F459993

General Info

Members Datasets Scaffolds Average Seq Length
530 299 1060 313

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0010057|Ga0466958_0010057_3010_4119
Length 358
Sequence LETVGPIGYTYRDGLIRPIAVPLEPLVSRADSDIAGDVATDVDAGGPGALPAEVYIEAVGLEKRFGDYLAVDGIDFRVRRGEAFGFLGPNGAGKSSTMRMIGCVSPVTAGSLRILGLDPAADGPAIRRRLGVVPQDDTLDMELTVRENILVYGRYFDLPRREIRARADELLEFVQLAERSDAKVEHLSGGMRRRLTIARSLVNDPDVLLLDEPTTGLDPQARHVVWDRLYRLKQRGVTLVLTTHYMDEAEQLCDRLVVMDKGRIAAEGSPMELIGRYSSREVLELRFAPGEAEHRVADVEDLAERVEVLPDRLLLYADDGEAAAARVHARGVVPISMLVRRSTLEDVFLRLTGRTLID

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
202 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
203 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
204 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
290 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
291 2739367898 Nocardioides sp. CF479 Isolate Unclassified
292 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
293 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
294 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
295 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
296 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
297 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
298 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
299 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 0.75
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 8.11
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0010057 3300045836 Bacteria 5288
2 JGI24737J22298_10030121 3300001990 Bacteria 1699
3 JGI24744J21845_10000545 3300002077 Bacteria 6764
4 JGI25407J50210_10004461 3300003373 Bacteria 3405
5 Ga0070658_10026555 3300005327 Bacteria 4645
6 Ga0070658_10040098 3300005327 Bacteria 3778
7 Ga0070658_10085736 3300005327 Bacteria 2590
8 Ga0070676_10036155 3300005328 Bacteria 2844
9 Ga0070683_100099023 3300005329 Bacteria 2744
10 Ga0070683_100225704 3300005329 Bacteria 1780
11 Ga0070683_100463737 3300005329 Bacteria 1209
12 Ga0070690_100040037 3300005330 Bacteria 2963
13 Ga0068869_100031104 3300005334 Bacteria 3754
14 Ga0068869_100039413 3300005334 Bacteria 3373
15 Ga0068869_100220673 3300005334 Bacteria 1502
16 Ga0070666_10006718 3300005335 Bacteria 7082
17 Ga0070666_10086441 3300005335 Bacteria 2148
18 Ga0070680_100019850 3300005336 Bacteria 5329
19 Ga0070680_100045197 3300005336 Bacteria 3580
20 Ga0070680_100056004 3300005336 Bacteria 3223
21 Ga0070682_100005590 3300005337 Bacteria 7006
22 Ga0070682_100017200 3300005337 Bacteria 4213
23 Ga0070682_100036541 3300005337 Bacteria 3003
24 Ga0070682_100051246 3300005337 Bacteria 2579
25 Ga0068868_100015311 3300005338 Bacteria 5669
26 Ga0068868_100059582 3300005338 Bacteria 3020
27 Ga0068868_100073754 3300005338 Bacteria 2725
28 Ga0070660_100010729 3300005339 Bacteria 6484
29 Ga0070660_100036062 3300005339 Bacteria 3744
30 Ga0070660_100038745 3300005339 Bacteria 3619
31 Ga0070660_100039585 3300005339 Bacteria 3584
32 Ga0070660_100044493 3300005339 Bacteria 3397
33 Ga0070689_100031570 3300005340 Bacteria 4027
34 Ga0070689_100034973 3300005340 Bacteria 3836
35 Ga0070689_100069027 3300005340 Bacteria 2757
36 Ga0070691_10061776 3300005341 Bacteria 1803
37 Ga0070687_100051835 3300005343 Bacteria 2127
38 Ga0070661_100125786 3300005344 Bacteria 1923
39 Ga0070692_10005129 3300005345 Bacteria 5544
40 Ga0070692_10006244 3300005345 Bacteria 5160
41 Ga0070692_10077594 3300005345 Bacteria 1782
42 Ga0070668_100004474 3300005347 Bacteria 10363
43 Ga0070668_100026766 3300005347 Bacteria 4378
44 Ga0070675_100001736 3300005354 Bacteria 16094
45 Ga0070671_100089434 3300005355 Bacteria 2578
46 Ga0070674_100046836 3300005356 Bacteria 2960
47 Ga0070673_100011571 3300005364 Bacteria 6028
48 Ga0070688_100014703 3300005365 Bacteria 4439
49 Ga0070659_100009691 3300005366 Bacteria 7079
50 Ga0070659_100015288 3300005366 Bacteria 5746
51 Ga0070659_100103578 3300005366 Bacteria 2292
52 Ga0070667_100061539 3300005367 Bacteria 3178
53 Ga0070703_10018689 3300005406 Bacteria 2007
54 Ga0070703_10027438 3300005406 Bacteria 1697
55 Ga0070709_10030733 3300005434 Bacteria 3226
56 Ga0070714_100019745 3300005435 Bacteria 5496
57 Ga0070714_100024226 3300005435 Bacteria 4994
58 Ga0070713_100225978 3300005436 Bacteria 1700
59 Ga0070713_100265278 3300005436 Bacteria 1571
60 Ga0070701_10004503 3300005438 Bacteria 5653
61 Ga0070701_10024991 3300005438 Bacteria 2896
62 Ga0070711_100001075 3300005439 Bacteria 14603
63 Ga0070711_100018634 3300005439 Bacteria 4435
64 Ga0070705_100012689 3300005440 Bacteria 4291
65 Ga0070700_100007469 3300005441 Bacteria 5906
66 Ga0070700_100018475 3300005441 Bacteria 4008
67 Ga0070700_100271409 3300005441 Bacteria 1226
68 Ga0070694_100021359 3300005444 Bacteria 4135
69 Ga0070708_100245364 3300005445 Bacteria 1682
70 Ga0070663_100004470 3300005455 Bacteria 8232
71 Ga0070663_100007874 3300005455 Bacteria 6518
72 Ga0070663_100030501 3300005455 Bacteria 3696
73 Ga0070678_100019929 3300005456 Bacteria 4388
74 Ga0070678_100261392 3300005456 Bacteria 1456
