F459999

General Info

Members Datasets Scaffolds Average Seq Length
530 400 1062 254

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0004119|Ga0495650_0004119_2322_3209
Length 295
Sequence VHDTKVTTARIVTIFCIVTIRSGNCGAEPARSNDKDDIMELQGKTALITGGNSGIGLATARLMLAQGARVAITGRDRAKLDEAVAELGPDVLALQADLNRSDDLVAVARAVGEAFGTLDIVFANAGISGPTPLGSTTYEAFRNIVDTNLTSVFFTVQSVLPLLRQGSAIVLNGSVMRELAVGGTAAYSATKAGITGMAKVFATELAPRGIRVNTVIPGATRTPIWTRGARAGATLDATEAHLAPRIPLGRLAEAEEVANAVVFLASPRASGMTAAEIVVDGGTLGAPSGGAIFRG

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
70 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
241 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
242 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
243 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
244 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
245 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
246 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
247 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
248 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
249 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
250 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
251 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
252 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
253 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
254 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
255 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
256 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
257 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
258 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
259 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
260 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
261 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
262 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
263 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
264 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
265 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
266 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
267 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
268 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
269 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
270 2718217882 Rhizobium sp. N741 Isolate Nodule
271 2718217927 Rhizobium sp. N324 Isolate Nodule
272 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
273 2718218009 Rhizobium sp. N561 Isolate Nodule
274 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
275 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
276 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
277 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
278 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
279 2718218363 Rhizobium sp. N113 Isolate Nodule
280 2718218365 Rhizobium sp. N731 Isolate Nodule
281 2718218366 Rhizobium sp. N621 Isolate Nodule
282 2718218423 Rhizobium sp. N941 Isolate Nodule
283 2721755514 Rhizobium sp. N6212 Isolate Nodule
284 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
285 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
286 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
287 2721755809 Rhizobium sp. N541 Isolate Nodule
288 2721755810 Rhizobium sp. N871 Isolate Nodule
289 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
290 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
291 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
292 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
293 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
294 2728369365 Rhizobium sp. N1341 Isolate Nodule
295 2728369397 Rhizobium sp. N1314 Isolate Nodule
296 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
297 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
298 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
299 2791355256 Rhizobium sp. M10 Isolate Nodule
300 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
301 2791355260 Rhizobium sp. L9 Isolate Nodule
302 2791355261 Rhizobium sp. J15 Isolate Nodule
303 2791355262 Rhizobium sp. M1 Isolate Nodule
304 2791355263 Rhizobium chutanense C5 Isolate Nodule
305 2791355264 Rhizobium sp. S9 Isolate Nodule
306 2791355265 Rhizobium sp. H4 Isolate Nodule
307 2791355266 Rhizobium sp. L43 Isolate Nodule
308 2791355267 Rhizobium sp. L18 Isolate Nodule
309 2802429633 Rhizobium anhuiense J3 Isolate Nodule
310 2802429634 Rhizobium anhuiense S10 Isolate Nodule
311 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
312 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
313 2802429637 Rhizobium anhuiense C15 Isolate Nodule
314 2818991459 Paenibacillus sp. 597 Isolate Unclassified
315 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
316 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
317 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
318 2838048938 Rhizobium pisi 27/80 Isolate Nodule
319 2838061910 Rhizobium phaseoli L15 Isolate Nodule
320 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
321 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
322 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
323 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
324 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
325 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
326 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
327 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
328 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
329 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
330 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
331 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
332 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
333 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
334 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
