F460002

General Info

Members Datasets Scaffolds Average Seq Length
530 320 1060 435

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0045733|Ga0495606_0045733_1018_2577
Length 508
Sequence MALRHFGAAAAVAIAVGMTASPALATTEIQWWHAMTGANNDVIVKLANDFNASQSDYKVIPTYKGSYPDTMNAGIAAFRAGNAPHIMQVFEVGTATMMAATGAVKPVYKLMADAGEKFDPKNYLSAITGYYSTSKGEMLSFPFNSSSTVMWVNLDELKKVNAEIPKTWPEVFEVAKKLHDNGHPTCGFSNSAWHNVPLASKANGLDGFDTKLEFNAPLQEKHLEKLVELQKDKTYDYAGRTNQGEGRFTSGECAIYLTSSAFFGNVKAQAKFNFTAVPMPYYPDVKGAPQNSIIGGASLWVMGGKSADEYKGVAKFLTFLSDTDRQVYIHKASGYLPITKAAYEKAKAEGFYKDQPYLETPLIELTNKEPTDNSRGLRLGNMVQLRDVWAEEIEQALAGKKTAKQALEASVERGNTMLRQFEKTAVKYGEGAGGRTISGPPAPPHHAKASDFPIKAAAVRAGCAATRDCSDFLLLAGRAGRHPVLPAAGRFRPLDELRLVRELRRAVQ

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
68 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
272 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
280 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
281 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
282 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
283 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
284 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
285 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
286 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
287 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
288 2643221651 Afipia sp. Root123D2 Isolate Unclassified
289 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
290 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
291 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
292 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
293 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
294 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
295 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
296 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
297 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
298 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
299 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
300 2904699407
301 2906610324
302 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
303 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
304 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
305 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
306 2922425934
307 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
308 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
309 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
310 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
311 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
312 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
313 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
314 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
315 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
316 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
317 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
318 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
319 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
320 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.6
Metatranscriptomes 0
Isolates 7.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 7.36
Rhizoplane 3.96
Rhizosphere 78.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0045733 3300046507 Bacteria 2898
2 JGI24739J22299_10039738 3300001989 Bacteria 1574
3 JGI24735J21928_10013429 3300002067 Bacteria 2575
4 JGI25153J46596_10007816 3300003215 Bacteria 5195
5 JGI25153J46596_10007902 3300003215 Bacteria 5161
6 JGI25153J46596_10010396 3300003215 Bacteria 4212
7 JGI25153J46596_10017295 3300003215 Bacteria 2845
8 JGI25160J50197_1010795 3300003354 Bacteria 3281
9 Ga0055542_1006636 3300003762 Bacteria 2450
10 Ga0055536_1006610 3300003781 Bacteria 5353
11 Ga0055536_1006721 3300003781 Bacteria 5283
12 Ga0055531_10004770 3300003794 Bacteria 8103
13 Ga0065712_10015671 3300005290 Bacteria 2077
14 Ga0065715_10133360 3300005293 Bacteria 1974
15 Ga0070658_10035380 3300005327 Bacteria 4022
16 Ga0070658_10064977 3300005327 Bacteria 2977
17 Ga0070683_100008196 3300005329 Bacteria 8875
18 Ga0070683_100058369 3300005329 Bacteria 3585
19 Ga0070683_100066845 3300005329 Bacteria 3348
20 Ga0070670_100003522 3300005331 Bacteria 13011
21 Ga0070670_100009835 3300005331 Bacteria 8170
22 Ga0070670_100081131 3300005331 Bacteria 2787
23 Ga0068869_100001725 3300005334 Bacteria 13059
24 Ga0070666_10040404 3300005335 Bacteria 3113
25 Ga0070660_100002704 3300005339 Bacteria 12173
26 Ga0070660_100100462 3300005339 Bacteria 2291
27 Ga0070661_100001413 3300005344 Bacteria 16755
28 Ga0070661_100017823 3300005344 Bacteria 5040
29 Ga0070668_100013749 3300005347 Bacteria 6045
30 Ga0070668_100132856 3300005347 Bacteria 1999
31 Ga0070668_100133201 3300005347 Bacteria 1996
32 Ga0070669_100029674 3300005353 Bacteria 3944
33 Ga0070669_100176757 3300005353 Bacteria 1668
34 Ga0070675_100022720 3300005354 Bacteria 5011
35 Ga0070675_100060283 3300005354 Bacteria 3133
36 Ga0070671_100007541 3300005355 Bacteria 8699
37 Ga0070673_100021366 3300005364 Bacteria 4691
38 Ga0070688_100064519 3300005365 Bacteria 2324
39 Ga0070659_100018465 3300005366 Bacteria 5263
40 Ga0070709_10002152 3300005434 Bacteria 10666
41 Ga0070709_10004534 3300005434 Bacteria 7496