75 Ga0070662_100015307 3300005457 Bacteria 5135
76 Ga0070662_100037828 3300005457 Bacteria 3424
77 Ga0068867_100010996 3300005459 Bacteria 6381
78 Ga0070685_10006574 3300005466 Bacteria 5930
79 Ga0070685_10075681 3300005466 Bacteria 2006
80 Ga0070706_100010936 3300005467 Bacteria 8426
81 Ga0070706_100033206 3300005467 Bacteria 4763
82 Ga0070706_100123628 3300005467 Bacteria 2412
83 Ga0070707_100000635 3300005468 Bacteria 35108
84 Ga0070707_100012722 3300005468 Bacteria 7856
85 Ga0070707_100031619 3300005468 Bacteria 5043
86 Ga0070698_100001447 3300005471 Bacteria 26354
87 Ga0070698_100121812 3300005471 Bacteria 2567
88 Ga0070699_100004137 3300005518 Bacteria 12817
89 Ga0070699_100345317 3300005518 Bacteria 1340
90 Ga0070679_100039850 3300005530 Bacteria 4670
91 Ga0070679_100130014 3300005530 Bacteria 2499
92 Ga0070684_100007429 3300005535 Bacteria 8517
93 Ga0070697_100039791 3300005536 Bacteria 3802
94 Ga0068853_100024124 3300005539 Bacteria 5098
95 Ga0068853_100128707 3300005539 Bacteria 2264
96 Ga0070672_100016444 3300005543 Bacteria 5297
97 Ga0070672_100228061 3300005543 Bacteria 1564
98 Ga0070686_100009810 3300005544 Bacteria 5381
99 Ga0070695_100077633 3300005545 Bacteria 2188
100 Ga0070696_100070710 3300005546 Bacteria 2455
101 Ga0070696_100084546 3300005546 Bacteria 2251
102 Ga0070693_100017250 3300005547 Bacteria 3750
103 Ga0070693_100033717 3300005547 Bacteria 2828
104 Ga0070665_100003419 3300005548 Bacteria 16959
105 Ga0070665_100032592 3300005548 Bacteria 5244
106 Ga0070665_100072829 3300005548 Bacteria 3443
107 Ga0070704_100223077 3300005549 Bacteria 1533
108 Ga0068855_100033888 3300005563 Bacteria 6091
109 Ga0068855_100086601 3300005563 Bacteria 3622
110 Ga0068855_100087187 3300005563 Bacteria 3608
111 Ga0068855_100089581 3300005563 Bacteria 3552
112 Ga0068855_100105730 3300005563 Bacteria 3236
113 Ga0068855_100249612 3300005563 Bacteria 1979
114 Ga0070664_100101896 3300005564 Bacteria 2497
115 Ga0068857_100008769 3300005577 Bacteria 8760
116 Ga0068854_100082572 3300005578 Bacteria 2375
117 Ga0068856_100016290 3300005614 Bacteria 7194
118 Ga0068856_100039021 3300005614 Bacteria 4663
119 Ga0068856_100046948 3300005614 Bacteria 4254
120 Ga0068856_100335295 3300005614 Bacteria 1530
121 Ga0070702_100001788 3300005615 Bacteria 8926
122 Ga0070702_100012528 3300005615 Bacteria 4252
123 Ga0070702_100043982 3300005615 Bacteria 2519
124 Ga0068852_100002353 3300005616 Bacteria 13020
125 Ga0068852_100009242 3300005616 Bacteria 7303
126 Ga0068852_100054285 3300005616 Bacteria 3453
127 Ga0068852_100218138 3300005616 Bacteria 1813
128 Ga0068859_100075629 3300005617 Bacteria 3408
129 Ga0068864_100035439 3300005618 Bacteria 4248
130 Ga0068866_10007635 3300005718 Bacteria 4534
131 Ga0068866_10210285 3300005718 Bacteria 1167
132 Ga0068861_100011898 3300005719 Bacteria 6059
133 Ga0068861_100090326 3300005719 Bacteria 2416
134 Ga0068851_10006785 3300005834 Bacteria 5240
135 Ga0068863_100060043 3300005841 Bacteria 3596
136 Ga0068863_100222824 3300005841 Bacteria 1817
137 Ga0068858_100140183 3300005842 Bacteria 2269
138 Ga0068860_100111399 3300005843 Bacteria 2617
139 Ga0068862_100109523 3300005844 Bacteria 2423
140 Ga0068862_100312772 3300005844 Bacteria 1448
141 Ga0081538_10000049 3300005981 Bacteria 110906
142 Ga0081538_10038364 3300005981 Bacteria 3091
143 Ga0081540_1003473 3300005983 Bacteria 12437
144 Ga0081539_10038831 3300005985 Bacteria 2816
145 Ga0070717_10079799 3300006028 Bacteria 2744
146 Ga0075365_10185883 3300006038 Bacteria 1453
147 Ga0070716_100011674 3300006173 Bacteria 4427
148 Ga0070712_100025640 3300006175 Bacteria 3921
149 Ga0075367_10036937 3300006178 Bacteria 2835
150 Ga0097621_100013980 3300006237 Bacteria 5996
151 Ga0097621_100015174 3300006237 Bacteria 5788
152 Ga0097621_100048732 3300006237 Bacteria 3439
153 Ga0068871_100006377 3300006358 Bacteria 8339
154 Ga0068871_100014424 3300006358 Bacteria 5893
155 Ga0068871_100041942 3300006358 Bacteria 3671
156 Ga0075428_100062002 3300006844 Bacteria 4095
157 Ga0075428_100090538 3300006844 Bacteria 3337
158 Ga0075430_100003484 3300006846 Bacteria 13164
159 Ga0075430_100085669 3300006846 Bacteria 2638
160 Ga0075430_100136720 3300006846 Bacteria 2041
161 Ga0075431_100012225 3300006847 Bacteria 8666
162 Ga0075431_100235015 3300006847 Bacteria 1866
163 Ga0075433_10425664 3300006852 Bacteria 1171
164 Ga0075429_100013032 3300006880 Bacteria 7215
165 Ga0068865_100004949 3300006881 Bacteria 8056
166 Ga0068865_100014446 3300006881 Bacteria 5017
167 Ga0075436_100005573 3300006914 Bacteria 8645
168 Ga0075436_100058529 3300006914 Bacteria 2661
169 Ga0097620_100075631 3300006931 Bacteria 3408
170 Ga0075435_100014980 3300007076 Bacteria 5816
171 Ga0075435_100020196 3300007076 Bacteria 5099
172 Ga0105240_10093724 3300009093 Bacteria 3665
173 Ga0105240_10118923 3300009093 Bacteria 3184
174 Ga0111539_10045488 3300009094 Bacteria 5254
175 Ga0105245_10044961 3300009098 Bacteria 3942
176 Ga0105245_10046722 3300009098 Bacteria 3869
177 Ga0105245_10322263 3300009098 Bacteria 1523
178 Ga0105247_10005243 3300009101 Bacteria 8180
