300048916 Ga0496113_0615543 Ga0496113_0615543_409_693 83
504 3300048917 Ga0496114_0002271 Ga0496114_0002271_11474_11725 83
505 3300048917 Ga0496114_0019327 Ga0496114_0019327_577_834 83
506 3300048917 Ga0496114_0078049 Ga0496114_0078049_739_990 83
507 3300048917 Ga0496114_0248069 Ga0496114_0248069_1160_1459 83
508 3300048918 Ga0496115_0003388 Ga0496115_0003388_5065_5322 83
509 3300048918 Ga0496115_0003556 Ga0496115_0003556_7332_7583 83
510 3300048918 Ga0496115_0010180 Ga0496115_0010180_5374_5625 83
511 3300049583 Ga0501067_0000845 Ga0501067_0000845_950_1201 83
512 3300049583 Ga0501067_0170486 Ga0501067_0170486_122_373 83
513 3300049584 Ga0501068_0486858 Ga0501068_0486858_82_333 83
514 3300049585 Ga0501069_0001111 Ga0501069_0001111_2426_2677 83
515 3300049585 Ga0501069_0222881 Ga0501069_0222881_99_350 83
516 3300049585 Ga0501069_0572757 Ga0501069_0572757_362_613 83
517 3300049586 Ga0501070_0877017 Ga0501070_0877017_297_548 83
518 3300049743 Ga0501081_0629947 Ga0501081_0629947_409_660 83
519 3300050512 nmdc:mga0n895_63654_c1 nmdc:mga0n895_63654_c1_1081_1347 83
520 3300050513 nmdc:mga0rr50_5367_c1 nmdc:mga0rr50_5367_c1_2521_2787 83
521 3300050514 nmdc:mga08x19_91593_c1 nmdc:mga08x19_91593_c1_496_762 83
522 3300053077 Ga0495601_0077459 Ga0495601_0077459_1621_1872 83
523 3300053078 Ga0495612_0009638 Ga0495612_0009638_2242_2493 83
524 3300053083 Ga0495655_0000869 Ga0495655_0000869_897_1151 83
525 3300053084 Ga0495595_0007508 Ga0495595_0007508_2027_2278 83
526 3300053084 Ga0495595_0106303 Ga0495595_0106303_772_1026 83
527 3300053085 Ga0495619_0112832 Ga0495619_0112832_52_303 83
528 3300061719 Ga0466962_0000257 Ga0466962_0000257_19449_19703 83
529 3300061719 Ga0466962_0224272 Ga0466962_0224272_408_668 83
530 3300061734 Ga0530510_0039653 Ga0530510_0039653_2894_3145 83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xmo-assembly1.cif.gz_A the crystal structure of lmo2642 0.9498 50 65
7xv0-assembly1.cif.gz_A crystal structure of rpa70n-blmp1 fusion 0.8242 50 66
4ipg-assembly1.cif.gz_A structure of the n-terminal domain of rpa70, e7r, e100r mutant 0.8157 50 66
7zd7-assembly1.cif.gz_A crystal structure of the r24e/e352t double mutant of s-adenosyl-l-homocysteine hydrolase from synechocystis sp. pcc 6803 cocrystallized with adenosine in the presence of rb+ cations 0.8153 49 64
5eay-assembly1.cif.gz_B crystal structure of a dna2 peptide in complex with rpa 70n 0.7995 50 66
ID Description Score Start End Superfamily
2xmoA01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9498 50 65 3.60.21.10
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8512 50 66 3.30.720.110
af_Q8IIN5_1_445_1.10.1370.30 Mainly Alpha;Orthogonal Bundle;Neurolysin; domain 3; 0.7385 48 67 1.10.1370.30
af_I1NGP4_33_562_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7359 41 68 3.50.50.60
af_Q9C8U5_24_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7355 50 65 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538J393-F1-model_v4 Uncharacterized protein 0.9414 2 65
AF-A0A7Y6CF62-F1-model_v4 Uncharacterized protein 0.9109 2 71
AF-A0A134A868-F1-model_v4 NIF system FeS cluster assembly NifU N-terminal domain-containing protein 0.9027 11 43
AF-A0A7W1GJJ4-F1-model_v4 Uncharacterized protein 0.8957 2 71
AF-A0A7W0P8V5-F1-model_v4 Uncharacterized protein 0.8915 2 68

Feature Viewer

pLDDT pTM Quality
84.7 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map