335 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
336 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
337 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
338 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
339 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
340 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
341 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
342 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
343 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
344 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
345 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
346 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
347 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
348 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
349 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
350 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
351 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
352 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
353 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
354 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
355 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
356 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
357 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
358 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
359 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
360 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
361 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
362 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
363 2933599457 Rhizobium phaseoli M3 Isolate Nodule
364 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
365 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
366 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
367 2936381700 Rhizobium chutanense C16 Isolate Unclassified
368 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
369 2996887358 Rhizobium sp. R711 Isolate Nodule
370 2996893221 Rhizobium sp. R635 Isolate Nodule
371 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
372 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
373 8005258706 Rhizobium sp. R693 Isolate Nodule
374 8005275841 Rhizobium sp. N4311 Isolate Nodule
375 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
376 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
377 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
378 8005321885 Rhizobium sp. R72 Isolate Nodule
379 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
380 8005382845 Rhizobium sp. R634 Isolate Nodule
381 8005395548 Rhizobium sp. R339 Isolate Nodule
382 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
383 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
384 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
385 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
386 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
387 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
388 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
389 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
390 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
391 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
392 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
393 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
394 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
395 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
396 8018176218 Rhizobium sp. N122 Isolate Nodule
397 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
398 8056382006 Rhizobium croatiense 13T Isolate Nodule
399 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
400 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.43
Metatranscriptomes 0
Isolates 30.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.91
Nodule 24.34
Rhizoplane 1.7
Rhizosphere 36.79
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0004119 3300046471 Bacteria 10129
2 JGI25158J39367_1003026 3300002739 Bacteria 2643
3 JGI25152J39213_1003247 3300002773 Bacteria 5642
4 JGI25152J39213_1005508 3300002773 Bacteria 3668
5 JGI25159J45721_1000289 3300002987 Bacteria 23616
6 JGI25159J45721_1001613 3300002987 Bacteria 9224
7 JGI25151J46595_10000506 3300003187 Bacteria 36556
8 JGI25153J46596_10005211 3300003215 Bacteria 6841
9 JGI25153J46596_10005668 3300003215 Bacteria 6518
10 rootH1_10029736 3300003316 Bacteria 3250
11 rootH1_10068274 3300003316 Bacteria 3003
12 rootH2_10042848 3300003320 Bacteria 3091
13 rootH2_10059413 3300003320 Bacteria 5550
14 rootH1_10031533 3300003316 Bacteria 9861
15 rootH1_10031533 3300003323 Bacteria 6090
16 rootH1_10125278 3300003316 Eukaryota 1356
17 rootH1_10125278 3300003323 Bacteria 2387
18 rootH1_10149944 3300003323 Bacteria 1132
19 rootH1_10157081 3300003323 Bacteria 1938
20 JGI25160J50197_1000004 3300003354 Bacteria 419797
21 JGI25160J50197_1002391 3300003354 Bacteria 8751
22 JGI25160J50197_1004081 3300003354 Bacteria 6358
23 JGI25160J50197_1011479 3300003354 Bacteria 3139
24 JGI25161J50226_1000003 3300003374 Bacteria 413345
25 JGI25161J50226_1000126 3300003374 Bacteria 54396
26 JGI25161J50226_1000372 3300003374 Bacteria 22540
27 JGI25161J50226_1005931 3300003374 Bacteria 2282
28 Ga0055539_1000280 3300003752 Bacteria 29407
29 Ga0055533_1000043 3300003756 Bacteria 229262
30 Ga0055525_1000981 3300003759 Bacteria 7709
31 Ga0055526_1000377 3300003771 Bacteria 36137
32 Ga0055526_1001577 3300003771 Bacteria 16040
33 Ga0055526_1004949 3300003771 Bacteria 7824
34 Ga0055526_1009362 3300003771 Bacteria 4724
35 Ga0055526_1014689 3300003771 Bacteria 3200
36 Ga0055524_1003719 3300003775 Bacteria 7292
37 Ga0055524_1004405 3300003775 Bacteria 6494
38 Ga0055524_1004442 3300003775 Bacteria 6470
39 Ga0055524_1009384 3300003775 Bacteria 3986