42 Ga0070714_100013143 3300005435 Bacteria 6629
43 Ga0070713_100000045 3300005436 Bacteria 77398
44 Ga0070713_100021807 3300005436 Bacteria 4937
45 Ga0070710_10051082 3300005437 Bacteria 2320
46 Ga0070711_100016348 3300005439 Bacteria 4711
47 Ga0070711_100030366 3300005439 Bacteria 3576
48 Ga0070663_100091220 3300005455 Bacteria 2257
49 Ga0070663_100131112 3300005455 Bacteria 1903
50 Ga0070678_100023376 3300005456 Bacteria 4118
51 Ga0070662_100070087 3300005457 Bacteria 2582
52 Ga0070662_100084286 3300005457 Bacteria 2374
53 Ga0070681_10041429 3300005458 Bacteria 4615
54 Ga0070681_10047103 3300005458 Bacteria 4309
55 Ga0068867_100027466 3300005459 Bacteria 4091
56 Ga0070706_100025322 3300005467 Bacteria 5460
57 Ga0070706_100065313 3300005467 Bacteria 3365
58 Ga0070706_100129477 3300005467 Bacteria 2355
59 Ga0070707_100072841 3300005468 Bacteria 3312
60 Ga0070698_100075213 3300005471 Bacteria 3382
61 Ga0070679_100030656 3300005530 Bacteria 5311
62 Ga0070679_100034699 3300005530 Bacteria 5001
63 Ga0068853_100103852 3300005539 Bacteria 2516
64 Ga0070672_100052703 3300005543 Bacteria 3177
65 Ga0070672_100054150 3300005543 Bacteria 3140
66 Ga0070665_100150070 3300005548 Bacteria 2333
67 Ga0068855_100051723 3300005563 Bacteria 4839
68 Ga0068855_100072739 3300005563 Bacteria 3995
69 Ga0068855_100110816 3300005563 Bacteria 3150
70 Ga0068855_100168338 3300005563 Bacteria 2482
71 Ga0070664_100003038 3300005564 Bacteria 13572
72 Ga0070664_100102378 3300005564 Bacteria 2492
73 Ga0068857_100000810 3300005577 Bacteria 23378
74 Ga0068857_100002261 3300005577 Bacteria 15660
75 Ga0068854_100069318 3300005578 Bacteria 2574
76 Ga0068856_100014288 3300005614 Bacteria 7678
77 Ga0068856_100075629 3300005614 Bacteria 3336
78 Ga0068852_100001129 3300005616 Bacteria 17663
79 Ga0068859_100000466 3300005617 Bacteria 40002
80 Ga0068859_100225633 3300005617 Bacteria 1961
81 Ga0068864_100001455 3300005618 Bacteria 19514
82 Ga0068864_100023418 3300005618 Bacteria 5185
83 Ga0068864_100042872 3300005618 Bacteria 3873
84 Ga0068864_100170161 3300005618 Bacteria 1986
85 Ga0068861_100011143 3300005719 Bacteria 6242
86 Ga0068861_100031998 3300005719 Bacteria 3869
87 Ga0068861_100045614 3300005719 Bacteria 3302
88 Ga0068851_10002809 3300005834 Bacteria 7676
89 Ga0068851_10039586 3300005834 Bacteria 2367
90 Ga0068863_100000829 3300005841 Bacteria 31008
91 Ga0068863_100028656 3300005841 Bacteria 5316
92 Ga0068858_100000624 3300005842 Bacteria 36860
93 Ga0068858_100025937 3300005842 Bacteria 5450
94 Ga0068860_100000782 3300005843 Bacteria 35765
95 Ga0068862_100007370 3300005844 Bacteria 9127
96 Ga0068862_100046933 3300005844 Bacteria 3685
97 Ga0081455_10050878 3300005937 Bacteria 3558
98 Ga0081540_1004334 3300005983 Bacteria 10871
99 Ga0081540_1018763 3300005983 Bacteria 4229
100 Ga0081540_1024850 3300005983 Bacteria 3465
101 Ga0081539_10012946 3300005985 Bacteria 6345
102 Ga0081539_10073239 3300005985 Bacteria 1828
103 Ga0070717_10190093 3300006028 Bacteria 1794
104 Ga0070716_100129097 3300006173 Bacteria 1595
105 Ga0070712_100152497 3300006175 Bacteria 1776
106 Ga0097621_100047547 3300006237 Bacteria 3478
107 Ga0097621_100104056 3300006237 Bacteria 2392
108 Ga0075370_10021464 3300006353 Bacteria 3537
109 Ga0075434_100073727 3300006871 Bacteria 3406
110 Ga0068865_100138541 3300006881 Bacteria 1832
111 Ga0097620_100000466 3300006931 Bacteria 40002
112 Ga0097620_100225639 3300006931 Bacteria 1961
113 Ga0099822_1004364 3300006943 Bacteria 18407
114 Ga0099823_1009115 3300006944 Bacteria 10076
115 Ga0105240_10001807 3300009093 Bacteria 36004
116 Ga0105240_10013166 3300009093 Bacteria 11377
117 Ga0105240_10056620 3300009093 Bacteria 4905
118 Ga0111539_10104860 3300009094 Bacteria 3317
119 Ga0105245_10122043 3300009098 Bacteria 2435
120 Ga0105245_10157120 3300009098 Bacteria 2155
121 Ga0105247_10094955 3300009101 Bacteria 1898
122 Ga0105243_10090220 3300009148 Bacteria 2522
123 Ga0105242_10040904 3300009176 Bacteria 3736
124 Ga0105242_10128297 3300009176 Bacteria 2186
125 Ga0105248_10000736 3300009177 Bacteria 36816
126 Ga0105248_10019836 3300009177 Bacteria 7446
127 Ga0105237_10030893 3300009545 Bacteria 5435
128 Ga0105237_10047164 3300009545 Bacteria 4332
129 Ga0105237_10192243 3300009545 Bacteria 2040
130 Ga0105238_10001317 3300009551 Bacteria 24891
131 Ga0105239_10218890 3300010375 Bacteria 2135
132 Ga0157371_10030019 3300013102 Bacteria 3924
133 Ga0157371_10060192 3300013102 Bacteria 2693
134 Ga0157370_10025696 3300013104 Bacteria 5827
135 Ga0157370_10079448 3300013104 Bacteria 3089
136 Ga0157369_10026262 3300013105 Bacteria 6462
137 Ga0157369_10028351 3300013105 Bacteria 6197
138 Ga0157369_10075412 3300013105 Bacteria 3617
139 Ga0157374_10059243 3300013296 Bacteria 3579
140 Ga0157378_10028724 3300013297 Bacteria 4910
141 Ga0157378_10234577 3300013297 Bacteria 1750
142 Ga0163162_10107477 3300013306 Bacteria 2886
143 Ga0163162_10114095 3300013306 Bacteria 2801
144 Ga0163162_10176752 3300013306 Bacteria 2260
145 Ga0157372_10062406 3300013307 Bacteria 4175
146 Ga0157372_10101310 3300013307 Bacteria 3287
147 Ga0157375_10004326 3300013308 Bacteria 12329
148 Ga0157375_10041140 3300013308 Bacteria 4460
149 Ga0157375_10135677 3300013308 Bacteria 2584
150 Ga0163163_10129302 3300014325 Bacteria 2565