179 Ga0105247_10033774 3300009101 Bacteria 3114
180 Ga0114129_10000031 3300009147 Bacteria 111827
181 Ga0114129_10004129 3300009147 Bacteria 20516
182 Ga0105243_10030792 3300009148 Bacteria 4134
183 Ga0105243_10038471 3300009148 Bacteria 3725
184 Ga0105243_10067972 3300009148 Bacteria 2871
185 Ga0105241_10033100 3300009174 Bacteria 3879
186 Ga0105242_10014129 3300009176 Bacteria 6182
187 Ga0105242_10181238 3300009176 Bacteria 1858
188 Ga0105248_10026459 3300009177 Bacteria 6454
189 Ga0105248_10045083 3300009177 Bacteria 4945
190 Ga0105248_10047870 3300009177 Bacteria 4795
191 Ga0105248_10166209 3300009177 Bacteria 2487
192 Ga0105237_10164035 3300009545 Bacteria 2221
193 Ga0105238_10041390 3300009551 Bacteria 4666
194 Ga0105238_10086054 3300009551 Bacteria 3130
195 Ga0105249_10001347 3300009553 Bacteria 21460
196 Ga0105249_10024591 3300009553 Bacteria 5414
197 Ga0105249_10576702 3300009553 Bacteria 1178
198 Ga0105239_10009547 3300010375 Bacteria 10917
199 Ga0105239_10057810 3300010375 Bacteria 4255
200 Ga0105246_10398628 3300011119 Bacteria 1142
201 Ga0157371_10010959 3300013102 Bacteria 7027
202 Ga0157370_10034064 3300013104 Bacteria 4962
203 Ga0157370_10070116 3300013104 Bacteria 3310
204 Ga0157370_10109761 3300013104 Bacteria 2579
205 Ga0157369_10009918 3300013105 Bacteria 10883
206 Ga0157369_10027326 3300013105 Bacteria 6327
207 Ga0157369_10254116 3300013105 Bacteria 1834
208 Ga0157374_10015577 3300013296 Bacteria 6672
209 Ga0157378_10006940 3300013297 Bacteria 9880
210 Ga0157378_10223309 3300013297 Bacteria 1792
211 Ga0163162_10013364 3300013306 Bacteria 8017
212 Ga0163162_10027647 3300013306 Bacteria 5610
213 Ga0157372_10211441 3300013307 Bacteria 2248
214 Ga0157372_10696458 3300013307 Bacteria 1182
215 Ga0157375_10024586 3300013308 Bacteria 5578
216 Ga0157375_10034939 3300013308 Bacteria 4794
217 Ga0157375_10064065 3300013308 Bacteria 3659
218 Ga0157375_10083117 3300013308 Bacteria 3246
219 Ga0163163_10029525 3300014325 Bacteria 5276
220 Ga0163163_10033950 3300014325 Bacteria 4939
221 Ga0163163_10182291 3300014325 Bacteria 2147
222 Ga0157380_10008097 3300014326 Bacteria 7490
223 Ga0157377_10005998 3300014745 Bacteria 5756
224 Ga0157377_10022170 3300014745 Bacteria 3350
225 Ga0157379_10505087 3300014968 Bacteria 1121
226 Ga0157376_10020185 3300014969 Bacteria 5150
227 Ga0157376_10036577 3300014969 Bacteria 3978
228 Ga0163161_10010508 3300017792 Bacteria 6411
229 Ga0206356_10427959 3300020070 Bacteria 3837
230 Ga0206354_10719510 3300020081 Bacteria 2404
231 Ga0206354_10843100 3300020081 Bacteria 2342
232 Ga0206353_11193225 3300020082 Bacteria 4331
233 Ga0213871_10066000 3300021441 Bacteria 1015
234 Ga0207692_10004373 3300025898 Bacteria 5595
235 Ga0207642_10004902 3300025899 Bacteria 4336
236 Ga0207710_10130136 3300025900 Bacteria 1208
237 Ga0207688_10023993 3300025901 Bacteria 3344
238 Ga0207688_10036365 3300025901 Bacteria 2729
239 Ga0207688_10044967 3300025901 Bacteria 2462
240 Ga0207680_10026642 3300025903 Bacteria 3207
241 Ga0207680_10056408 3300025903 Bacteria 2372
242 Ga0207647_10008509 3300025904 Bacteria 7351
243 Ga0207647_10033696 3300025904 Bacteria 3276
244 Ga0207699_10041704 3300025906 Bacteria 2653
245 Ga0207645_10067108 3300025907 Bacteria 2293
246 Ga0207645_10090760 3300025907 Bacteria 1964
247 Ga0207643_10000112 3300025908 Bacteria 55805
248 Ga0207643_10058599 3300025908 Bacteria 2195
249 Ga0207705_10094338 3300025909 Bacteria 2194
250 Ga0207705_10171805 3300025909 Bacteria 1632
251 Ga0207684_10091589 3300025910 Bacteria 2591
252 Ga0207654_10096048 3300025911 Bacteria 1817
253 Ga0207707_10056943 3300025912 Bacteria 3402
254 Ga0207671_10052335 3300025914 Bacteria 3026
255 Ga0207671_10127655 3300025914 Bacteria 1950
256 Ga0207693_10000409 3300025915 Bacteria 39089
257 Ga0207693_10001176 3300025915 Bacteria 23358
258 Ga0207663_10060209 3300025916 Bacteria 2405
259 Ga0207660_10007499 3300025917 Bacteria 7060
260 Ga0207660_10222278 3300025917 Bacteria 1482
261 Ga0207662_10052854 3300025918 Bacteria 2418
262 Ga0207657_10003179 3300025919 Bacteria 17568
263 Ga0207657_10005213 3300025919 Bacteria 13615
264 Ga0207657_10065016 3300025919 Bacteria 3111
265 Ga0207657_10119832 3300025919 Bacteria 2165
266 Ga0207652_10012926 3300025921 Bacteria 6754
267 Ga0207652_10045951 3300025921 Bacteria 3724
268 Ga0207652_10053775 3300025921 Bacteria 3459
269 Ga0207646_10002084 3300025922 Bacteria 24000
270 Ga0207646_10007636 3300025922 Bacteria 10947
271 Ga0207694_10047309 3300025924 Bacteria 3328
272 Ga0207650_10004590 3300025925 Bacteria 9446
273 Ga0207659_10005948 3300025926 Bacteria 7445
274 Ga0207687_10003050 3300025927 Bacteria 11358
275 Ga0207687_10056798 3300025927 Bacteria 2747
276 Ga0207700_10123007 3300025928 Bacteria 2107
277 Ga0207664_10025967 3300025929 Bacteria 4421
278 Ga0207664_10032082 3300025929 Bacteria 4024
279 Ga0207664_10042739 3300025929 Bacteria 3540
280 Ga0207644_10081838 3300025931 Bacteria 2387
281 Ga0207644_10100121 3300025931 Bacteria 2176
282 Ga0207690_10027965 3300025932 Bacteria 3569