40 Ga0055536_1006211 3300003781 Bacteria 5641
41 Ga0055528_1000067 3300003790 Bacteria 83853
42 Ga0055528_1000890 3300003790 Bacteria 20167
43 Ga0055528_1001085 3300003790 Bacteria 17923
44 Ga0055528_1011409 3300003790 Bacteria 3531
45 Ga0055528_1014375 3300003790 Bacteria 2931
46 Ga0055530_10030293 3300003791 Bacteria 1435
47 Ga0055540_1000613 3300003792 Bacteria 25435
48 Ga0055540_1001575 3300003792 Bacteria 13294
49 Ga0055540_1004063 3300003792 Bacteria 6789
50 Ga0055540_1007015 3300003792 Bacteria 4344
51 Ga0055540_1015524 3300003792 Bacteria 2211
52 Ga0055531_10004951 3300003794 Bacteria 7914
53 Ga0055541_1006854 3300003841 Unclassified 1907
54 Ga0055543_1000001 3300004625 Bacteria 419949
55 Ga0055543_1000156 3300004625 Bacteria 57199
56 Ga0055543_1000622 3300004625 Bacteria 19097
57 Ga0055543_1007345 3300004625 Bacteria 2559
58 Ga0065165_1000675 3300005262 Bacteria 49121
59 Ga0065165_1000736 3300005262 Bacteria 45533
60 Ga0065165_1032052 3300005262 Bacteria 1652
61 Ga0065714_10066554 3300005288 Bacteria 6662
62 Ga0065707_10082114 3300005295 Bacteria 21501
63 Ga0070658_10016510 3300005327 Bacteria 5909
64 Ga0070658_10065242 3300005327 Bacteria 2971
65 Ga0070658_10529010 3300005327 Bacteria 1020
66 Ga0070690_100008323 3300005330 Bacteria 5969
67 Ga0068869_100086100 3300005334 Bacteria 2355
68 Ga0070682_100302494 3300005337 Bacteria 1174
69 Ga0070671_100024430 3300005355 Bacteria 4946
70 Ga0070659_100034270 3300005366 Bacteria 3948
71 Ga0070714_100010304 3300005435 Bacteria 7385
72 Ga0070713_100174867 3300005436 Bacteria 1926
73 Ga0070663_100217892 3300005455 Bacteria 1497
74 Ga0070663_100228413 3300005455 Bacteria 1464
75 Ga0070681_10141978 3300005458 Bacteria 2331
76 Ga0070679_100025377 3300005530 Bacteria 5815
77 Ga0070679_100437166 3300005530 Unclassified 1253
78 Ga0070672_100264865 3300005543 Bacteria 1450
79 Ga0070665_100400681 3300005548 Bacteria 1380
80 Ga0068855_100031798 3300005563 Bacteria 6300
81 Ga0068855_100065397 3300005563 Bacteria 4240
82 Ga0068856_100167113 3300005614 Bacteria 2211
83 Ga0068861_100004819 3300005719 Bacteria 9072
84 Ga0081540_1052772 3300005983 Bacteria 1999
85 Ga0081540_1090622 3300005983 Bacteria 1346
86 Ga0070717_10213264 3300006028 Bacteria 1695
87 Ga0075365_10003061 3300006038 Bacteria 8485
88 Ga0075365_10027593 3300006038 Bacteria 3614
89 Ga0075365_10295039 3300006038 Bacteria 1141
90 Ga0075363_100151443 3300006048 Bacteria 1309
91 Ga0075362_10074826 3300006177 Bacteria 1552
92 Ga0075367_10001548 3300006178 Bacteria 9947
93 Ga0075369_10028673 3300006186 Bacteria 2334
94 Ga0075370_10381938 3300006353 Bacteria 844
95 Ga0075428_100106598 3300006844 Bacteria 3055
96 Ga0075430_100037838 3300006846 Bacteria 4090
97 Ga0075431_100080500 3300006847 Bacteria 3363
98 Ga0075433_10008069 3300006852 Bacteria 8382
99 Ga0075434_100002979 3300006871 Bacteria 15067
100 Ga0068865_100498240 3300006881 Bacteria 1015
101 Ga0075435_100001787 3300007076 Bacteria 13994
102 Ga0099794_10010276 3300007265 Bacteria 3967
103 Ga0105250_10006700 3300009092 Bacteria 5006
104 Ga0105240_10024884 3300009093 Bacteria 7881
105 Ga0105240_10066371 3300009093 Bacteria 4477
106 Ga0111539_10035256 3300009094 Bacteria 6059
107 Ga0105247_10081457 3300009101 Bacteria 2041
108 Ga0114129_10007097 3300009147 Bacteria 15942
109 Ga0114129_10042922 3300009147 Bacteria 6364
110 Ga0114129_10130812 3300009147 Bacteria 3447
111 Ga0105243_10279568 3300009148 Bacteria 1503
112 Ga0105242_10205025 3300009176 Bacteria 1753
113 Ga0105248_10019813 3300009177 Bacteria 7451
114 Ga0105237_10346183 3300009545 Bacteria 1490
115 Ga0105237_10611459 3300009545 Bacteria 1097
116 Ga0105249_10201227 3300009553 Bacteria 1949
117 Ga0123341_1000001 3300009765 Bacteria 314908
118 Ga0123342_1014705 3300009766 Bacteria 7379
119 Ga0099796_10022005 3300010159 Bacteria 1972
120 Ga0099796_10038215 3300010159 Bacteria 1609
121 Ga0105239_10226497 3300010375 Bacteria 2097
122 Ga0157370_10019096 3300013104 Bacteria 6890
123 Ga0157374_10194314 3300013296 Unclassified 1986
124 Ga0157380_10000342 3300014326 Bacteria 27911
125 Ga0182008_10052298 3300014497 Bacteria 2025
126 Ga0157376_10192925 3300014969 Bacteria 1869
127 Ga0213872_10011509 3300021361 Bacteria 4184
128 Ga0209436_100361 3300025208 Bacteria 20593
129 Ga0209674_100067 3300025226 Bacteria 253824
130 Ga0209563_100068 3300025230 Bacteria 254802
131 Ga0207425_1008731 3300025245 Bacteria 2568
132 Ga0207425_1009115 3300025245 Bacteria 2490
133 Ga0207425_1013189 3300025245 Bacteria 1916
134 Ga0209677_100049 3300025253 Bacteria 180721
135 Ga0209677_101808 3300025253 Bacteria 8758
136 Ga0209148_1009593 3300025254 Bacteria 1876
137 Ga0209759_1000978 3300025256 Bacteria 19762
138 Ga0209129_1001535 3300025258 Bacteria 12746
139 Ga0209129_1002325 3300025258 Bacteria 9409
140 Ga0209129_1003783 3300025258 Bacteria 6357
141 Ga0209129_1012809 3300025258 Bacteria 1890
142 Ga0209233_1013804 3300025261 Bacteria 2298
143 Ga0209455_1003249 3300025272 Bacteria 5855
144 Ga0209673_1000068 3300025273 Bacteria 245891
145 Ga0209673_1000310 3300025273 Bacteria 89821
146 Ga0209673_1000348 3300025273 Bacteria 84966
147 Ga0209673_1002113 3300025273 Bacteria 14887
148 Ga0209673_1006019 3300025273 Bacteria 5964
149 Ga0209673_1008798 3300025273 Bacteria 4452
150 Ga0209130_1000006 3300025284 Bacteria 596528
151 Ga0209130_1000012 3300025284 Bacteria 421329
152 Ga0209676_1011024 3300025292 Bacteria 3693
153 Ga0209025_1000097 3300025294 Bacteria 236632
154 Ga0209025_1004704 3300025294 Bacteria 11653
155 Ga0209025_1008093 3300025294 Bacteria 7647
156 Ga0209025_1023600 3300025294 Bacteria 3206
157 Ga0209564_1000137 3300025295 Bacteria 183874
158 Ga0209564_1000739 3300025295 Bacteria 46443
159 Ga0209564_1000966 3300025295 Bacteria 36349
160 Ga0209564_1004497 3300025295 Bacteria 8505
161 Ga0209564_1009101 3300025295 Bacteria 4781