151 Ga0163163_10171872 3300014325 Bacteria 2214
152 Ga0163163_10210410 3300014325 Bacteria 1994
153 Ga0157380_10030766 3300014326 Bacteria 4114
154 Ga0157380_10227029 3300014326 Bacteria 1674
155 Ga0157379_10000233 3300014968 Bacteria 43500
156 Ga0157379_10069172 3300014968 Bacteria 3157
157 Ga0157379_10180524 3300014968 Bacteria 1907
158 Ga0157376_10162542 3300014969 Bacteria 2026
159 Ga0163161_10070747 3300017792 Bacteria 2551
160 Ga0209677_104912 3300025253 Bacteria 3658
161 Ga0209148_1000308 3300025254 Bacteria 70131
162 Ga0209676_1000097 3300025292 Bacteria 237203
163 Ga0209564_1007252 3300025295 Bacteria 5764
164 Ga0209564_1009228 3300025295 Bacteria 4728
165 Ga0209758_1000443 3300025297 Bacteria 69228
166 Ga0209758_1000546 3300025297 Bacteria 59757
167 Ga0209758_1004610 3300025297 Bacteria 11323
168 Ga0209758_1008688 3300025297 Bacteria 6503
169 Ga0209758_1013471 3300025297 Bacteria 4453
170 Ga0209256_1002930 3300025299 Bacteria 12820
171 Ga0207426_1007996 3300025302 Bacteria 4344
172 Ga0209257_1001004 3300025304 Bacteria 38186
173 Ga0209257_1015484 3300025304 Bacteria 3170
174 Ga0207697_10000068 3300025315 Bacteria 44303
175 Ga0207656_10008744 3300025321 Bacteria 3741
176 Ga0207656_10042997 3300025321 Bacteria 1925
177 Ga0207682_10000097 3300025893 Bacteria 39655
178 Ga0207682_10000266 3300025893 Bacteria 23550
179 Ga0207642_10031724 3300025899 Bacteria 2217
180 Ga0207642_10088050 3300025899 Bacteria 1526
181 Ga0207710_10020950 3300025900 Bacteria 2799
182 Ga0207688_10105033 3300025901 Bacteria 1635
183 Ga0207680_10042685 3300025903 Bacteria 2655
184 Ga0207647_10023452 3300025904 Bacteria 4080
185 Ga0207699_10001846 3300025906 Bacteria 9967
186 Ga0207699_10091799 3300025906 Bacteria 1907
187 Ga0207645_10004546 3300025907 Bacteria 10248
188 Ga0207645_10022990 3300025907 Bacteria 4051
189 Ga0207645_10023460 3300025907 Bacteria 4010
190 Ga0207643_10010998 3300025908 Bacteria 4884
191 Ga0207643_10015498 3300025908 Bacteria 4149
192 Ga0207705_10060071 3300025909 Bacteria 2745
193 Ga0207684_10009875 3300025910 Bacteria 8418
194 Ga0207684_10060801 3300025910 Bacteria 3209
195 Ga0207684_10117214 3300025910 Bacteria 2282
196 Ga0207654_10023650 3300025911 Bacteria 3294
197 Ga0207707_10015977 3300025912 Bacteria 6546
198 Ga0207695_10000107 3300025913 Bacteria 252606
199 Ga0207695_10054785 3300025913 Bacteria 4161
200 Ga0207695_10187513 3300025913 Bacteria 1987
201 Ga0207695_10338442 3300025913 Bacteria 1393
202 Ga0207671_10006765 3300025914 Bacteria 10136
203 Ga0207671_10167552 3300025914 Bacteria 1704
204 Ga0207693_10019351 3300025915 Bacteria 5417
205 Ga0207693_10067049 3300025915 Bacteria 2810
206 Ga0207693_10236362 3300025915 Bacteria 1435
207 Ga0207663_10007451 3300025916 Bacteria 5675
208 Ga0207657_10021865 3300025919 Bacteria 6007
209 Ga0207657_10094822 3300025919 Bacteria 2484
210 Ga0207657_10104246 3300025919 Bacteria 2350
211 Ga0207652_10212846 3300025921 Bacteria 1741
212 Ga0207646_10018727 3300025922 Bacteria 6453
213 Ga0207681_10095540 3300025923 Bacteria 2132
214 Ga0207694_10003964 3300025924 Bacteria 11677
215 Ga0207694_10074789 3300025924 Bacteria 2651
216 Ga0207694_10108133 3300025924 Bacteria 2209
217 Ga0207650_10008850 3300025925 Bacteria 6879
218 Ga0207650_10026884 3300025925 Bacteria 4111
219 Ga0207650_10034291 3300025925 Bacteria 3680
220 Ga0207650_10046657 3300025925 Bacteria 3191
221 Ga0207659_10037471 3300025926 Bacteria 3367
222 Ga0207659_10043335 3300025926 Bacteria 3160
223 Ga0207659_10103169 3300025926 Bacteria 2154
224 Ga0207687_10072474 3300025927 Bacteria 2464
225 Ga0207687_10145749 3300025927 Bacteria 1801
226 Ga0207700_10000051 3300025928 Bacteria 77057
227 Ga0207700_10013199 3300025928 Bacteria 5365
228 Ga0207700_10017262 3300025928 Bacteria 4817
229 Ga0207664_10033510 3300025929 Bacteria 3947
230 Ga0207690_10026056 3300025932 Bacteria 3680
231 Ga0207706_10033238 3300025933 Bacteria 4591
232 Ga0207706_10070833 3300025933 Bacteria 3067
233 Ga0207706_10076316 3300025933 Bacteria 2947
234 Ga0207706_10118076 3300025933 Bacteria 2333
235 Ga0207706_10236260 3300025933 Bacteria 1598
236 Ga0207686_10123188 3300025934 Bacteria 1767
237 Ga0207670_10057680 3300025936 Bacteria 2634
238 Ga0207669_10018077 3300025937 Bacteria 3633
239 Ga0207704_10030438 3300025938 Bacteria 3026
240 Ga0207704_10132220 3300025938 Bacteria 1730
241 Ga0207704_10142158 3300025938 Bacteria 1680
242 Ga0207665_10080351 3300025939 Bacteria 2243
243 Ga0207665_10150052 3300025939 Bacteria 1669
244 Ga0207665_10187602 3300025939 Bacteria 1501
245 Ga0207691_10000331 3300025940 Bacteria 47246
246 Ga0207691_10002783 3300025940 Bacteria 17058
247 Ga0207691_10025670 3300025940 Bacteria 5529
248 Ga0207711_10010140 3300025941 Bacteria 7824
249 Ga0207711_10016463 3300025941 Bacteria 6143
250 Ga0207689_10000310 3300025942 Bacteria 44928
251 Ga0207689_10028706 3300025942 Bacteria 4653
252 Ga0207689_10176957 3300025942 Bacteria 1759
253 Ga0207661_10005122 3300025944 Bacteria 9203
254 Ga0207661_10008755 3300025944 Bacteria 7239
255 Ga0207661_10173181 3300025944 Bacteria 1880
256 Ga0207679_10013209 3300025945 Bacteria 5410
257 Ga0207679_10071933 3300025945 Bacteria 2610
258 Ga0207679_10093421 3300025945 Bacteria 2333
259 Ga0207667_10010866 3300025949 Bacteria 10616