283 Ga0207690_10090892 3300025932 Bacteria 2156
284 Ga0207690_10108327 3300025932 Bacteria 1996
285 Ga0207690_10352944 3300025932 Bacteria 1163
286 Ga0207706_10003043 3300025933 Bacteria 16167
287 Ga0207706_10024684 3300025933 Bacteria 5387
288 Ga0207706_10113924 3300025933 Bacteria 2378
289 Ga0207686_10003864 3300025934 Bacteria 8034
290 Ga0207686_10026043 3300025934 Bacteria 3410
291 Ga0207709_10012187 3300025935 Bacteria 4739
292 Ga0207709_10062374 3300025935 Bacteria 2333
293 Ga0207669_10021389 3300025937 Bacteria 3414
294 Ga0207669_10072106 3300025937 Bacteria 2173
295 Ga0207704_10005166 3300025938 Bacteria 6012
296 Ga0207704_10079420 3300025938 Bacteria 2114
297 Ga0207665_10006099 3300025939 Bacteria 8005
298 Ga0207665_10181263 3300025939 Bacteria 1525
299 Ga0207691_10022722 3300025940 Bacteria 5913
300 Ga0207691_10142454 3300025940 Bacteria 2111
301 Ga0207689_10000247 3300025942 Bacteria 48421
302 Ga0207689_10057931 3300025942 Bacteria 3186
303 Ga0207661_10021608 3300025944 Bacteria 4824
304 Ga0207661_10025730 3300025944 Bacteria 4477
305 Ga0207661_10079054 3300025944 Bacteria 2710
306 Ga0207679_10187512 3300025945 Bacteria 1716
307 Ga0207667_10019931 3300025949 Bacteria 7473
308 Ga0207667_10030735 3300025949 Bacteria 5805
309 Ga0207667_10273780 3300025949 Bacteria 1726
310 Ga0207651_10041567 3300025960 Bacteria 3053
311 Ga0207668_10008002 3300025972 Bacteria 6291
312 Ga0207668_10127140 3300025972 Bacteria 1940
313 Ga0207640_10061985 3300025981 Bacteria 2479
314 Ga0207677_10009652 3300026023 Bacteria 5434
315 Ga0207703_10185058 3300026035 Bacteria 1840
316 Ga0207703_10201433 3300026035 Bacteria 1769
317 Ga0207678_10002660 3300026067 Bacteria 16232
318 Ga0207678_10004730 3300026067 Bacteria 12226
319 Ga0207678_10006233 3300026067 Bacteria 10593
320 Ga0207678_10007527 3300026067 Bacteria 9627
321 Ga0207708_10001288 3300026075 Bacteria 18839
322 Ga0207708_10010392 3300026075 Bacteria 6909
323 Ga0207708_10168519 3300026075 Bacteria 1733
324 Ga0207702_10003223 3300026078 Bacteria 15072
325 Ga0207702_10012065 3300026078 Bacteria 7187
326 Ga0207702_10025530 3300026078 Bacteria 4904
327 Ga0207702_10065017 3300026078 Bacteria 3123
328 Ga0207702_10159160 3300026078 Bacteria 2061
329 Ga0207641_10201328 3300026088 Bacteria 1836
330 Ga0207641_10205724 3300026088 Bacteria 1817
331 Ga0207648_10000136 3300026089 Bacteria 73368
332 Ga0207676_10001377 3300026095 Bacteria 18083
333 Ga0207674_10023525 3300026116 Bacteria 6596
334 Ga0207675_100053991 3300026118 Bacteria 3748
335 Ga0207675_100102502 3300026118 Bacteria 2697
336 Ga0207675_100117780 3300026118 Bacteria 2511
337 Ga0207683_10000371 3300026121 Bacteria 41225
338 Ga0207683_10001767 3300026121 Bacteria 19129
339 Ga0207683_10005450 3300026121 Bacteria 10898
340 Ga0207428_10017252 3300027907 Bacteria 6199
341 Ga0207428_10028153 3300027907 Bacteria 4671
342 Ga0268266_10017670 3300028379 Bacteria 6082
343 Ga0268265_10075331 3300028380 Bacteria 2643
344 Ga0268265_10251362 3300028380 Bacteria 1566
345 Ga0268264_10027520 3300028381 Bacteria 4647
346 Ga0268264_10143485 3300028381 Bacteria 2132
347 Ga0268264_10526121 3300028381 Bacteria 1157
348 Ga0307513_10235564 3300031456 Bacteria 1640
349 Ga0316577_10001679 3300031733 Bacteria 10609
350 Ga0316577_10153117 3300031733 Bacteria 1300
351 Ga0307410_10256611 3300031852 Bacteria 1362
352 Ga0307406_10008721 3300031901 Bacteria 5667
353 Ga0307406_10072018 3300031901 Bacteria 2267
354 Ga0307407_10232777 3300031903 Bacteria 1252
355 Ga0307507_10000090 3300033179 Bacteria 142457
356 Ga0373938_0007430 3300034957 Bacteria 1927
357 Ga0373938_0018038 3300034957 Bacteria 1396
358 Ga0373951_0021390 3300035091 Bacteria 1486
359 Ga0373943_0143582 3300035170 Bacteria 1288
360 Ga0373931_0063704 3300035691 Bacteria 1993
361 Ga0395899_0007122 3300037312 Bacteria 8651
362 Ga0395899_0013580 3300037312 Bacteria 6226
363 Ga0395899_0088251 3300037312 Bacteria 2250
364 Ga0395900_0001036 3300037418 Bacteria 35631
365 Ga0395900_0093344 3300037418 Bacteria 3091
366 Ga0395898_0001318 3300037466 Bacteria 36063
367 Ga0395898_0010178 3300037466 Bacteria 9845
368 Ga0395898_0059579 3300037466 Bacteria 3713
369 Ga0395898_0244177 3300037466 Bacteria 1712
370 Ga0395905_0007007 3300037471 Bacteria 11268
371 Ga0395905_0304086 3300037471 Bacteria 1482
372 Ga0436364_1475170 3300037853 Bacteria 3888
373 Ga0395901_0040462 3300038443 Bacteria 4828
374 Ga0395901_0442324 3300038443 Bacteria 1330
375 Ga0400485_15906 3300038735 Bacteria 2673
376 Ga0436360_0802153 3300039438 Bacteria 5012
377 Ga0436360_1224020 3300039438 Bacteria 1815
378 Ga0451795_1479959 3300041456 Bacteria 2088
379 Ga0451800_0130591 3300041459 Bacteria 1286
380 Ga0451833_0174647 3300041491 Bacteria 3665
381 Ga0451839_1186836 3300041496 Bacteria 2734
382 Ga0451853_1398733 3300041512 Bacteria 5192
383 Ga0439450_025599 3300042008 Bacteria 1295
384 Ga0439458_0021472 3300042157 Bacteria 1495
385 Ga0439459_0004658 3300042438 Bacteria 2217
386 Ga0466969_0046218 3300044656 Bacteria 2159
387 Ga0466966_0016415 3300044684 Bacteria 4893
388 Ga0466963_0015316 3300044694 Bacteria 4744