162 Ga0209758_1000714 3300025297 Bacteria 49025
163 Ga0209758_1001743 3300025297 Bacteria 24215
164 Ga0209758_1002296 3300025297 Bacteria 19769
165 Ga0209758_1008924 3300025297 Bacteria 6361
166 Ga0209758_1008929 3300025297 Bacteria 6358
167 Ga0209050_1001715 3300025298 Bacteria 21877
168 Ga0209256_1000397 3300025299 Bacteria 68947
169 Ga0209256_1001022 3300025299 Bacteria 32877
170 Ga0209256_1005212 3300025299 Bacteria 7633
171 Ga0209256_1006066 3300025299 Bacteria 6589
172 Ga0207426_1000003 3300025302 Bacteria 1063212
173 Ga0207426_1000010 3300025302 Bacteria 796003
174 Ga0207426_1000094 3300025302 Bacteria 275293
175 Ga0207426_1003738 3300025302 Bacteria 7948
176 Ga0209051_1000201 3300025303 Bacteria 106123
177 Ga0209051_1001312 3300025303 Bacteria 21851
178 Ga0209051_1019336 3300025303 Bacteria 2976
179 Ga0209051_1030961 3300025303 Bacteria 2067
180 Ga0209257_1001768 3300025304 Bacteria 23940
181 Ga0209257_1002387 3300025304 Bacteria 18814
182 Ga0209257_1014345 3300025304 Bacteria 3409
183 Ga0207710_10018041 3300025900 Bacteria 2998
184 Ga0207705_10017565 3300025909 Bacteria 5121
185 Ga0207705_10108138 3300025909 Bacteria 2052
186 Ga0207707_10015378 3300025912 Bacteria 6664
187 Ga0207707_10361657 3300025912 Bacteria 1249
188 Ga0207695_10007496 3300025913 Bacteria 13854
189 Ga0207695_10063748 3300025913 Bacteria 3798
190 Ga0207671_10136072 3300025914 Bacteria 1889
191 Ga0207660_10072909 3300025917 Bacteria 2502
192 Ga0207652_10511802 3300025921 Unclassified 1080
193 Ga0207700_10126716 3300025928 Bacteria 2078
194 Ga0207644_10088264 3300025931 Bacteria 2306
195 Ga0207690_10039999 3300025932 Bacteria 3062
196 Ga0207709_10013955 3300025935 Bacteria 4436
197 Ga0207691_10475069 3300025940 Bacteria 1063
198 Ga0207711_10372648 3300025941 Bacteria 1324
199 Ga0207667_10013254 3300025949 Bacteria 9449
200 Ga0207667_10124317 3300025949 Bacteria 2658
201 Ga0207712_10237192 3300025961 Bacteria 1467
202 Ga0207702_10239045 3300026078 Bacteria 1701
203 Ga0207676_10399010 3300026095 Bacteria 1285
204 Ga0207675_100057149 3300026118 Bacteria 3640
205 Ga0207675_100140082 3300026118 Bacteria 2297
206 Ga0207683_10377205 3300026121 Bacteria 1303
207 Ga0209588_1012102 3300027671 Bacteria 2616
208 Ga0307515_10056344 3300028794 Bacteria 5715
209 Ga0307511_10000036 3300030521 Bacteria 103249
210 Ga0307513_10047444 3300031456 Bacteria 4673
211 Ga0307509_10511758 3300031507 Bacteria 883
212 Ga0307408_100041831 3300031548 Bacteria 3251
213 Ga0307410_10043234 3300031852 Bacteria 2984
214 Ga0307407_10046698 3300031903 Bacteria 2453
215 Ga0307416_100425356 3300032002 Bacteria 1374
216 Ga0436361_0151558 3300039447 Bacteria 5864
217 Ga0436361_0191516 3300039447 Bacteria 4168
218 Ga0439436_0027971 3300041404 Bacteria 1647
219 Ga0439465_0009331 3300041413 Bacteria 3092
220 Ga0439465_0010918 3300041413 Bacteria 2849
221 Ga0451787_130413 3300041441 Bacteria 2673
222 Ga0451791_0487884 3300041451 Bacteria 1812
223 Ga0451791_0954775 3300041451 Bacteria 4129
224 Ga0451793_1076619 3300041452 Bacteria 3465
225 Ga0451833_0887560 3300041491 Bacteria 3077
226 Ga0451837_0082266 3300041494 Bacteria 2458
227 Ga0451839_0865257 3300041496 Bacteria 856
228 Ga0451841_0194129 3300041498 Bacteria 5957
229 Ga0451841_1431128 3300041498 Bacteria 2696
230 Ga0451845_0835782 3300041501 Bacteria 1399
231 Ga0451855_0695010 3300041511 Bacteria 1317
232 Ga0451853_0201273 3300041512 Bacteria 4533
233 Ga0439431_0062065 3300041997 Bacteria 985
234 Ga0439449_0044246 3300042007 Bacteria 1651
235 Ga0466969_0004885 3300044656 Bacteria 7142
236 Ga0466972_0035303 3300044658 Bacteria 2447
237 Ga0466965_0024538 3300044683 Bacteria 2917
238 Ga0466966_0006267 3300044684 Bacteria 7868
239 Ga0466961_0020199 3300044693 Bacteria 4286
240 Ga0466963_0080204 3300044694 Bacteria 2209
241 Ga0466964_0002940 3300044706 Bacteria 6151
242 Ga0466971_0041909 3300044719 Bacteria 2056
243 Ga0466968_0007141 3300044735 Bacteria 4241
244 Ga0466970_0154108 3300044765 Bacteria 1269
245 Ga0466957_0002121 3300044842 Bacteria 10623
246 Ga0466957_0140921 3300044842 Bacteria 1553
247 Ga0466960_0087813 3300044901 Bacteria 1580
248 Ga0466959_0012969 3300045049 Bacteria 6034
249 Ga0466958_0029411 3300045836 Bacteria 3260
250 Ga0466967_0018645 3300045976 Bacteria 5554
251 Ga0495617_077242 3300046452 Bacteria 1092
252 Ga0495629_0592268 3300046459 Bacteria 742
253 Ga0495638_0002612 3300046460 Bacteria 14506
254 Ga0495650_0028483 3300046471 Unclassified 2563
255 Ga0495580_0096682 3300046472 Bacteria 2054
256 Ga0495605_0001565 3300046474 Bacteria 14872
257 Ga0495605_0057614 3300046474 Bacteria 1869
258 Ga0495664_0042627 3300046477 Bacteria 2688
259 Ga0495607_0000044 3300046501 Bacteria 125410
260 Ga0495607_0015234 3300046501 Bacteria 4986
261 Ga0495583_0000173 3300046506 Bacteria 109405
262 Ga0495583_0081999 3300046506 Bacteria 1400
263 Ga0495606_0000129 3300046507 Bacteria 127929
264 Ga0495606_0001243 3300046507 Bacteria 35607
265 Ga0495606_0021093 3300046507 Bacteria 4779
266 Ga0495606_0104088 3300046507 Bacteria 1723
267 Ga0495610_0126618 3300046512 Bacteria 1113
268 Ga0495631_0117928 3300046518 Bacteria 1141
269 Ga0495643_0018882 3300046522 Bacteria 3994
270 Ga0495643_0060918 3300046522 Bacteria 2002
271 Ga0495648_0019577 3300046524 Bacteria 4754
272 Ga0495609_0106492 3300046538 Bacteria 1212
273 Ga0495633_0012390 3300046558 Bacteria 4537
274 Ga0495656_0178282 3300046615 Bacteria 1043
275 Ga0495668_0039569 3300046616 Bacteria 2632
276 Ga0495668_0125480 3300046616 Bacteria 1405
277 Ga0495668_0232370 3300046616 Bacteria 1010
278 Ga0495625_0101280 3300046660 Bacteria 1978
279 Ga0495661_0005158 3300046665 Bacteria 9307
280 Ga0495661_0219701 3300046665 Bacteria 985
281 Ga0495670_0006868 3300046691 Bacteria 5600
282 Ga0495649_0001153 3300046694 Bacteria 20576
283 Ga0495589_0006876 3300046794 Bacteria 5981
284 Ga0495660_0222312 3300046810 Bacteria 889