260 Ga0207667_10033168 3300025949 Bacteria 5555
261 Ga0207667_10157991 3300025949 Bacteria 2333
262 Ga0207667_10159374 3300025949 Bacteria 2321
263 Ga0207667_10283852 3300025949 Bacteria 1692
264 Ga0207651_10033592 3300025960 Bacteria 3310
265 Ga0207651_10064308 3300025960 Bacteria 2567
266 Ga0207668_10004867 3300025972 Bacteria 7905
267 Ga0207640_10052873 3300025981 Bacteria 2648
268 Ga0207640_10078096 3300025981 Bacteria 2252
269 Ga0207658_10000650 3300025986 Bacteria 30420
270 Ga0207658_10095301 3300025986 Bacteria 2318
271 Ga0207703_10000443 3300026035 Bacteria 43710
272 Ga0207703_10064385 3300026035 Bacteria 3009
273 Ga0207703_10086720 3300026035 Bacteria 2623
274 Ga0207703_10103230 3300026035 Bacteria 2420
275 Ga0207639_10176445 3300026041 Bacteria 1814
276 Ga0207678_10002621 3300026067 Bacteria 16388
277 Ga0207678_10050007 3300026067 Bacteria 3612
278 Ga0207708_10006748 3300026075 Bacteria 8492
279 Ga0207702_10003982 3300026078 Bacteria 13259
280 Ga0207702_10018926 3300026078 Bacteria 5697
281 Ga0207702_10186150 3300026078 Bacteria 1915
282 Ga0207641_10001097 3300026088 Bacteria 27224
283 Ga0207641_10004409 3300026088 Bacteria 12196
284 Ga0207648_10003029 3300026089 Bacteria 17753
285 Ga0207648_10003723 3300026089 Bacteria 15960
286 Ga0207648_10061587 3300026089 Bacteria 3272
287 Ga0207648_10193386 3300026089 Bacteria 1804
288 Ga0207676_10000995 3300026095 Bacteria 21861
289 Ga0207674_10000418 3300026116 Bacteria 55342
290 Ga0207674_10071635 3300026116 Bacteria 3482
291 Ga0207675_100000726 3300026118 Bacteria 32704
292 Ga0207675_100001605 3300026118 Bacteria 22659
293 Ga0207675_100022891 3300026118 Bacteria 5812
294 Ga0207675_100025019 3300026118 Bacteria 5556
295 Ga0207675_100221489 3300026118 Bacteria 1823
296 Ga0207683_10000276 3300026121 Bacteria 45906
297 Ga0207683_10058191 3300026121 Bacteria 3393
298 Ga0207698_10020906 3300026142 Bacteria 4516
299 Ga0207698_10052986 3300026142 Bacteria 3111
300 Ga0209389_1000153 3300027296 Bacteria 58606
301 Ga0209389_1000344 3300027296 Bacteria 28211
302 Ga0209589_1000032 3300027357 Bacteria 141881
303 Ga0209589_1000046 3300027357 Bacteria 118780
304 Ga0209489_100106 3300027361 Bacteria 118780
305 Ga0209489_100936 3300027361 Bacteria 58586
306 Ga0209489_102825 3300027361 Bacteria 34712
307 Ga0209700_100011 3300027363 Bacteria 362159
308 Ga0209700_100105 3300027363 Bacteria 118780
309 Ga0209971_1002480 3300027682 Bacteria 4434
310 Ga0268266_10235284 3300028379 Bacteria 1689
311 Ga0268265_10019896 3300028380 Bacteria 4675
312 Ga0268265_10173167 3300028380 Bacteria 1847
313 Ga0268265_10187123 3300028380 Bacteria 1785
314 Ga0268264_10000566 3300028381 Bacteria 45480
315 Ga0265339_10090003 3300031249 Bacteria 1610
316 Ga0307510_10066110 3300033180 Bacteria 3654
317 Ga0315911_1000013 3300033442 Bacteria 239334
318 Ga0373926_0022812 3300035083 Bacteria 2172
319 Ga0373944_0009550 3300035089 Bacteria 2633
320 Ga0373945_0005059 3300035116 Bacteria 4202
321 Ga0373953_0036137 3300035117 Bacteria 1944
322 Ga0373956_0032778 3300035119 Bacteria 2281
323 Ga0373955_0087051 3300035172 Bacteria 1775
324 Ga0373935_0010225 3300035692 Bacteria 5622
325 Ga0373927_0028242 3300035695 Bacteria 3659
326 Ga0373927_0028563 3300035695 Bacteria 3639
327 Ga0373947_0006308 3300035725 Bacteria 6892
328 Ga0373937_0015351 3300036401 Bacteria 6774
329 Ga0373937_0104963 3300036401 Bacteria 2625
330 Ga0373925_0046505 3300037068 Bacteria 3227
331 Ga0373925_0114575 3300037068 Bacteria 2087
332 Ga0395899_0003854 3300037312 Bacteria 11827
333 Ga0395900_0007892 3300037418 Bacteria 10962
334 Ga0395900_0143158 3300037418 Bacteria 2447
335 Ga0395905_0195793 3300037471 Bacteria 1895
336 Ga0395905_0486770 3300037471 Bacteria 1133
337 Ga0436364_0059646 3300037853 Bacteria 4718
338 Ga0242420_006119 3300038996 Bacteria 1892
339 Ga0436365_0097731 3300039437 Bacteria 2358
340 Ga0451577_0034575 3300042876 Bacteria 4556
341 Ga0466972_0001405 3300044658 Bacteria 11669
342 Ga0466972_0005312 3300044658 Bacteria 6449
343 Ga0466972_0034717 3300044658 Bacteria 2469
344 Ga0466966_0000209 3300044684 Bacteria 39062
345 Ga0466961_0000110 3300044693 Bacteria 54241
346 Ga0466968_0042359 3300044735 Bacteria 1925
347 Ga0466968_0095111 3300044735 Bacteria 1325
348 Ga0466970_0004728 3300044765 Bacteria 6727
349 Ga0466959_0007187 3300045049 Bacteria 7798
350 Ga0466959_0189675 3300045049 Bacteria 1435
351 Ga0451576_0000030 3300045051 Bacteria 403352
352 Ga0451576_0057362 3300045051 Bacteria 4071
353 Ga0466967_0037924 3300045976 Bacteria 4129
354 Ga0495629_0017962 3300046459 Bacteria 5070
355 Ga0495638_0008749 3300046460 Bacteria 7152
356 Ga0495580_0132900 3300046472 Bacteria 1725
357 Ga0495664_0031902 3300046477 Bacteria 3089
358 Ga0495585_0067208 3300046492 Bacteria 1961
359 Ga0495594_0052304 3300046499 Bacteria 2249
360 Ga0495606_0028489 3300046507 Bacteria 3940
361 Ga0495608_0027653 3300046511 Bacteria 3858
362 Ga0495652_0015898 3300046529 Bacteria 6736
363 Ga0495640_0008874 3300046533 Bacteria 7855
364 Ga0495640_0021916 3300046533 Bacteria 4680
365 Ga0495598_0023593 3300046537 Bacteria 1659
366 Ga0495667_0046711 3300046559 Bacteria 2862
367 Ga0495634_0059320 3300046642 Bacteria 2549
368 Ga0495635_0018265 3300046663 Bacteria 4895
369 Ga0495657_0105491 3300046675 Bacteria 1790