389 Ga0466963_0067077 3300044694 Bacteria 2407
390 Ga0466963_0138280 3300044694 Bacteria 1686
391 Ga0466970_0017951 3300044765 Bacteria 3660
392 Ga0466957_0023206 3300044842 Bacteria 3666
393 Ga0466957_0122923 3300044842 Bacteria 1656
394 Ga0466957_0210089 3300044842 Bacteria 1281
395 Ga0466960_0006554 3300044901 Bacteria 4675
396 Ga0466960_0008279 3300044901 Bacteria 4253
397 Ga0466960_0020471 3300044901 Bacteria 2931
398 Ga0466958_0065680 3300045836 Bacteria 2214
399 Ga0466967_0070336 3300045976 Bacteria 3131
400 Ga0466967_0608088 3300045976 Bacteria 1079
401 Ga0495603_0163354 3300046455 Bacteria 1291
402 Ga0495629_0321513 3300046459 Bacteria 1058
403 Ga0495641_0046397 3300046461 Bacteria 1998
404 Ga0495582_0019253 3300046473 Bacteria 3733
405 Ga0495582_0051079 3300046473 Bacteria 2279
406 Ga0495596_0081277 3300046500 Bacteria 1258
407 Ga0495607_0071824 3300046501 Bacteria 1929
408 Ga0495628_0233265 3300046516 Bacteria 1379
409 Ga0495663_0022204 3300046525 Bacteria 1832
410 Ga0495586_0036394 3300046535 Bacteria 2642
411 Ga0495609_0072193 3300046538 Bacteria 1516
412 Ga0495656_0062822 3300046615 Bacteria 1626
413 Ga0495668_0075739 3300046616 Bacteria 1848
414 Ga0495634_0033804 3300046642 Bacteria 3511
415 Ga0495625_0006148 3300046660 Bacteria 10750
416 Ga0495588_0206037 3300046674 Bacteria 1039
417 Ga0495647_0045356 3300046681 Bacteria 1688
418 Ga0495589_0089684 3300046794 Bacteria 1493
419 Ga0495676_0104132 3300047321 Bacteria 2094
420 Ga0495683_0033576 3300047323 Bacteria 2610
421 Ga0495677_0067882 3300047445 Bacteria 1327
422 Ga0495684_0050774 3300047471 Bacteria 3166
423 Ga0495614_0060465 3300048089 Bacteria 1628
424 Ga0495626_0000784 3300048091 Bacteria 28861
425 Ga0496100_0234149 3300048903 Bacteria 1352
426 Ga0496101_0001995 3300048904 Bacteria 12381
427 Ga0496101_0321973 3300048904 Bacteria 1213
428 Ga0496102_0015059 3300048905 Bacteria 6731
429 Ga0496102_0105287 3300048905 Bacteria 2624
430 Ga0496103_0004353 3300048906 Bacteria 8595
431 Ga0496104_0054633 3300048907 Bacteria 3775
432 Ga0496104_0139194 3300048907 Bacteria 2332
433 Ga0496105_0013282 3300048908 Bacteria 6535
434 Ga0496105_0045250 3300048908 Bacteria 3631
435 Ga0496105_0071739 3300048908 Bacteria 2862
436 Ga0496105_0178068 3300048908 Bacteria 1741
437 Ga0496105_0211082 3300048908 Bacteria 1582
438 Ga0496106_0003272 3300048909 Bacteria 12106
439 Ga0496106_0003308 3300048909 Bacteria 12017
440 Ga0496107_0014241 3300048910 Bacteria 5569
441 Ga0496108_0009239 3300048911 Bacteria 7977
442 Ga0496108_0112864 3300048911 Bacteria 2325
443 Ga0496108_0175768 3300048911 Bacteria 1853
444 Ga0496108_0265716 3300048911 Bacteria 1493
445 Ga0496109_0004612 3300048912 Bacteria 11501
446 Ga0496109_0008315 3300048912 Bacteria 8812
447 Ga0496109_0020626 3300048912 Bacteria 5822
448 Ga0496109_0032504 3300048912 Bacteria 4690
449 Ga0496109_0037431 3300048912 Bacteria 4382
450 Ga0496109_0482993 3300048912 Bacteria 1170
451 Ga0496110_0007957 3300048913 Bacteria 8490
452 Ga0496110_0058833 3300048913 Bacteria 3385
453 Ga0496110_0090814 3300048913 Bacteria 2731
454 Ga0496110_0146853 3300048913 Bacteria 2133
455 Ga0496111_0004766 3300048914 Bacteria 8604
456 Ga0496111_0011523 3300048914 Bacteria 5961
457 Ga0496112_0001031 3300048915 Bacteria 20495
458 Ga0496112_0016365 3300048915 Bacteria 6945
459 Ga0496112_0020727 3300048915 Bacteria 6236
460 Ga0496112_0051384 3300048915 Bacteria 4043
461 Ga0496112_0081851 3300048915 Bacteria 3193
462 Ga0496114_0039819 3300048917 Bacteria 3889
463 Ga0496114_0396632 3300048917 Bacteria 1222
464 Ga0496115_0003007 3300048918 Bacteria 12105
465 Ga0496115_0003930 3300048918 Bacteria 10708
466 Ga0501032_0014627 3300049569 Bacteria 5559
467 Ga0501034_0042176 3300049571 Bacteria 4619
468 Ga0501034_0223019 3300049571 Bacteria 1837
469 Ga0501036_0105172 3300049572 Bacteria 2387
470 Ga0501036_0158258 3300049572 Bacteria 1910
471 Ga0501036_0236158 3300049572 Bacteria 1533
472 Ga0501036_0532618 3300049572 Bacteria 976
473 Ga0501037_0048648 3300049573 Bacteria 3106
474 Ga0501038_0003462 3300049574 Bacteria 14721
475 Ga0501039_0043255 3300049575 Bacteria 3480
476 Ga0501040_0010511 3300049576 Bacteria 6054
477 Ga0501046_0161631 3300049580 Bacteria 1684
478 Ga0501046_0163438 3300049580 Bacteria 1673
479 Ga0501047_0003842 3300049581 Bacteria 14123
480 Ga0501048_0001586 3300049582 Bacteria 17266
481 Ga0501048_0079127 3300049582 Bacteria 2320
482 Ga0501069_0000015 3300049585 Bacteria 144828
483 Ga0501070_0000005 3300049586 Bacteria 250033
484 Ga0501072_0048035 3300049588 Bacteria 3361
485 Ga0501072_0120312 3300049588 Bacteria 2092
486 Ga0501073_0252634 3300049589 Bacteria 1217
487 Ga0501075_0265262 3300049591 Bacteria 1309
488 Ga0501079_0357495 3300049741 Bacteria 1144
489 Ga0501080_0113700 3300049742 Bacteria 2510
490 Ga0501081_0059112 3300049743 Bacteria 2653
491 Ga0501081_0243136 3300049743 Bacteria 1313
492 Ga0501035_0021169 3300049822 Bacteria 5977
493 Ga0501044_0028149 3300049823 Bacteria 5932
494 Ga0501044_0197182 3300049823 Bacteria 1973