285 Ga0495683_0088637 3300047323 Bacteria 1502
286 Ga0495679_081363 3300047446 Bacteria 919
287 Ga0495673_0000904 3300047469 Bacteria 27167
288 Ga0495681_0081969 3300047470 Bacteria 1438
289 Ga0495686_0045031 3300047472 Bacteria 2792
290 Ga0495686_0056915 3300047472 Bacteria 2441
291 Ga0495593_0061508 3300047673 Bacteria 1964
292 Ga0495615_0061768 3300048090 Bacteria 990
293 Ga0495626_0037523 3300048091 Bacteria 2302
294 Ga0496102_0412384 3300048905 Bacteria 1269
295 Ga0496104_0000291 3300048907 Bacteria 44138
296 Ga0496104_0018320 3300048907 Bacteria 6388
297 Ga0496106_0000046 3300048909 Bacteria 101516
298 Ga0496106_0003765 3300048909 Bacteria 11299
299 Ga0496116_0064870 3300048919 Bacteria 2345
300 Ga0496116_0109687 3300048919 Bacteria 1626
301 Ga0496116_0109742 3300048919 Bacteria 1625
302 Ga0496118_0082865 3300048921 Bacteria 2245
303 Ga0496120_0158774 3300048923 Bacteria 1129
304 Ga0496121_0000102 3300048924 Bacteria 195341
305 Ga0496121_0048567 3300048924 Bacteria 3609
306 Ga0496121_0097355 3300048924 Bacteria 2280
307 Ga0496121_0129475 3300048924 Bacteria 1892
308 Ga0496121_0178605 3300048924 Bacteria 1535
309 Ga0496121_0323498 3300048924 Bacteria 1037
310 Ga0496122_0058147 3300048925 Bacteria 2865
311 Ga0496122_0150691 3300048925 Bacteria 1436
312 Ga0496123_0056860 3300048926 Bacteria 2552
313 Ga0496124_0022521 3300048927 Bacteria 5772
314 Ga0496124_0028556 3300048927 Bacteria 4988
315 Ga0496124_0062304 3300048927 Bacteria 3121
316 Ga0496125_0024433 3300048928 Bacteria 5557
317 Ga0496125_0042310 3300048928 Bacteria 3882
318 Ga0496126_0000679 3300048929 Bacteria 62626
319 Ga0496126_0075724 3300048929 Bacteria 2986
320 Ga0496126_0078879 3300048929 Bacteria 2917
321 Ga0496126_0177483 3300048929 Bacteria 1811
322 Ga0501031_0195385 3300049568 Bacteria 1321
323 Ga0501032_0108557 3300049569 Bacteria 1837
324 Ga0501033_0163087 3300049570 Bacteria 1604
325 Ga0501036_0208314 3300049572 Bacteria 1643
326 Ga0501037_0125484 3300049573 Bacteria 1843
327 Ga0501043_0235261 3300049579 Bacteria 1414
328 Ga0501043_0288326 3300049579 Bacteria 1257
329 Ga0501046_0046111 3300049580 Bacteria 3461
330 Ga0501046_0433852 3300049580 Bacteria 946
331 Ga0501068_0214366 3300049584 Bacteria 1223
332 Ga0501068_0227315 3300049584 Bacteria 1186
333 Ga0501073_0192190 3300049589 Bacteria 1412
334 Ga0501083_0169923 3300049744 Bacteria 1425
335 Ga0501083_0270297 3300049744 Bacteria 1106
336 Ga0501044_0283823 3300049823 Bacteria 1588
337 nmdc:mga03683_45363_c1 3300050489 Bacteria 1819
338 nmdc:mga0yw44_19063_c1 3300050492 Bacteria 3775
339 nmdc:mga0k408_83818_c1 3300050493 Bacteria 1869
340 nmdc:mga05p37_139945_c1 3300050507 Bacteria 2966
341 nmdc:mga05p37_91640_c1 3300050507 Bacteria 3745
342 nmdc:mga09592_1232_c1 3300050508 Bacteria 20495
343 nmdc:mga09592_296169_c1 3300050508 Bacteria 1403
344 nmdc:mga0qj67_42398_c1 3300050509 Bacteria 3582
345 nmdc:mga08y16_111226_c1 3300050511 Bacteria 2852
346 nmdc:mga0n895_12421_c1 3300050512 Bacteria 7640
347 nmdc:mga0rr50_22977_c1 3300050513 Bacteria 4290
348 nmdc:mga0a205_2900_c1 3300050515 Bacteria 15175
349 Ga0500643_000256 3300053087 Bacteria 48356
350 Ga0500644_0101721 3300053088 Bacteria 1093
351 Ga0500646_0002876 3300053090 Bacteria 4414
352 Ga0500583_0038358 3300053092 Bacteria 2157
353 Ga0500651_0336478 3300053093 Bacteria 859
354 Ga0500595_058609 3300053119 Bacteria 1170
355 Ga0500618_007052 3300053125 Bacteria 3241
356 Ga0500642_0184485 3300053130 Bacteria 975
357 Ga0500658_0028157 3300053134 Bacteria 2178
358 Ga0500564_058444 3300053138 Bacteria 1753
359 Ga0500568_0000106 3300053139 Bacteria 77620
360 Ga0500568_0032685 3300053139 Bacteria 2138
361 Ga0500604_0000901 3300053151 Bacteria 8215
362 Ga0500604_0012235 3300053151 Bacteria 2315
363 Ga0500622_0001154 3300053156 Bacteria 21943
364 Ga0500622_0048121 3300053156 Bacteria 2201
365 Ga0500638_196404 3300053162 Bacteria 857
366 Ga0501084_0113202 3300054114 Bacteria 2281
367 Ga0500661_005921 3300055283 Bacteria 2280
368 Ga0501082_0229112 3300060353 Bacteria 1617
369 Ga0501082_0233660 3300060353 Bacteria 1600
370 Ga0466962_0054086 3300061719 Bacteria 1918
371 2509387348 2509276021 Bacteria 7634384
372 2509442747 2509276033 Bacteria 7180565
373 2510893983 2510461076 Bacteria 8618824
374 2510899008 2510461076 Bacteria 8618824
375 2511183508 2510917028 Bacteria 6185411
376 2511193869 2510917030 Bacteria 7460662
377 2513570209 2513237084 Bacteria 7231967
378 2513598008 2513237088 Bacteria 6927906
379 2513632831 2513237093 Bacteria 7545552
380 2513676840 2513237098 Bacteria 9902361
381 2513710441 2513237103 Bacteria 7647401
382 2513870648 2513237138 Bacteria 7368160
383 2514019683 2513237162 Bacteria 7468464
384 2515111636 2515075009 Bacteria 7288508
385 2515634876 2515154113 Bacteria 7807172
386 2515641961 2515154114 Bacteria 7848616
387 2515656028 2515154116 Bacteria 7552979
388 2517040319 2516653077 Bacteria 7555578
389 2517094399 2517093000 Bacteria 7412387
390 2530644940 2529292951 Bacteria 6916614
391 2535516016 2534681796 Bacteria 7146037
392 2585199756 2582581294 Bacteria 6626667
393 2585226069 2582581298 Bacteria 7315509
394 2585400568 2582581867 Bacteria 7184437
395 2585540173 2585427528 Bacteria 6842387
396 2585547102 2585427529 Bacteria 7395659
397 2585819869 2585427590 Bacteria 6824633
398 2585838371 2585427593 Bacteria 7141551
399 2587741620 2585428059 Bacteria 8696589
400 2616292976 2615840624 Bacteria 6557588
401 2644422092 2643221676 Bacteria 8119172
402 2719180605 2718217882 Bacteria 6556348
403 2719385207 2718217927 Bacteria 6972593
404 2719665030 2718217997 Bacteria 6740740
405 2719731354 2718218009 Bacteria 6478651
406 2720491450 2718218199 Bacteria 6740745
407 2720612745 2718218232 Bacteria 6720332
408 2720619600 2718218233 Bacteria 6662049
409 2720631038 2718218235 Bacteria 6630699
410 2720774676 2718218269 Bacteria 6906114
