F460028

General Info

Members Datasets Scaffolds Average Seq Length
530 239 530 209

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0280909|Ga0501081_0280909_477_1205
Length 242
Sequence VRTPPLAIIDTVRTVELGGIARIPADGLEYFGMGKPRVLLADDHTLLLGAFEKLLAEECEIVGQVSDGRALVAAAEDLTPDLIVLDISMPLLNGLEAGRQIKQKLRNVKLVFLTMNEDADLAAEAFRSGASGYLLKRSASSELATAIREVMQGRSYVTPLVTEGLVGSLLNQDDTDRPSDDLTSRQREVLQLLAEGRSMKEVASVLNLTPRTVAFHKYRMMEQLKVKTTAELIQYAVKHHIV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
208 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
211 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
223 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
224 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 5.28
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1373379 2162886007 Bacteria 1244
2 MRS1b_contig_6792041 2162886011 Unclassified 1398
3 MRS1b_contig_7604879 2162886011 Bacteria 2392
4 MBSR1b_contig_10852347 2162886012 Bacteria 1579
5 MBSR1b_contig_11074376 2162886012 Unclassified 825
6 Ga0058861_10791624 3300004800 Bacteria 1285
7 Ga0065704_10084830 3300005289 Bacteria 3290
8 Ga0065712_10000605 3300005290 Bacteria 13608
9 Ga0065712_10260229 3300005290 Unclassified 938
10 Ga0065715_10014392 3300005293 Bacteria 2744
11 Ga0065715_10144202 3300005293 Bacteria 1811
12 Ga0065715_10190882 3300005293 Bacteria 1416
13 Ga0065715_10199920 3300005293 Bacteria 1367
14 Ga0065715_10424076 3300005293 Unclassified 854
15 Ga0065715_10597132 3300005293 Unclassified 710
16 Ga0065707_10020564 3300005295 Unclassified 1723
17 Ga0065707_10113165 3300005295 Bacteria 2336
18 Ga0070676_10045532 3300005328 Bacteria 2555
19 Ga0070676_10208697 3300005328 Bacteria 1284
20 Ga0070676_10487708 3300005328 Bacteria 873
21 Ga0070683_100003660 3300005329 Bacteria 12527
22 Ga0070690_100034912 3300005330 Bacteria 3153
23 Ga0070670_101253149 3300005331 Unclassified 678
24 Ga0070677_10476944 3300005333 Bacteria 672
25 Ga0068869_100046029 3300005334 Bacteria 3144
26 Ga0068869_100136191 3300005334 Bacteria 1892
27 Ga0070666_10009961 3300005335 Bacteria 5932
28 Ga0070666_10685199 3300005335 Unclassified 751
29 Ga0070666_10707905 3300005335 Bacteria 739
30 Ga0070682_100168024 3300005337 Bacteria 1522
31 Ga0070660_100367561 3300005339 Bacteria 1186
32 Ga0070689_100009451 3300005340 Bacteria 6912
33 Ga0070689_100029458 3300005340 Bacteria 4155
34 Ga0070689_100140369 3300005340 Bacteria 1943
35 Ga0070691_10000290 3300005341 Bacteria 17494
36 Ga0070661_100096727 3300005344 Bacteria 2191
37 Ga0070668_100076998 3300005347 Bacteria 2607
38 Ga0070668_100097891 3300005347 Bacteria 2320
39 Ga0070668_100178576 3300005347 Bacteria 1733
40 Ga0070669_100005559 3300005353 Bacteria 9106
41 Ga0070669_100018408 3300005353 Bacteria 4992
42 Ga0070669_100039752 3300005353 Unclassified 3418
43 Ga0070669_100081646 3300005353 Bacteria 2409
44 Ga0070669_100096273 3300005353 Bacteria 2227
45 Ga0070669_100121996 3300005353 Bacteria 1989
46 Ga0070675_100169530 3300005354 Unclassified 1882
47 Ga0070675_100713553 3300005354 Bacteria 914
48 Ga0070671_100003359 3300005355 Bacteria 12483
49 Ga0070671_100143662 3300005355 Unclassified 2014
50 Ga0070671_100424287 3300005355 Bacteria 1139
51 Ga0070674_100009078 3300005356 Bacteria 5946
52 Ga0070674_100017542 3300005356 Bacteria 4507
53 Ga0070674_100018623 3300005356 Bacteria 4395
54 Ga0070674_100036984 3300005356 Unclassified 3281
55 Ga0070674_100477286 3300005356 Bacteria 1034
56 Ga0070673_100005004 3300005364 Bacteria 8451
57 Ga0070673_100066802 3300005364 Bacteria 2874
58 Ga0070673_100182916 3300005364 Bacteria 1795