495 nmdc:mga06z11_103606_c1 3300050494 Bacteria 1565
496 nmdc:mga05p37_18065_c1 3300050507 Bacteria 8519
497 nmdc:mga05p37_988_c1 3300050507 Bacteria 32390
498 nmdc:mga09592_11_c2 3300050508 Bacteria 31986
499 nmdc:mga09592_15716_c1 3300050508 Bacteria 6185
500 nmdc:mga0qj67_122711_c1 3300050509 Bacteria 2102
501 nmdc:mga0qj67_2886_c1 3300050509 Bacteria 10551
502 nmdc:mga0qj67_95_c1 3300050509 Bacteria 59712
503 nmdc:mga06r32_31796_c1 3300050510 Bacteria 4960
504 nmdc:mga06r32_73821_c1 3300050510 Bacteria 3306
505 nmdc:mga08y16_23821_c1 3300050511 Bacteria 6465
506 nmdc:mga0n895_147901_c1 3300050512 Bacteria 2379
507 nmdc:mga0n895_53044_c1 3300050512 Bacteria 3982
508 nmdc:mga0n895_56284_c1 3300050512 Bacteria 3874
509 nmdc:mga0rr50_2965_c1 3300050513 Bacteria 9710
510 nmdc:mga0rr50_32652_c1 3300050513 Bacteria 3712
511 nmdc:mga0a205_22916_c1 3300050515 Bacteria 5921
512 nmdc:mga0a205_30741_c1 3300050515 Bacteria 5144
513 Ga0495619_0054362 3300053085 Bacteria 2650
514 Ga0500556_0000873 3300053104 Bacteria 17059
515 Ga0500593_000011 3300053117 Bacteria 62847
516 Ga0501084_0000039 3300054114 Bacteria 107409
517 Ga0501084_0219145 3300054114 Bacteria 1606
518 Ga0501082_0109127 3300060353 Bacteria 2395
519 Ga0530510_0172938 3300061734 Bacteria 1600
520 2515855055 2515154155 Bacteria 7985436
521 2676482800 2675903059 Bacteria 8644972
522 2740169179 2739367898 Bacteria 4367674
523 2774392054 2773857762 Bacteria 5971770
524 2809195843 2808606439 Bacteria 5952208
525 2812352012 2811994878 Bacteria 5992952
526 2816427906 2816332119 Bacteria 8120218
527 2837273106 2837268691 Bacteria 7850704
528 2868091040 2868088558 Bacteria 7609351
529 2891970333 2891968417 Bacteria 5821697
530 8055069151 8055066027 Bacteria 9479577
531 Ga0466958_0010057
532 JGI24737J22298_10030121
533 JGI24744J21845_10000545
534 JGI25407J50210_10004461
535 Ga0070658_10026555
536 Ga0070658_10040098
537 Ga0070658_10085736
538 Ga0070676_10036155
539 Ga0070683_100099023
540 Ga0070683_100225704
541 Ga0070683_100463737
542 Ga0070690_100040037
543 Ga0068869_100031104
544 Ga0068869_100039413
545 Ga0068869_100220673
546 Ga0070666_10006718
547 Ga0070666_10086441
548 Ga0070680_100019850
549 Ga0070680_100045197
550 Ga0070680_100056004
551 Ga0070682_100005590
552 Ga0070682_100017200
553 Ga0070682_100036541
554 Ga0070682_100051246
555 Ga0068868_100015311
556 Ga0068868_100059582
557 Ga0068868_100073754
558 Ga0070660_100010729
559 Ga0070660_100036062
560 Ga0070660_100038745
561 Ga0070660_100039585
562 Ga0070660_100044493
563 Ga0070689_100031570
564 Ga0070689_100034973
565 Ga0070689_100069027
566 Ga0070691_10061776
567 Ga0070687_100051835
568 Ga0070661_100125786
569 Ga0070692_10005129
570 Ga0070692_10006244
571 Ga0070692_10077594
572 Ga0070668_100004474
573 Ga0070668_100026766
574 Ga0070675_100001736
575 Ga0070671_100089434
576 Ga0070674_100046836
577 Ga0070673_100011571
578 Ga0070688_100014703
579 Ga0070659_100009691
580 Ga0070659_100015288
581 Ga0070659_100103578
582 Ga0070667_100061539
583 Ga0070703_10018689
584 Ga0070703_10027438
585 Ga0070709_10030733
586 Ga0070714_100019745
587 Ga0070714_100024226
588 Ga0070713_100225978
589 Ga0070713_100265278
590 Ga0070701_10004503
591 Ga0070701_10024991
592 Ga0070711_100001075
593 Ga0070711_100018634
594 Ga0070705_100012689
595 Ga0070700_100007469
596 Ga0070700_100018475
597 Ga0070700_100271409
598 Ga0070694_100021359
599 Ga0070708_100245364
600 Ga0070663_100004470
601 Ga0070663_100007874
602 Ga0070663_100030501
603 Ga0070678_100019929
604 Ga0070678_100261392
605 Ga0070662_100015307
606 Ga0070662_100037828
607 Ga0068867_100010996
608 Ga0070685_10006574
609 Ga0070685_10075681
610 Ga0070706_100010936
611 Ga0070706_100033206
612 Ga0070706_100123628
613 Ga0070707_100000635
614 Ga0070707_100012722
615 Ga0070707_100031619
616 Ga0070698_100001447
617 Ga0070698_100121812
618 Ga0070699_100004137
619 Ga0070699_100345317
620 Ga0070679_100039850
621 Ga0070679_100130014
622 Ga0070684_100007429
623 Ga0070697_100039791
624 Ga0068853_100024124
625 Ga0068853_100128707
626 Ga0070672_100016444
627 Ga0070672_100228061
628 Ga0070686_100009810
629 Ga0070695_100077633
630 Ga0070696_100070710
631 Ga0070696_100084546
632 Ga0070693_100017250
633 Ga0070693_100033717
634 Ga0070665_100003419
635 Ga0070665_100032592
636 Ga0070665_100072829
637 Ga0070704_100223077
638 Ga0068855_100033888
639 Ga0068855_100086601
640 Ga0068855_100087187
641 Ga0068855_100089581
642 Ga0068855_100105730
643 Ga0068855_100249612
644 Ga0070664_100101896
645 Ga0068857_100008769
646 Ga0068854_100082572
647 Ga0068856_100016290
648 Ga0068856_100039021
649 Ga0068856_100046948
650 Ga0068856_100335295
651 Ga0070702_100001788
652 Ga0070702_100012528
653 Ga0070702_100043982
654 Ga0068852_100002353
655 Ga0068852_100009242
656 Ga0068852_100054285
657 Ga0068852_100218138
658 Ga0068859_100075629
659 Ga0068864_100035439
660 Ga0068866_10007635
661 Ga0068866_10210285
662 Ga0068861_100011898
663 Ga0068861_100090326
664 Ga0068851_10006785
665 Ga0068863_100060043
666 Ga0068863_100222824
667 Ga0068858_100140183
668 Ga0068860_100111399