411 2721146699 2718218363 Bacteria 6524337
412 2721158222 2718218365 Bacteria 6274507
413 2721163578 2718218366 Bacteria 6425255
414 2721398926 2718218423 Bacteria 6438183
415 2722839748 2721755514 Bacteria 6424414
416 2723026402 2721755556 Bacteria 6745503
417 2723559945 2721755684 Bacteria 6859907
418 2723566564 2721755685 Bacteria 6704835
419 2724037739 2721755809 Bacteria 6438790
420 2724044110 2721755810 Bacteria 6479005
421 2724089283 2721755819 Bacteria 6906405
422 2724103829 2721755822 Bacteria 6726041
423 2724109667 2721755823 Bacteria 6752556
424 2725951648 2724679232 Bacteria 7646494
425 2730107338 2728369352 Bacteria 6745171
426 2730163842 2728369365 Bacteria 6555560
427 2730297854 2728369397 Bacteria 6274511
428 2739037812 2738541333 Bacteria 7106503
429 2766063626 2765235942 Bacteria 7445910
430 2792839590 2791355137 Bacteria 9654227
431 2793296981 2791355256 Bacteria 6798008
432 2793315545 2791355259 Bacteria 7254731
433 2793321414 2791355260 Bacteria 6598818
434 2793328765 2791355261 Bacteria 6661293
435 2793335176 2791355262 Bacteria 6774204
436 2793342640 2791355263 Bacteria 6872478
437 2793350148 2791355264 Bacteria 6429314
438 2793352088 2791355265 Bacteria 6539969
439 2793360559 2791355266 Bacteria 7116587
440 2793366226 2791355267 Bacteria 7222458
441 2806048541 2802429633 Bacteria 7341974
442 2806053616 2802429634 Bacteria 7083200
443 2806060816 2802429635 Bacteria 7650140
444 2806067691 2802429636 Bacteria 7597525
445 2806072957 2802429637 Bacteria 7067217
446 2819669940 2818991459 Bacteria 8736032
447 2838018531 2838016132 Bacteria 6577831
448 2838022754 2838022645 Bacteria 6494267
449 2838047746 2838042994 Bacteria 6046894
450 2838054054 2838048938 Bacteria 6044578
451 2838066558 2838061910 Bacteria 6794874
452 2838071165 2838068647 Bacteria 6208656
453 2838682829 2838680041 Bacteria 6545511
454 2838697462 2838694306 Bacteria 6853137
455 2838709360 2838707686 Bacteria 6619912
456 2841865126 2841864319 Bacteria 6742987
457 2842077471 2842077413 Bacteria 6508645
458 2842111192 2842110456 Bacteria 7656360
459 2842120020 2842118031 Bacteria 7033875
460 2842201419 2842198810 Bacteria 6608673
461 2842220386 2842217011 Bacteria 7497767
462 2842238772 2842237096 Bacteria 6620661
463 2842268652 2842264693 Bacteria 6472963
464 2842287807 2842285085 Bacteria 6011953
465 2842291133 2842291075 Bacteria 7076806
466 2842315130 2842311132 Bacteria 6616990
467 2842347120 2842341865 Bacteria 7003929
468 2842366954 2842363717 Bacteria 6844742
469 2842373458 2842370503 Bacteria 7038661
470 2842377529 2842377471 Bacteria 7140707
471 2842386531 2842384541 Bacteria 7057858
472 2842399711 2842395702 Bacteria 6780583
473 2842404665 2842402390 Bacteria 6681310
474 2842411248 2842409023 Bacteria 6687331
475 2842418303 2842415677 Bacteria 6596907
476 2842425179 2842422224 Bacteria 6239196
477 2842432785 2842428310 Bacteria 6767288
478 2842439090 2842434925 Bacteria 6502746
479 2842445719 2842441272 Bacteria 6769273
480 2842451433 2842447887 Bacteria 6754142
481 2842466929 2842462802 Bacteria 6588055
482 2842473704 2842469257 Bacteria 6752936
483 2852389440 2852387548 Bacteria 8025568
484 2857523366 2857516855 Bacteria 7787325
485 2876762089 2876761206 Bacteria 10111113
486 2903774620 2903768456 Bacteria 9749579
487 2904115600 2904113452 Bacteria 7796941
488 2908676725 2908674828 Bacteria 3382763
489 2919041558 2919039151 Bacteria 3391018
490 2919104185 2919100787 Bacteria 7710546
491 2919176028 2919171160 Bacteria 6499771
492 2923558363 2923556063 Bacteria 6793593
493 2928502796 2928500415 Bacteria 3384541
494 2933587217 2933586486 Bacteria 7667493
495 2933601964 2933599457 Bacteria 5858799
496 2935900404 2935894831 Bacteria 6620579
497 2936373396 2936367885 Bacteria 7324495
498 2936378665 2936375103 Bacteria 6652732
499 2936387714 2936381700 Bacteria 7006523
500 2971415270 2971410472 Bacteria 8311090
501 2996892228 2996887358 Bacteria 5795980
502 2996893963 2996893221 Bacteria 5823108
503 3005447042 3005445848 Bacteria 6906074
504 639647841 639633055 Bacteria 7751309
505 8005259574 8005258706 Bacteria 6184835
506 8005279983 8005275841 Bacteria 6929066
507 8005284080 8005282627 Bacteria 6675747
508 8005294581 8005289223 Bacteria 6634003
509 8005307233 8005301065 Bacteria 6614431
510 8005326755 8005321885 Bacteria 5795980
511 8005378567 8005376324 Bacteria 6590079
512 8005384810 8005382845 Bacteria 6732062
513 8005398259 8005395548 Bacteria 6806915
514 8005436315 8005430974 Bacteria 6689030
515 8005462288 8005460587 Bacteria 7157962
516 8005499696 8005497431 Bacteria 6477605
517 8005544713 8005542996 Bacteria 7077758
518 8005558343 8005556819 Bacteria 6908598
519 8005569524 8005563573 Bacteria 7153261
520 8005575198 8005570704 Bacteria 6957481
521 8005620877 8005619151 Bacteria 7030230
522 8005627378 8005626139 Bacteria 6534237
523 8005671117 8005668836 Bacteria 6953162
524 8005695143 8005688590 Bacteria 6610080
525 8005696380 8005695170 Bacteria 6912330
526 8018128335 8018127388 Bacteria 7351159
527 8018164778 8018163183 Bacteria 7277977
528 8018177769 8018176218 Bacteria 6896178
529 8024485531 8024479707 Bacteria 6954785
530 8056387759 8056382006 Bacteria 6408074
531 8056540666 8056533031 Bacteria 8964429
532 8057875723 8057874678 Bacteria 7494653
533 Ga0495650_0004119
534 JGI25158J39367_1003026
535 JGI25152J39213_1003247
536 JGI25152J39213_1005508
537 JGI25159J45721_1000289
538 JGI25159J45721_1001613
539 JGI25151J46595_10000506
540 JGI25153J46596_10005211
541 JGI25153J46596_10005668
542 rootH1_10029736
543 rootH1_10068274
544 rootH2_10042848
545 rootH2_10059413
546 rootH1_10031533
547 rootH1_10125278
548 rootH1_10149944
549 rootH1_10157081
550 JGI25160J50197_1000004
551 JGI25160J50197_1002391
552 JGI25160J50197_1004081
553 JGI25160J50197_1011479
554 JGI25161J50226_1000003
555 JGI25161J50226_1000126