370 Ga0495623_0017667 3300046679 Bacteria 4607
371 Ga0495646_0055703 3300046680 Bacteria 2373
372 Ga0495647_0014535 3300046681 Bacteria 2744
373 Ga0495624_0030288 3300046690 Bacteria 3526
374 Ga0495600_0003817 3300046809 Bacteria 8926
375 Ga0495581_0035160 3300047315 Bacteria 2899
376 Ga0495581_0046456 3300047315 Bacteria 2509
377 Ga0495604_0001495 3300047317 Bacteria 19268
378 Ga0495674_0021283 3300047319 Bacteria 5999
379 Ga0495676_0013624 3300047321 Bacteria 7299
380 Ga0495676_0030025 3300047321 Bacteria 4621
381 Ga0495680_0005483 3300047322 Bacteria 11927
382 Ga0495687_011481 3300047443 Bacteria 4757
383 Ga0495673_0037214 3300047469 Bacteria 2225
384 Ga0495684_0011086 3300047471 Bacteria 6968
385 Ga0495684_0042187 3300047471 Bacteria 3495
386 Ga0495602_0026445 3300048088 Bacteria 5596
387 Ga0495602_0059103 3300048088 Bacteria 3350
388 Ga0496102_0214140 3300048905 Bacteria 1816
389 Ga0496102_0298911 3300048905 Bacteria 1517
390 Ga0496103_0179003 3300048906 Bacteria 1362
391 Ga0496104_0001082 3300048907 Bacteria 23263
392 Ga0496105_0001148 3300048908 Bacteria 18448
393 Ga0496105_0122539 3300048908 Bacteria 2143
394 Ga0496106_0098985 3300048909 Bacteria 2260
395 Ga0496108_0001659 3300048911 Bacteria 17640
396 Ga0496108_0134264 3300048911 Bacteria 2128
397 Ga0496108_0290552 3300048911 Bacteria 1423
398 Ga0496109_0052621 3300048912 Bacteria 3712
399 Ga0496109_0100702 3300048912 Bacteria 2681
400 Ga0496109_0392296 3300048912 Bacteria 1312
401 Ga0496110_0008384 3300048913 Bacteria 8314
402 Ga0496111_0083719 3300048914 Bacteria 2331
403 Ga0496112_0000896 3300048915 Bacteria 21449
404 Ga0496112_0002790 3300048915 Bacteria 14183
405 Ga0496112_0145404 3300048915 Bacteria 2339
406 Ga0496113_0000418 3300048916 Bacteria 20649
407 Ga0496115_0001613 3300048918 Bacteria 16216
408 Ga0496120_0066413 3300048923 Bacteria 1995
409 Ga0496126_0014893 3300048929 Bacteria 7842
410 Ga0496126_0025590 3300048929 Bacteria 5673
411 Ga0496126_0078616 3300048929 Bacteria 2922
412 Ga0501031_0000890 3300049568 Bacteria 18010
413 Ga0501031_0022980 3300049568 Bacteria 4066
414 Ga0501032_0000372 3300049569 Bacteria 37150
415 Ga0501032_0029900 3300049569 Bacteria 3736
416 Ga0501032_0064130 3300049569 Bacteria 2459
417 Ga0501033_0000824 3300049570 Bacteria 28287
418 Ga0501033_0028686 3300049570 Bacteria 4182
419 Ga0501033_0040171 3300049570 Bacteria 3493
420 Ga0501033_0057360 3300049570 Bacteria 2878
421 Ga0501033_0148121 3300049570 Bacteria 1694
422 Ga0501033_0214414 3300049570 Bacteria 1372
423 Ga0501034_0000058 3300049571 Bacteria 198554
424 Ga0501034_0128684 3300049571 Bacteria 2516
425 Ga0501036_0000691 3300049572 Bacteria 24907
426 Ga0501037_0001344 3300049573 Bacteria 18059
427 Ga0501038_0000913 3300049574 Bacteria 26199
428 Ga0501038_0008489 3300049574 Bacteria 9444
429 Ga0501039_0051531 3300049575 Bacteria 3185
430 Ga0501039_0156239 3300049575 Bacteria 1792
431 Ga0501040_0005144 3300049576 Bacteria 8461
432 Ga0501042_0066098 3300049578 Bacteria 2584
433 Ga0501043_0000444 3300049579 Bacteria 37193
434 Ga0501043_0012190 3300049579 Bacteria 6719
435 Ga0501043_0051609 3300049579 Bacteria 3231
436 Ga0501043_0125244 3300049579 Bacteria 2014
437 Ga0501046_0029707 3300049580 Bacteria 4442
438 Ga0501047_0000022 3300049581 Bacteria 249062
439 Ga0501047_0025198 3300049581 Bacteria 5715
440 Ga0501047_0042186 3300049581 Bacteria 4409
441 Ga0501047_0045096 3300049581 Bacteria 4262
442 Ga0501048_0000041 3300049582 Bacteria 62410
443 Ga0501067_0000764 3300049583 Bacteria 17325
444 Ga0501067_0001148 3300049583 Bacteria 14356
445 Ga0501068_0000547 3300049584 Bacteria 19075
446 Ga0501068_0071266 3300049584 Bacteria 2121
447 Ga0501069_0043422 3300049585 Bacteria 2488
448 Ga0501070_0004220 3300049586 Bacteria 12353
449 Ga0501070_0112532 3300049586 Bacteria 2249
450 Ga0501070_0134828 3300049586 Bacteria 2039
451 Ga0501072_0003399 3300049588 Bacteria 11979
452 Ga0501072_0214004 3300049588 Bacteria 1536
453 Ga0501073_0000504 3300049589 Bacteria 27300
454 Ga0501074_0000028 3300049590 Bacteria 67595
455 Ga0501074_0000683 3300049590 Bacteria 21201
456 Ga0501077_0075177 3300049593 Bacteria 2139
457 Ga0501079_0002860 3300049741 Bacteria 12589
458 Ga0501079_0083613 3300049741 Bacteria 2469
459 Ga0501080_0012339 3300049742 Bacteria 7830
460 Ga0501083_0001349 3300049744 Bacteria 16655
461 Ga0501035_0001113 3300049822 Bacteria 28138
462 Ga0501035_0015011 3300049822 Bacteria 7149
463 Ga0501035_0098467 3300049822 Bacteria 2567
464 Ga0501035_0146725 3300049822 Bacteria 2048
465 Ga0501044_0000370 3300049823 Bacteria 56259
466 Ga0501044_0024557 3300049823 Bacteria 6395
467 Ga0501044_0239790 3300049823 Bacteria 1757
468 Ga0501045_0006116 3300049824 Bacteria 8336
469 Ga0501045_0014542 3300049824 Bacteria 5579
470 nmdc:mga0yw44_57675_c1 3300050492 Bacteria 2370
471 nmdc:mga0k408_32699_c1 3300050493 Bacteria 2971
472 nmdc:mga0k408_75484_c1 3300050493 Bacteria 1970
473 nmdc:mga05p37_163289_c1 3300050507 Bacteria 2719
474 nmdc:mga08y16_50025_c1 3300050511 Bacteria 4373
475 Ga0495601_0079609 3300053077 Bacteria 2101
476 Ga0500643_000049 3300053087 Bacteria 147107
477 Ga0500557_000192 3300053105 Bacteria 10407
478 Ga0500642_0000056 3300053130 Bacteria 67746
479 Ga0500559_0046016 3300053136 Bacteria 1912