669 Ga0068862_100109523
670 Ga0068862_100312772
671 Ga0081538_10000049
672 Ga0081538_10038364
673 Ga0081540_1003473
674 Ga0081539_10038831
675 Ga0070717_10079799
676 Ga0075365_10185883
677 Ga0070716_100011674
678 Ga0070712_100025640
679 Ga0075367_10036937
680 Ga0097621_100013980
681 Ga0097621_100015174
682 Ga0097621_100048732
683 Ga0068871_100006377
684 Ga0068871_100014424
685 Ga0068871_100041942
686 Ga0075428_100062002
687 Ga0075428_100090538
688 Ga0075430_100003484
689 Ga0075430_100085669
690 Ga0075430_100136720
691 Ga0075431_100012225
692 Ga0075431_100235015
693 Ga0075433_10425664
694 Ga0075429_100013032
695 Ga0068865_100004949
696 Ga0068865_100014446
697 Ga0075436_100005573
698 Ga0075436_100058529
699 Ga0097620_100075631
700 Ga0075435_100014980
701 Ga0075435_100020196
702 Ga0105240_10093724
703 Ga0105240_10118923
704 Ga0111539_10045488
705 Ga0105245_10044961
706 Ga0105245_10046722
707 Ga0105245_10322263
708 Ga0105247_10005243
709 Ga0105247_10033774
710 Ga0114129_10000031
711 Ga0114129_10004129
712 Ga0105243_10030792
713 Ga0105243_10038471
714 Ga0105243_10067972
715 Ga0105241_10033100
716 Ga0105242_10014129
717 Ga0105242_10181238
718 Ga0105248_10026459
719 Ga0105248_10045083
720 Ga0105248_10047870
721 Ga0105248_10166209
722 Ga0105237_10164035
723 Ga0105238_10041390
724 Ga0105238_10086054
725 Ga0105249_10001347
726 Ga0105249_10024591
727 Ga0105249_10576702
728 Ga0105239_10009547
729 Ga0105239_10057810
730 Ga0105246_10398628
731 Ga0157371_10010959
732 Ga0157370_10034064
733 Ga0157370_10070116
734 Ga0157370_10109761
735 Ga0157369_10009918
736 Ga0157369_10027326
737 Ga0157369_10254116
738 Ga0157374_10015577
739 Ga0157378_10006940
740 Ga0157378_10223309
741 Ga0163162_10013364
742 Ga0163162_10027647
743 Ga0157372_10211441
744 Ga0157372_10696458
745 Ga0157375_10024586
746 Ga0157375_10034939
747 Ga0157375_10064065
748 Ga0157375_10083117
749 Ga0163163_10029525
750 Ga0163163_10033950
751 Ga0163163_10182291
752 Ga0157380_10008097
753 Ga0157377_10005998
754 Ga0157377_10022170
755 Ga0157379_10505087
756 Ga0157376_10020185
757 Ga0157376_10036577
758 Ga0163161_10010508
759 Ga0206356_10427959
760 Ga0206354_10719510
761 Ga0206354_10843100
762 Ga0206353_11193225
763 Ga0213871_10066000
764 Ga0207692_10004373
765 Ga0207642_10004902
766 Ga0207710_10130136
767 Ga0207688_10023993
768 Ga0207688_10036365
769 Ga0207688_10044967
770 Ga0207680_10026642
771 Ga0207680_10056408
772 Ga0207647_10008509
773 Ga0207647_10033696
774 Ga0207699_10041704
775 Ga0207645_10067108
776 Ga0207645_10090760
777 Ga0207643_10000112
778 Ga0207643_10058599
779 Ga0207705_10094338
780 Ga0207705_10171805
781 Ga0207684_10091589
782 Ga0207654_10096048
783 Ga0207707_10056943
784 Ga0207671_10052335
785 Ga0207671_10127655
786 Ga0207693_10000409
787 Ga0207693_10001176
788 Ga0207663_10060209
789 Ga0207660_10007499
790 Ga0207660_10222278
791 Ga0207662_10052854
792 Ga0207657_10003179
793 Ga0207657_10005213
794 Ga0207657_10065016
795 Ga0207657_10119832
796 Ga0207652_10012926
797 Ga0207652_10045951
798 Ga0207652_10053775
799 Ga0207646_10002084
800 Ga0207646_10007636
801 Ga0207694_10047309
802 Ga0207650_10004590
803 Ga0207659_10005948
804 Ga0207687_10003050
805 Ga0207687_10056798
806 Ga0207700_10123007
807 Ga0207664_10025967
808 Ga0207664_10032082
809 Ga0207664_10042739
810 Ga0207644_10081838
811 Ga0207644_10100121
812 Ga0207690_10027965
813 Ga0207690_10090892
814 Ga0207690_10108327
815 Ga0207690_10352944
816 Ga0207706_10003043
817 Ga0207706_10024684
818 Ga0207706_10113924
819 Ga0207686_10003864
820 Ga0207686_10026043
821 Ga0207709_10012187
822 Ga0207709_10062374
823 Ga0207669_10021389
824 Ga0207669_10072106
825 Ga0207704_10005166
826 Ga0207704_10079420
827 Ga0207665_10006099
828 Ga0207665_10181263
829 Ga0207691_10022722
830 Ga0207691_10142454
831 Ga0207689_10000247
832 Ga0207689_10057931
833 Ga0207661_10021608
834 Ga0207661_10025730
835 Ga0207661_10079054
836 Ga0207679_10187512
837 Ga0207667_10019931
838 Ga0207667_10030735
839 Ga0207667_10273780
840 Ga0207651_10041567
841 Ga0207668_10008002
842 Ga0207668_10127140
843 Ga0207640_10061985
844 Ga0207677_10009652
845 Ga0207703_10185058
846 Ga0207703_10201433
847 Ga0207678_10002660
848 Ga0207678_10004730
849 Ga0207678_10006233
850 Ga0207678_10007527
851 Ga0207708_10001288
852 Ga0207708_10010392
853 Ga0207708_10168519
854 Ga0207702_10003223
855 Ga0207702_10012065
856 Ga0207702_10025530
857 Ga0207702_10065017
858 Ga0207702_10159160
859 Ga0207641_10201328
860 Ga0207641_10205724
861 Ga0207648_10000136
862 Ga0207676_10001377
863 Ga0207674_10023525
864 Ga0207675_100053991
865 Ga0207675_100102502
866 Ga0207675_100117780
867 Ga0207683_10000371
868 Ga0207683_10001767
869 Ga0207683_10005450
870 Ga0207428_10017252
871 Ga0207428_10028153
872 Ga0268266_10017670
873 Ga0268265_10075331
874 Ga0268265_10251362
875 Ga0268264_10027520
876 Ga0268264_10143485
877 Ga0268264_10526121
878 Ga0307513_10235564
879 Ga0316577_10001679
880 Ga0316577_10153117
881 Ga0307410_10256611
882 Ga0307406_10008721
883 Ga0307406_10072018
884 Ga0307407_10232777
885 Ga0307507_10000090
886 Ga0373938_0007430