556 JGI25161J50226_1000372
557 JGI25161J50226_1005931
558 Ga0055539_1000280
559 Ga0055533_1000043
560 Ga0055525_1000981
561 Ga0055526_1000377
562 Ga0055526_1001577
563 Ga0055526_1004949
564 Ga0055526_1009362
565 Ga0055526_1014689
566 Ga0055524_1003719
567 Ga0055524_1004405
568 Ga0055524_1004442
569 Ga0055524_1009384
570 Ga0055536_1006211
571 Ga0055528_1000067
572 Ga0055528_1000890
573 Ga0055528_1001085
574 Ga0055528_1011409
575 Ga0055528_1014375
576 Ga0055530_10030293
577 Ga0055540_1000613
578 Ga0055540_1001575
579 Ga0055540_1004063
580 Ga0055540_1007015
581 Ga0055540_1015524
582 Ga0055531_10004951
583 Ga0055541_1006854
584 Ga0055543_1000001
585 Ga0055543_1000156
586 Ga0055543_1000622
587 Ga0055543_1007345
588 Ga0065165_1000675
589 Ga0065165_1000736
590 Ga0065165_1032052
591 Ga0065714_10066554
592 Ga0065707_10082114
593 Ga0070658_10016510
594 Ga0070658_10065242
595 Ga0070658_10529010
596 Ga0070690_100008323
597 Ga0068869_100086100
598 Ga0070682_100302494
599 Ga0070671_100024430
600 Ga0070659_100034270
601 Ga0070714_100010304
602 Ga0070713_100174867
603 Ga0070663_100217892
604 Ga0070663_100228413
605 Ga0070681_10141978
606 Ga0070679_100025377
607 Ga0070679_100437166
608 Ga0070672_100264865
609 Ga0070665_100400681
610 Ga0068855_100031798
611 Ga0068855_100065397
612 Ga0068856_100167113
613 Ga0068861_100004819
614 Ga0081540_1052772
615 Ga0081540_1090622
616 Ga0070717_10213264
617 Ga0075365_10003061
618 Ga0075365_10027593
619 Ga0075365_10295039
620 Ga0075363_100151443
621 Ga0075362_10074826
622 Ga0075367_10001548
623 Ga0075369_10028673
624 Ga0075370_10381938
625 Ga0075428_100106598
626 Ga0075430_100037838
627 Ga0075431_100080500
628 Ga0075433_10008069
629 Ga0075434_100002979
630 Ga0068865_100498240
631 Ga0075435_100001787
632 Ga0099794_10010276
633 Ga0105250_10006700
634 Ga0105240_10024884
635 Ga0105240_10066371
636 Ga0111539_10035256
637 Ga0105247_10081457
638 Ga0114129_10007097
639 Ga0114129_10042922
640 Ga0114129_10130812
641 Ga0105243_10279568
642 Ga0105242_10205025
643 Ga0105248_10019813
644 Ga0105237_10346183
645 Ga0105237_10611459
646 Ga0105249_10201227
647 Ga0123341_1000001
648 Ga0123342_1014705
649 Ga0099796_10022005
650 Ga0099796_10038215
651 Ga0105239_10226497
652 Ga0157370_10019096
653 Ga0157374_10194314
654 Ga0157380_10000342
655 Ga0182008_10052298
656 Ga0157376_10192925
657 Ga0213872_10011509
658 Ga0209436_100361
659 Ga0209674_100067
660 Ga0209563_100068
661 Ga0207425_1008731
662 Ga0207425_1009115
663 Ga0207425_1013189
664 Ga0209677_100049
665 Ga0209677_101808
666 Ga0209148_1009593
667 Ga0209759_1000978
668 Ga0209129_1001535
669 Ga0209129_1002325
670 Ga0209129_1003783
671 Ga0209129_1012809
672 Ga0209233_1013804
673 Ga0209455_1003249
674 Ga0209673_1000068
675 Ga0209673_1000310
676 Ga0209673_1000348
677 Ga0209673_1002113
678 Ga0209673_1006019
679 Ga0209673_1008798
680 Ga0209130_1000006
681 Ga0209130_1000012
682 Ga0209676_1011024
683 Ga0209025_1000097
684 Ga0209025_1004704
685 Ga0209025_1008093
686 Ga0209025_1023600
687 Ga0209564_1000137
688 Ga0209564_1000739
689 Ga0209564_1000966
690 Ga0209564_1004497
691 Ga0209564_1009101
692 Ga0209758_1000714
693 Ga0209758_1001743
694 Ga0209758_1002296
695 Ga0209758_1008924
696 Ga0209758_1008929
697 Ga0209050_1001715
698 Ga0209256_1000397
699 Ga0209256_1001022
700 Ga0209256_1005212
701 Ga0209256_1006066
702 Ga0207426_1000003
703 Ga0207426_1000010
704 Ga0207426_1000094
705 Ga0207426_1003738
706 Ga0209051_1000201
707 Ga0209051_1001312
708 Ga0209051_1019336
709 Ga0209051_1030961
710 Ga0209257_1001768
711 Ga0209257_1002387
712 Ga0209257_1014345
713 Ga0207710_10018041
714 Ga0207705_10017565
715 Ga0207705_10108138
716 Ga0207707_10015378
717 Ga0207707_10361657
718 Ga0207695_10007496
719 Ga0207695_10063748
720 Ga0207671_10136072
721 Ga0207660_10072909
722 Ga0207652_10511802
723 Ga0207700_10126716
724 Ga0207644_10088264
725 Ga0207690_10039999
726 Ga0207709_10013955
727 Ga0207691_10475069
728 Ga0207711_10372648
729 Ga0207667_10013254
730 Ga0207667_10124317
731 Ga0207712_10237192
732 Ga0207702_10239045
733 Ga0207676_10399010
734 Ga0207675_100057149
735 Ga0207675_100140082
736 Ga0207683_10377205
737 Ga0209588_1012102
738 Ga0307515_10056344
739 Ga0307511_10000036
740 Ga0307513_10047444
741 Ga0307509_10511758
742 Ga0307408_100041831
743 Ga0307410_10043234
744 Ga0307407_10046698
745 Ga0307416_100425356
746 Ga0436361_0151558
747 Ga0436361_0191516
748 Ga0439436_0027971
749 Ga0439465_0009331
750 Ga0439465_0010918
751 Ga0451787_130413
752 Ga0451791_0487884
753 Ga0451791_0954775
754 Ga0451793_1076619
755 Ga0451833_0887560
756 Ga0451837_0082266
757 Ga0451839_0865257
758 Ga0451841_0194129
759 Ga0451841_1431128
760 Ga0451845_0835782
761 Ga0451855_0695010
762 Ga0451853_0201273
763 Ga0439431_0062065
764 Ga0439449_0044246
765 Ga0466969_0004885
766 Ga0466972_0035303
767 Ga0466965_0024538
768 Ga0466966_0006267
769 Ga0466961_0020199
770 Ga0466963_0080204
771 Ga0466964_0002940
772 Ga0466971_0041909
773 Ga0466968_0007141
774 Ga0466970_0154108
775 Ga0466957_0002121
776 Ga0466957_0140921
777 Ga0466960_0087813
778 Ga0466959_0012969
779 Ga0466958_0029411
780 Ga0466967_0018645
781 Ga0495617_077242
782 Ga0495629_0592268
783 Ga0495638_0002612
784 Ga0495650_0028483
785 Ga0495580_0096682
786 Ga0495605_0001565
787 Ga0495605_0057614
788 Ga0495664_0042627
789 Ga0495607_0000044
790 Ga0495607_0015234
791 Ga0495583_0000173
792 Ga0495583_0081999
793 Ga0495606_0000129
794 Ga0495606_0001243
795 Ga0495606_0021093
796 Ga0495606_0104088
797 Ga0495610_0126618
798 Ga0495631_0117928
799 Ga0495643_0018882
800 Ga0495643_0060918
801 Ga0495648_0019577
802 Ga0495609_0106492
803 Ga0495633_0012390
804 Ga0495656_0178282
805 Ga0495668_0039569
806 Ga0495668_0125480
807 Ga0495668_0232370
808 Ga0495625_0101280
809 Ga0495661_0005158
810 Ga0495661_0219701
811 Ga0495670_0006868
812 Ga0495649_0001153
813 Ga0495589_0006876
814 Ga0495660_0222312