480 Ga0500616_0024201 3300053153 Bacteria 3377
481 Ga0500636_0002629 3300053177 Bacteria 9982
482 Ga0500636_0014012 3300053177 Bacteria 4713
483 Ga0500601_003890 3300053737 Bacteria 1623
484 Ga0501084_0007133 3300054114 Bacteria 9204
485 Ga0501084_0055837 3300054114 Bacteria 3304
486 Ga0501082_0000101 3300060353 Bacteria 66608
487 Ga0501082_0013595 3300060353 Bacteria 6994
488 Ga0501082_0057571 3300060353 Bacteria 3348
489 2513660977 2513237096 Bacteria 8722461
490 2513677588 2513237098 Bacteria 9902361
491 2513719800 2513237104 Bacteria 10034502
492 2513860468 2513237137 Bacteria 9558895
493 2513922719 2513237145 Bacteria 8979722
494 2517888724 2517572143 Bacteria 9484767
495 2524467399 2524023210 Bacteria 9029266
496 2524538819 2524023228 Bacteria 10118060
497 2644027976 2643221603 Bacteria 6147767
498 2644290859 2643221651 Bacteria 4798932
499 2671119897 2667528175 Bacteria 7532676
500 2728754888 2728368998 Bacteria 8720350
501 2793067543 2791355197 Bacteria 8420563
502 2819687911 2818991461 Bacteria 7026071
503 2854681327 2854681122 Bacteria 4548679
504 2885377939 2885374607 Bacteria 8927485
505 2885391013 2885383462 Bacteria 9473874
506 2900580149 2900577576 Bacteria 5438534
507 2903756378 2903748898 Bacteria 9972761
508 2903772359 2903768456 Bacteria 9749579
509 2904690615 2904690495 Bacteria 9412302
510 2904708853
511 2906613753
512 2906640094 2906635258 Bacteria 8601019
513 2906667488 2906660503 Bacteria 8595048
514 2908747317 2908739725 Bacteria 8628932
515 2908756395 2908756301 Bacteria 8864324
516 2922434407
517 2932794431 2932794094 Bacteria 7915132
518 2932806713 2932801729 Bacteria 7987968
519 2935635460 2935630451 Bacteria 8169952
520 2935888484 2935883170 Bacteria 7964738
521 2941512243 2941507105 Bacteria 8166816
522 2941519944 2941515067 Bacteria 8166720
523 2941528115 2941523033 Bacteria 8169134
524 3005474955 3005474847 Bacteria 9259049
525 8006936377 8006933436 Bacteria 10410654
526 8006976346 8006973647 Bacteria 10679141
527 8019562283 8019555841 Bacteria 9642137
528 8019572353 8019565922 Bacteria 9639779
529 8056687499 8056681323 Bacteria 8472857
530 8056695307 8056689827 Bacteria 6712655
531 Ga0495606_0045733
532 JGI24739J22299_10039738
533 JGI24735J21928_10013429
534 JGI25153J46596_10007816
535 JGI25153J46596_10007902
536 JGI25153J46596_10010396
537 JGI25153J46596_10017295
538 JGI25160J50197_1010795
539 Ga0055542_1006636
540 Ga0055536_1006610
541 Ga0055536_1006721
542 Ga0055531_10004770
543 Ga0065712_10015671
544 Ga0065715_10133360
545 Ga0070658_10035380
546 Ga0070658_10064977
547 Ga0070683_100008196
548 Ga0070683_100058369
549 Ga0070683_100066845
550 Ga0070670_100003522
551 Ga0070670_100009835
552 Ga0070670_100081131
553 Ga0068869_100001725
554 Ga0070666_10040404
555 Ga0070660_100002704
556 Ga0070660_100100462
557 Ga0070661_100001413
558 Ga0070661_100017823
559 Ga0070668_100013749
560 Ga0070668_100132856
561 Ga0070668_100133201
562 Ga0070669_100029674
563 Ga0070669_100176757
564 Ga0070675_100022720
565 Ga0070675_100060283
566 Ga0070671_100007541
567 Ga0070673_100021366
568 Ga0070688_100064519
569 Ga0070659_100018465
570 Ga0070709_10002152
571 Ga0070709_10004534
572 Ga0070714_100013143
573 Ga0070713_100000045
574 Ga0070713_100021807
575 Ga0070710_10051082
576 Ga0070711_100016348
577 Ga0070711_100030366
578 Ga0070663_100091220
579 Ga0070663_100131112
580 Ga0070678_100023376
581 Ga0070662_100070087
582 Ga0070662_100084286
583 Ga0070681_10041429
584 Ga0070681_10047103
585 Ga0068867_100027466
586 Ga0070706_100025322
587 Ga0070706_100065313
588 Ga0070706_100129477
589 Ga0070707_100072841
590 Ga0070698_100075213
591 Ga0070679_100030656
592 Ga0070679_100034699
593 Ga0068853_100103852
594 Ga0070672_100052703
595 Ga0070672_100054150
596 Ga0070665_100150070
597 Ga0068855_100051723
598 Ga0068855_100072739
599 Ga0068855_100110816
600 Ga0068855_100168338
601 Ga0070664_100003038
602 Ga0070664_100102378
603 Ga0068857_100000810
604 Ga0068857_100002261
605 Ga0068854_100069318
606 Ga0068856_100014288
607 Ga0068856_100075629
608 Ga0068852_100001129
609 Ga0068859_100000466
610 Ga0068859_100225633
611 Ga0068864_100001455
612 Ga0068864_100023418
613 Ga0068864_100042872
614 Ga0068864_100170161
615 Ga0068861_100011143
616 Ga0068861_100031998
617 Ga0068861_100045614
618 Ga0068851_10002809
619 Ga0068851_10039586
620 Ga0068863_100000829
621 Ga0068863_100028656
622 Ga0068858_100000624
623 Ga0068858_100025937
624 Ga0068860_100000782
625 Ga0068862_100007370
626 Ga0068862_100046933
627 Ga0081455_10050878
628 Ga0081540_1004334
629 Ga0081540_1018763
630 Ga0081540_1024850
631 Ga0081539_10012946
632 Ga0081539_10073239
633 Ga0070717_10190093
634 Ga0070716_100129097
635 Ga0070712_100152497
636 Ga0097621_100047547
637 Ga0097621_100104056
638 Ga0075370_10021464
639 Ga0075434_100073727
640 Ga0068865_100138541
641 Ga0097620_100000466
642 Ga0097620_100225639
643 Ga0099822_1004364
644 Ga0099823_1009115
645 Ga0105240_10001807
646 Ga0105240_10013166
647 Ga0105240_10056620
648 Ga0111539_10104860
649 Ga0105245_10122043
650 Ga0105245_10157120
651 Ga0105247_10094955
652 Ga0105243_10090220
653 Ga0105242_10040904
654 Ga0105242_10128297
655 Ga0105248_10000736
656 Ga0105248_10019836
657 Ga0105237_10030893
658 Ga0105237_10047164
659 Ga0105237_10192243
660 Ga0105238_10001317