59 Ga0070673_100363558 3300005364 Bacteria 1287
60 Ga0070673_100585435 3300005364 Bacteria 1016
61 Ga0070688_100013809 3300005365 Bacteria 4566
62 Ga0070688_100128764 3300005365 Bacteria 1705
63 Ga0070688_100744737 3300005365 Unclassified 762
64 Ga0070659_100095355 3300005366 Bacteria 2390
65 Ga0070659_100102968 3300005366 Bacteria 2299
66 Ga0070667_100048408 3300005367 Unclassified 3578
67 Ga0070667_100090381 3300005367 Bacteria 2632
68 Ga0070667_100623749 3300005367 Bacteria 994
69 Ga0070667_100647360 3300005367 Bacteria 976
70 Ga0070703_10071145 3300005406 Bacteria 1162
71 Ga0070701_10002670 3300005438 Bacteria 6916
72 Ga0070701_10019396 3300005438 Unclassified 3211
73 Ga0070705_100008956 3300005440 Bacteria 4964
74 Ga0070705_100244076 3300005440 Bacteria 1257
75 Ga0070700_100000383 3300005441 Bacteria 22722
76 Ga0070700_100254069 3300005441 Bacteria 1262
77 Ga0070700_100480352 3300005441 Bacteria 952
78 Ga0070694_100001320 3300005444 Bacteria 14433
79 Ga0070694_100095616 3300005444 Bacteria 2092
80 Ga0070708_100465153 3300005445 Bacteria 1193
81 Ga0070663_100175017 3300005455 Bacteria 1661
82 Ga0070663_100255093 3300005455 Unclassified 1389
83 Ga0070663_100753812 3300005455 Bacteria 831
84 Ga0070678_100089917 3300005456 Bacteria 2351
85 Ga0070662_100073927 3300005457 Unclassified 2520
86 Ga0070681_10501894 3300005458 Bacteria 1126
87 Ga0068867_100016814 3300005459 Bacteria 5198
88 Ga0068867_100036462 3300005459 Bacteria 3570
89 Ga0068867_100043804 3300005459 Bacteria 3277
90 Ga0068867_100277042 3300005459 Bacteria 1374
91 Ga0068867_100839910 3300005459 Bacteria 822
92 Ga0070684_100004122 3300005535 Bacteria 10999
93 Ga0070684_100456504 3300005535 Bacteria 1181
94 Ga0070672_100004805 3300005543 Bacteria 8873
95 Ga0070686_100023526 3300005544 Unclassified 3683
96 Ga0070686_100093918 3300005544 Bacteria 2012
97 Ga0070686_100143309 3300005544 Bacteria 1665
98 Ga0070695_100020122 3300005545 Bacteria 4071
99 Ga0070695_100033455 3300005545 Bacteria 3216
100 Ga0070695_100037646 3300005545 Bacteria 3050
101 Ga0070696_100003529 3300005546 Bacteria 10406
102 Ga0070693_100008382 3300005547 Bacteria 5093
103 Ga0070693_100010937 3300005547 Bacteria 4559
104 Ga0070693_100068592 3300005547 Bacteria 2082
105 Ga0070665_100019581 3300005548 Bacteria 6794
106 Ga0070665_100396254 3300005548 Unclassified 1388
107 Ga0070704_100004714 3300005549 Bacteria 7888
108 Ga0070704_100031227 3300005549 Bacteria 3581
109 Ga0070704_100038691 3300005549 Unclassified 3269
110 Ga0068855_100416342 3300005563 Bacteria 1470
111 Ga0070664_100033339 3300005564 Unclassified 4313
112 Ga0068857_100242682 3300005577 Bacteria 1650
113 Ga0068854_100010252 3300005578 Bacteria 6075
114 Ga0068854_100058649 3300005578 Bacteria 2779
115 Ga0070702_100000083 3300005615 Bacteria 27572
116 Ga0070702_100044768 3300005615 Bacteria 2500
117 Ga0070702_100377920 3300005615 Bacteria 1006
118 Ga0070702_100504382 3300005615 Unclassified 889
119 Ga0068859_100021906 3300005617 Bacteria 6407
120 Ga0068859_100087614 3300005617 Bacteria 3162
121 Ga0068866_10009288 3300005718 Bacteria 4169
122 Ga0068866_10025264 3300005718 Bacteria 2790
123 Ga0068861_100000910 3300005719 Bacteria 17939
124 Ga0068861_100062330 3300005719 Bacteria 2864
125 Ga0068861_100089558 3300005719 Unclassified 2425
126 Ga0068851_10174417 3300005834 Bacteria 1188
127 Ga0068863_100003058 3300005841 Bacteria 16534
128 Ga0068863_100060928 3300005841 Bacteria 3568
129 Ga0068863_100382895 3300005841 Unclassified 1374
130 Ga0068863_101304310 3300005841 Bacteria 733