815 Ga0495683_0088637
816 Ga0495679_081363
817 Ga0495673_0000904
818 Ga0495681_0081969
819 Ga0495686_0045031
820 Ga0495686_0056915
821 Ga0495593_0061508
822 Ga0495615_0061768
823 Ga0495626_0037523
824 Ga0496102_0412384
825 Ga0496104_0000291
826 Ga0496104_0018320
827 Ga0496106_0000046
828 Ga0496106_0003765
829 Ga0496116_0064870
830 Ga0496116_0109687
831 Ga0496116_0109742
832 Ga0496118_0082865
833 Ga0496120_0158774
834 Ga0496121_0000102
835 Ga0496121_0048567
836 Ga0496121_0097355
837 Ga0496121_0129475
838 Ga0496121_0178605
839 Ga0496121_0323498
840 Ga0496122_0058147
841 Ga0496122_0150691
842 Ga0496123_0056860
843 Ga0496124_0022521
844 Ga0496124_0028556
845 Ga0496124_0062304
846 Ga0496125_0024433
847 Ga0496125_0042310
848 Ga0496126_0000679
849 Ga0496126_0075724
850 Ga0496126_0078879
851 Ga0496126_0177483
852 Ga0501031_0195385
853 Ga0501032_0108557
854 Ga0501033_0163087
855 Ga0501036_0208314
856 Ga0501037_0125484
857 Ga0501043_0235261
858 Ga0501043_0288326
859 Ga0501046_0046111
860 Ga0501046_0433852
861 Ga0501068_0214366
862 Ga0501068_0227315
863 Ga0501073_0192190
864 Ga0501083_0169923
865 Ga0501083_0270297
866 Ga0501044_0283823
867 nmdc:mga03683_45363_c1
868 nmdc:mga0yw44_19063_c1
869 nmdc:mga0k408_83818_c1
870 nmdc:mga05p37_139945_c1
871 nmdc:mga05p37_91640_c1
872 nmdc:mga09592_1232_c1
873 nmdc:mga09592_296169_c1
874 nmdc:mga0qj67_42398_c1
875 nmdc:mga08y16_111226_c1
876 nmdc:mga0n895_12421_c1
877 nmdc:mga0rr50_22977_c1
878 nmdc:mga0a205_2900_c1
879 Ga0500643_000256
880 Ga0500644_0101721
881 Ga0500646_0002876
882 Ga0500583_0038358
883 Ga0500651_0336478
884 Ga0500595_058609
885 Ga0500618_007052
886 Ga0500642_0184485
887 Ga0500658_0028157
888 Ga0500564_058444
889 Ga0500568_0000106
890 Ga0500568_0032685
891 Ga0500604_0000901
892 Ga0500604_0012235
893 Ga0500622_0001154
894 Ga0500622_0048121
895 Ga0500638_196404
896 Ga0501084_0113202
897 Ga0500661_005921
898 Ga0501082_0229112
899 Ga0501082_0233660
900 Ga0466962_0054086
901 2509387348
902 2509442747
903 2510893983
904 2510899008
905 2511183508
906 2511193869
907 2513570209
908 2513598008
909 2513632831
910 2513676840
911 2513710441
912 2513870648
913 2514019683
914 2515111636
915 2515634876
916 2515641961
917 2515656028
918 2517040319
919 2517094399
920 2530644940
921 2535516016
922 2585199756
923 2585226069
924 2585400568
925 2585540173
926 2585547102
927 2585819869
928 2585838371
929 2587741620
930 2616292976
931 2644422092
932 2719180605
933 2719385207
934 2719665030
935 2719731354
936 2720491450
937 2720612745
938 2720619600
939 2720631038
940 2720774676
941 2721146699
942 2721158222
943 2721163578
944 2721398926
945 2722839748
946 2723026402
947 2723559945
948 2723566564
949 2724037739
950 2724044110
951 2724089283
952 2724103829
953 2724109667
954 2725951648
955 2730107338
956 2730163842
957 2730297854
958 2739037812
959 2766063626
960 2792839590
961 2793296981
962 2793315545
963 2793321414
964 2793328765
965 2793335176
966 2793342640
967 2793350148
968 2793352088
969 2793360559
970 2793366226
971 2806048541
972 2806053616
973 2806060816
974 2806067691
975 2806072957
976 2819669940
977 2838018531
978 2838022754
979 2838047746
980 2838054054
981 2838066558
982 2838071165
983 2838682829
984 2838697462
985 2838709360
986 2841865126
987 2842077471
988 2842111192
989 2842120020
990 2842201419
991 2842220386
992 2842238772
993 2842268652
994 2842287807
995 2842291133
996 2842315130
997 2842347120
998 2842366954
999 2842373458
1000 2842377529
1001 2842386531
1002 2842399711
1003 2842404665
1004 2842411248
1005 2842418303
1006 2842425179
1007 2842432785
1008 2842439090
1009 2842445719
1010 2842451433
1011 2842466929
1012 2842473704
1013 2852389440
1014 2857523366
1015 2876762089
1016 2903774620
1017 2904115600
1018 2908676725
1019 2919041558
1020 2919104185
1021 2919176028
1022 2923558363
1023 2928502796
1024 2933587217
1025 2933601964
1026 2935900404
1027 2936373396
1028 2936378665
1029 2936387714
1030 2971415270
1031 2996892228
1032 2996893963
1033 3005447042
1034 639647841
1035 8005259574
1036 8005279983
1037 8005284080
1038 8005294581
1039 8005307233
1040 8005326755
1041 8005378567
1042 8005384810
1043 8005398259
1044 8005436315
1045 8005462288
1046 8005499696
1047 8005544713
1048 8005558343
1049 8005569524
1050 8005575198
1051 8005620877
1052 8005627378
1053 8005671117
1054 8005695143
1055 8005696380
1056 8018128335
1057 8018164778
1058 8018177769
1059 8024485531
1060 8056387759
1061 8056540666
1062 8057875723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

44

231

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

50

283

0.94

PF08659

KR

KR domain

44

215

0.89

PF23441

38

285

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9853 2 224
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9852 2 224
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9844 2 224
6ihh-assembly1.cif.gz_A crystal structure of rasadh f12 from ralstonia.sp in complex with nadph and a6o 0.9831 2 224
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9824 2 224
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.981 2 224 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9652 3 223 3.40.50.720
af_Q54PL1_17_278_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9636 2 223 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9629 3 223 3.40.50.720
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 3 224 3.40.50.720
ID Description Score Start End GO Terms
AF-K0VUL8-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9888 1 183 GO:0016491
AF-A0A7Y6JY91-F1-model_v4 SDR family oxidoreductase 0.9875 1 233 GO:0016491
AF-A0A239IFX9-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9862 1 233 GO:0016491
AF-A0A5R9A4V7-F1-model_v4 SDR family oxidoreductase 0.9852 3 224 GO:0016491
AF-A0A537JGP5-F1-model_v4 SDR family oxidoreductase 0.9847 2 224 GO:0016491

Map