661 Ga0105239_10218890
662 Ga0157371_10030019
663 Ga0157371_10060192
664 Ga0157370_10025696
665 Ga0157370_10079448
666 Ga0157369_10026262
667 Ga0157369_10028351
668 Ga0157369_10075412
669 Ga0157374_10059243
670 Ga0157378_10028724
671 Ga0157378_10234577
672 Ga0163162_10107477
673 Ga0163162_10114095
674 Ga0163162_10176752
675 Ga0157372_10062406
676 Ga0157372_10101310
677 Ga0157375_10004326
678 Ga0157375_10041140
679 Ga0157375_10135677
680 Ga0163163_10129302
681 Ga0163163_10171872
682 Ga0163163_10210410
683 Ga0157380_10030766
684 Ga0157380_10227029
685 Ga0157379_10000233
686 Ga0157379_10069172
687 Ga0157379_10180524
688 Ga0157376_10162542
689 Ga0163161_10070747
690 Ga0209677_104912
691 Ga0209148_1000308
692 Ga0209676_1000097
693 Ga0209564_1007252
694 Ga0209564_1009228
695 Ga0209758_1000443
696 Ga0209758_1000546
697 Ga0209758_1004610
698 Ga0209758_1008688
699 Ga0209758_1013471
700 Ga0209256_1002930
701 Ga0207426_1007996
702 Ga0209257_1001004
703 Ga0209257_1015484
704 Ga0207697_10000068
705 Ga0207656_10008744
706 Ga0207656_10042997
707 Ga0207682_10000097
708 Ga0207682_10000266
709 Ga0207642_10031724
710 Ga0207642_10088050
711 Ga0207710_10020950
712 Ga0207688_10105033
713 Ga0207680_10042685
714 Ga0207647_10023452
715 Ga0207699_10001846
716 Ga0207699_10091799
717 Ga0207645_10004546
718 Ga0207645_10022990
719 Ga0207645_10023460
720 Ga0207643_10010998
721 Ga0207643_10015498
722 Ga0207705_10060071
723 Ga0207684_10009875
724 Ga0207684_10060801
725 Ga0207684_10117214
726 Ga0207654_10023650
727 Ga0207707_10015977
728 Ga0207695_10000107
729 Ga0207695_10054785
730 Ga0207695_10187513
731 Ga0207695_10338442
732 Ga0207671_10006765
733 Ga0207671_10167552
734 Ga0207693_10019351
735 Ga0207693_10067049
736 Ga0207693_10236362
737 Ga0207663_10007451
738 Ga0207657_10021865
739 Ga0207657_10094822
740 Ga0207657_10104246
741 Ga0207652_10212846
742 Ga0207646_10018727
743 Ga0207681_10095540
744 Ga0207694_10003964
745 Ga0207694_10074789
746 Ga0207694_10108133
747 Ga0207650_10008850
748 Ga0207650_10026884
749 Ga0207650_10034291
750 Ga0207650_10046657
751 Ga0207659_10037471
752 Ga0207659_10043335
753 Ga0207659_10103169
754 Ga0207687_10072474
755 Ga0207687_10145749
756 Ga0207700_10000051
757 Ga0207700_10013199
758 Ga0207700_10017262
759 Ga0207664_10033510
760 Ga0207690_10026056
761 Ga0207706_10033238
762 Ga0207706_10070833
763 Ga0207706_10076316
764 Ga0207706_10118076
765 Ga0207706_10236260
766 Ga0207686_10123188
767 Ga0207670_10057680
768 Ga0207669_10018077
769 Ga0207704_10030438
770 Ga0207704_10132220
771 Ga0207704_10142158
772 Ga0207665_10080351
773 Ga0207665_10150052
774 Ga0207665_10187602
775 Ga0207691_10000331
776 Ga0207691_10002783
777 Ga0207691_10025670
778 Ga0207711_10010140
779 Ga0207711_10016463
780 Ga0207689_10000310
781 Ga0207689_10028706
782 Ga0207689_10176957
783 Ga0207661_10005122
784 Ga0207661_10008755
785 Ga0207661_10173181
786 Ga0207679_10013209
787 Ga0207679_10071933
788 Ga0207679_10093421
789 Ga0207667_10010866
790 Ga0207667_10033168
791 Ga0207667_10157991
792 Ga0207667_10159374
793 Ga0207667_10283852
794 Ga0207651_10033592
795 Ga0207651_10064308
796 Ga0207668_10004867
797 Ga0207640_10052873
798 Ga0207640_10078096
799 Ga0207658_10000650
800 Ga0207658_10095301
801 Ga0207703_10000443
802 Ga0207703_10064385
803 Ga0207703_10086720
804 Ga0207703_10103230
805 Ga0207639_10176445
806 Ga0207678_10002621
807 Ga0207678_10050007
808 Ga0207708_10006748
809 Ga0207702_10003982
810 Ga0207702_10018926
811 Ga0207702_10186150
812 Ga0207641_10001097
813 Ga0207641_10004409
814 Ga0207648_10003029
815 Ga0207648_10003723
816 Ga0207648_10061587
817 Ga0207648_10193386
818 Ga0207676_10000995
819 Ga0207674_10000418
820 Ga0207674_10071635
821 Ga0207675_100000726
822 Ga0207675_100001605
823 Ga0207675_100022891
824 Ga0207675_100025019
825 Ga0207675_100221489
826 Ga0207683_10000276
827 Ga0207683_10058191
828 Ga0207698_10020906
829 Ga0207698_10052986
830 Ga0209389_1000153
831 Ga0209389_1000344
832 Ga0209589_1000032
833 Ga0209589_1000046
834 Ga0209489_100106
835 Ga0209489_100936
836 Ga0209489_102825
837 Ga0209700_100011
838 Ga0209700_100105
839 Ga0209971_1002480
840 Ga0268266_10235284
841 Ga0268265_10019896
842 Ga0268265_10173167
843 Ga0268265_10187123
844 Ga0268264_10000566
845 Ga0265339_10090003
846 Ga0307510_10066110
847 Ga0315911_1000013
848 Ga0373926_0022812
849 Ga0373944_0009550
850 Ga0373945_0005059
851 Ga0373953_0036137
852 Ga0373956_0032778
853 Ga0373955_0087051
854 Ga0373935_0010225
855 Ga0373927_0028242
856 Ga0373927_0028563
857 Ga0373947_0006308
858 Ga0373937_0015351
859 Ga0373937_0104963
860 Ga0373925_0046505
861 Ga0373925_0114575
862 Ga0395899_0003854
863 Ga0395900_0007892
864 Ga0395900_0143158
865 Ga0395905_0195793
866 Ga0395905_0486770
867 Ga0436364_0059646
868 Ga0242420_006119
869 Ga0436365_0097731
870 Ga0451577_0034575
871 Ga0466972_0001405
872 Ga0466972_0005312
873 Ga0466972_0034717
874 Ga0466966_0000209
875 Ga0466961_0000110
876 Ga0466968_0042359
877 Ga0466968_0095111
878 Ga0466970_0004728
879 Ga0466959_0007187
880 Ga0466959_0189675
881 Ga0451576_0000030
882 Ga0451576_0057362
883 Ga0466967_0037924
884 Ga0495629_0017962
885 Ga0495638_0008749
886 Ga0495580_0132900
887 Ga0495664_0031902
888 Ga0495585_0067208
889 Ga0495594_0052304
890 Ga0495606_0028489
891 Ga0495608_0027653