887 Ga0373938_0018038
888 Ga0373951_0021390
889 Ga0373943_0143582
890 Ga0373931_0063704
891 Ga0395899_0007122
892 Ga0395899_0013580
893 Ga0395899_0088251
894 Ga0395900_0001036
895 Ga0395900_0093344
896 Ga0395898_0001318
897 Ga0395898_0010178
898 Ga0395898_0059579
899 Ga0395898_0244177
900 Ga0395905_0007007
901 Ga0395905_0304086
902 Ga0436364_1475170
903 Ga0395901_0040462
904 Ga0395901_0442324
905 Ga0400485_15906
906 Ga0436360_0802153
907 Ga0436360_1224020
908 Ga0451795_1479959
909 Ga0451800_0130591
910 Ga0451833_0174647
911 Ga0451839_1186836
912 Ga0451853_1398733
913 Ga0439450_025599
914 Ga0439458_0021472
915 Ga0439459_0004658
916 Ga0466969_0046218
917 Ga0466966_0016415
918 Ga0466963_0015316
919 Ga0466963_0067077
920 Ga0466963_0138280
921 Ga0466970_0017951
922 Ga0466957_0023206
923 Ga0466957_0122923
924 Ga0466957_0210089
925 Ga0466960_0006554
926 Ga0466960_0008279
927 Ga0466960_0020471
928 Ga0466958_0065680
929 Ga0466967_0070336
930 Ga0466967_0608088
931 Ga0495603_0163354
932 Ga0495629_0321513
933 Ga0495641_0046397
934 Ga0495582_0019253
935 Ga0495582_0051079
936 Ga0495596_0081277
937 Ga0495607_0071824
938 Ga0495628_0233265
939 Ga0495663_0022204
940 Ga0495586_0036394
941 Ga0495609_0072193
942 Ga0495656_0062822
943 Ga0495668_0075739
944 Ga0495634_0033804
945 Ga0495625_0006148
946 Ga0495588_0206037
947 Ga0495647_0045356
948 Ga0495589_0089684
949 Ga0495676_0104132
950 Ga0495683_0033576
951 Ga0495677_0067882
952 Ga0495684_0050774
953 Ga0495614_0060465
954 Ga0495626_0000784
955 Ga0496100_0234149
956 Ga0496101_0001995
957 Ga0496101_0321973
958 Ga0496102_0015059
959 Ga0496102_0105287
960 Ga0496103_0004353
961 Ga0496104_0054633
962 Ga0496104_0139194
963 Ga0496105_0013282
964 Ga0496105_0045250
965 Ga0496105_0071739
966 Ga0496105_0178068
967 Ga0496105_0211082
968 Ga0496106_0003272
969 Ga0496106_0003308
970 Ga0496107_0014241
971 Ga0496108_0009239
972 Ga0496108_0112864
973 Ga0496108_0175768
974 Ga0496108_0265716
975 Ga0496109_0004612
976 Ga0496109_0008315
977 Ga0496109_0020626
978 Ga0496109_0032504
979 Ga0496109_0037431
980 Ga0496109_0482993
981 Ga0496110_0007957
982 Ga0496110_0058833
983 Ga0496110_0090814
984 Ga0496110_0146853
985 Ga0496111_0004766
986 Ga0496111_0011523
987 Ga0496112_0001031
988 Ga0496112_0016365
989 Ga0496112_0020727
990 Ga0496112_0051384
991 Ga0496112_0081851
992 Ga0496114_0039819
993 Ga0496114_0396632
994 Ga0496115_0003007
995 Ga0496115_0003930
996 Ga0501032_0014627
997 Ga0501034_0042176
998 Ga0501034_0223019
999 Ga0501036_0105172
1000 Ga0501036_0158258
1001 Ga0501036_0236158
1002 Ga0501036_0532618
1003 Ga0501037_0048648
1004 Ga0501038_0003462
1005 Ga0501039_0043255
1006 Ga0501040_0010511
1007 Ga0501046_0161631
1008 Ga0501046_0163438
1009 Ga0501047_0003842
1010 Ga0501048_0001586
1011 Ga0501048_0079127
1012 Ga0501069_0000015
1013 Ga0501070_0000005
1014 Ga0501072_0048035
1015 Ga0501072_0120312
1016 Ga0501073_0252634
1017 Ga0501075_0265262
1018 Ga0501079_0357495
1019 Ga0501080_0113700
1020 Ga0501081_0059112
1021 Ga0501081_0243136
1022 Ga0501035_0021169
1023 Ga0501044_0028149
1024 Ga0501044_0197182
1025 nmdc:mga06z11_103606_c1
1026 nmdc:mga05p37_18065_c1
1027 nmdc:mga05p37_988_c1
1028 nmdc:mga09592_11_c2
1029 nmdc:mga09592_15716_c1
1030 nmdc:mga0qj67_122711_c1
1031 nmdc:mga0qj67_2886_c1
1032 nmdc:mga0qj67_95_c1
1033 nmdc:mga06r32_31796_c1
1034 nmdc:mga06r32_73821_c1
1035 nmdc:mga08y16_23821_c1
1036 nmdc:mga0n895_147901_c1
1037 nmdc:mga0n895_53044_c1
1038 nmdc:mga0n895_56284_c1
1039 nmdc:mga0rr50_2965_c1
1040 nmdc:mga0rr50_32652_c1
1041 nmdc:mga0a205_22916_c1
1042 nmdc:mga0a205_30741_c1
1043 Ga0495619_0054362
1044 Ga0500556_0000873
1045 Ga0500593_000011
1046 Ga0501084_0000039
1047 Ga0501084_0219145
1048 Ga0501082_0109127
1049 Ga0530510_0172938
1050 2515855055
1051 2676482800
1052 2740169179
1053 2774392054
1054 2809195843
1055 2812352012
1056 2816427906
1057 2837273106
1058 2868091040
1059 2891970333
1060 8055069151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

215

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

157

245

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9401 2 222
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9367 14 219
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9301 2 214
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9296 2 221
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9292 3 221
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 2 222 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9673 2 214 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9669 2 214 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 2 224 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9716 2 219 GO:0005524
GO:0016887
AF-A0A1V5YM67-F1-model_v4 Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) 0.9699 2 215 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A535F3M6-F1-model_v4 ABC transporter ATP-binding protein 0.969 2 221 GO:0005524
GO:0016887
AF-A0A381GRC3-F1-model_v4 deleted 0.9688 2 214
AF-A0A3D2KNM8-F1-model_v4 ABC transporter 0.9687 1 221 GO:0005524
GO:0016887

Map