892 Ga0495652_0015898
893 Ga0495640_0008874
894 Ga0495640_0021916
895 Ga0495598_0023593
896 Ga0495667_0046711
897 Ga0495634_0059320
898 Ga0495635_0018265
899 Ga0495657_0105491
900 Ga0495623_0017667
901 Ga0495646_0055703
902 Ga0495647_0014535
903 Ga0495624_0030288
904 Ga0495600_0003817
905 Ga0495581_0035160
906 Ga0495581_0046456
907 Ga0495604_0001495
908 Ga0495674_0021283
909 Ga0495676_0013624
910 Ga0495676_0030025
911 Ga0495680_0005483
912 Ga0495687_011481
913 Ga0495673_0037214
914 Ga0495684_0011086
915 Ga0495684_0042187
916 Ga0495602_0026445
917 Ga0495602_0059103
918 Ga0496102_0214140
919 Ga0496102_0298911
920 Ga0496103_0179003
921 Ga0496104_0001082
922 Ga0496105_0001148
923 Ga0496105_0122539
924 Ga0496106_0098985
925 Ga0496108_0001659
926 Ga0496108_0134264
927 Ga0496108_0290552
928 Ga0496109_0052621
929 Ga0496109_0100702
930 Ga0496109_0392296
931 Ga0496110_0008384
932 Ga0496111_0083719
933 Ga0496112_0000896
934 Ga0496112_0002790
935 Ga0496112_0145404
936 Ga0496113_0000418
937 Ga0496115_0001613
938 Ga0496120_0066413
939 Ga0496126_0014893
940 Ga0496126_0025590
941 Ga0496126_0078616
942 Ga0501031_0000890
943 Ga0501031_0022980
944 Ga0501032_0000372
945 Ga0501032_0029900
946 Ga0501032_0064130
947 Ga0501033_0000824
948 Ga0501033_0028686
949 Ga0501033_0040171
950 Ga0501033_0057360
951 Ga0501033_0148121
952 Ga0501033_0214414
953 Ga0501034_0000058
954 Ga0501034_0128684
955 Ga0501036_0000691
956 Ga0501037_0001344
957 Ga0501038_0000913
958 Ga0501038_0008489
959 Ga0501039_0051531
960 Ga0501039_0156239
961 Ga0501040_0005144
962 Ga0501042_0066098
963 Ga0501043_0000444
964 Ga0501043_0012190
965 Ga0501043_0051609
966 Ga0501043_0125244
967 Ga0501046_0029707
968 Ga0501047_0000022
969 Ga0501047_0025198
970 Ga0501047_0042186
971 Ga0501047_0045096
972 Ga0501048_0000041
973 Ga0501067_0000764
974 Ga0501067_0001148
975 Ga0501068_0000547
976 Ga0501068_0071266
977 Ga0501069_0043422
978 Ga0501070_0004220
979 Ga0501070_0112532
980 Ga0501070_0134828
981 Ga0501072_0003399
982 Ga0501072_0214004
983 Ga0501073_0000504
984 Ga0501074_0000028
985 Ga0501074_0000683
986 Ga0501077_0075177
987 Ga0501079_0002860
988 Ga0501079_0083613
989 Ga0501080_0012339
990 Ga0501083_0001349
991 Ga0501035_0001113
992 Ga0501035_0015011
993 Ga0501035_0098467
994 Ga0501035_0146725
995 Ga0501044_0000370
996 Ga0501044_0024557
997 Ga0501044_0239790
998 Ga0501045_0006116
999 Ga0501045_0014542
1000 nmdc:mga0yw44_57675_c1
1001 nmdc:mga0k408_32699_c1
1002 nmdc:mga0k408_75484_c1
1003 nmdc:mga05p37_163289_c1
1004 nmdc:mga08y16_50025_c1
1005 Ga0495601_0079609
1006 Ga0500643_000049
1007 Ga0500557_000192
1008 Ga0500642_0000056
1009 Ga0500559_0046016
1010 Ga0500616_0024201
1011 Ga0500636_0002629
1012 Ga0500636_0014012
1013 Ga0500601_003890
1014 Ga0501084_0007133
1015 Ga0501084_0055837
1016 Ga0501082_0000101
1017 Ga0501082_0013595
1018 Ga0501082_0057571
1019 2513660977
1020 2513677588
1021 2513719800
1022 2513860468
1023 2513922719
1024 2517888724
1025 2524467399
1026 2524538819
1027 2644027976
1028 2644290859
1029 2671119897
1030 2728754888
1031 2793067543
1032 2819687911
1033 2854681327
1034 2885377939
1035 2885391013
1036 2900580149
1037 2903756378
1038 2903772359
1039 2904690615
1040 2904708853
1041 2906613753
1042 2906640094
1043 2906667488
1044 2908747317
1045 2908756395
1046 2922434407
1047 2932794431
1048 2932806713
1049 2935635460
1050 2935888484
1051 2941512243
1052 2941519944
1053 2941528115
1054 3005474955
1055 8006936377
1056 8006976346
1057 8019562283
1058 8019572353
1059 8056687499
1060 8056695307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

45

360

0.85

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

36

327

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq4-assembly1.cif.gz_A substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli 0.9652 26 427
4aq4-assembly1.cif.gz_A substrate bound sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli 0.9268 26 427
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.902 25 428
6x84-assembly2.cif.gz_B sn-glycerol-3-phosphate binding periplasmic protein ugpb from escherichia coli - w169s, w172s 0.8796 25 428
7c0u-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (s127a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine 0.8613 27 422
ID Description Score Start End Superfamily
af_P0AG80_145_437_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9649 147 427 3.40.190.10
4aq4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9564 26 374 3.40.190.10
4aq4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9288 26 374 3.40.190.10
af_P0AG80_145_437_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9231 147 427 3.40.190.10
4aq4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8948 147 427 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1G3RQS8-F1-model_v4 sn-glycerol-3-phosphate ABC transporter substrate-binding protein 0.9721 35 429 GO:0030313
GO:0055085
AF-A0A0E1UNP6-F1-model_v4 deleted 0.9691 21 416
AF-A0A0R3CB30-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.9662 20 428 GO:0042597
AF-A0A432RQP0-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.9652 35 426 GO:0030313
GO:0055085
AF-A0A2X2TAB2-F1-model_v4 sn-glycerol-3-phosphate-binding periplasmic protein UgpB 0.962 20 430 GO:0016020
GO:0030288
GO:0055085

Map