131 Ga0068858_100054780 3300005842 Bacteria 3688
132 Ga0068858_100151771 3300005842 Unclassified 2179
133 Ga0068858_100302158 3300005842 Unclassified 1527
134 Ga0068858_101062702 3300005842 Bacteria 794
135 Ga0068860_100149615 3300005843 Bacteria 2248
136 Ga0068860_100160061 3300005843 Bacteria 2170
137 Ga0068860_100231935 3300005843 Unclassified 1794
138 Ga0068860_100298888 3300005843 Unclassified 1577
139 Ga0068862_100119335 3300005844 Bacteria 2323
140 Ga0068862_100176127 3300005844 Bacteria 1917
141 Ga0068862_100358571 3300005844 Bacteria 1354
142 Ga0068862_100390324 3300005844 Unclassified 1300
143 Ga0068862_100514191 3300005844 Bacteria 1138
144 Ga0075365_10402678 3300006038 Bacteria 966
145 Ga0097621_100008632 3300006237 Bacteria 7351
146 Ga0097621_100056717 3300006237 Bacteria 3201
147 Ga0097621_100232803 3300006237 Bacteria 1609
148 Ga0097621_100541954 3300006237 Bacteria 1058
149 Ga0068871_100002602 3300006358 Bacteria 12320
150 Ga0068871_100006540 3300006358 Bacteria 8256
151 Ga0068871_100070051 3300006358 Bacteria 2882
152 Ga0068871_100099710 3300006358 Bacteria 2432
153 Ga0068871_100538731 3300006358 Bacteria 1056
154 Ga0068871_100927568 3300006358 Bacteria 808
155 Ga0075428_100025217 3300006844 Bacteria 6580
156 Ga0075428_100042717 3300006844 Bacteria 4984
157 Ga0075428_100080253 3300006844 Bacteria 3560
158 Ga0075428_100239581 3300006844 Bacteria 1957
159 Ga0075428_100490386 3300006844 Bacteria 1315
160 Ga0075428_100662196 3300006844 Unclassified 1113
161 Ga0075428_100840923 3300006844 Unclassified 975
162 Ga0075430_100144333 3300006846 Bacteria 1982
163 Ga0075431_100052128 3300006847 Bacteria 4219
164 Ga0075431_100095620 3300006847 Bacteria 3067
165 Ga0075431_100098062 3300006847 Unclassified 3026
166 Ga0075431_100158716 3300006847 Bacteria 2326
167 Ga0075431_100306574 3300006847 Bacteria 1603
168 Ga0075431_100467139 3300006847 Bacteria 1256
169 Ga0075433_10065001 3300006852 Bacteria 3199
170 Ga0075433_10100752 3300006852 Bacteria 2558
171 Ga0075433_10111144 3300006852 Unclassified 2431
172 Ga0075433_10586807 3300006852 Unclassified 979
173 Ga0075434_100061110 3300006871 Unclassified 3748
174 Ga0075434_100131045 3300006871 Bacteria 2526
175 Ga0075434_100337826 3300006871 Unclassified 1527
176 Ga0075429_100002883 3300006880 Bacteria 14567
177 Ga0075429_100022602 3300006880 Bacteria 5451
178 Ga0075429_100038404 3300006880 Bacteria 4167
179 Ga0075429_100289722 3300006880 Bacteria 1434
180 Ga0068865_100010956 3300006881 Bacteria 5658
181 Ga0068865_100307721 3300006881 Bacteria 1270
182 Ga0068865_100623205 3300006881 Bacteria 914
183 Ga0075436_100371464 3300006914 Unclassified 1033
184 Ga0097620_100021906 3300006931 Bacteria 6407
185 Ga0097620_100087611 3300006931 Bacteria 3162
186 Ga0075435_100005626 3300007076 Bacteria 8778
187 Ga0075435_100011809 3300007076 Bacteria 6446
188 Ga0075435_100155743 3300007076 Bacteria 1922
189 Ga0075435_100653818 3300007076 Bacteria 912
190 Ga0105251_10063378 3300009011 Unclassified 1734
191 Ga0111539_10001664 3300009094 Bacteria 29674
192 Ga0111539_10006629 3300009094 Bacteria 14912
193 Ga0111539_10038689 3300009094 Bacteria 5756
194 Ga0111539_10041435 3300009094 Bacteria 5537
195 Ga0111539_10041566 3300009094 Bacteria 5526
196 Ga0111539_10070770 3300009094 Bacteria 4117
197 Ga0111539_11536617 3300009094 Bacteria 772
198 Ga0105245_10081382 3300009098 Unclassified 2960
199 Ga0105245_10221922 3300009098 Bacteria 1824
200 Ga0105245_10585161 3300009098 Bacteria 1141
201 Ga0105247_10440268 3300009101 Unclassified 937
202 Ga0114129_10003469 3300009147 Bacteria 22175
203 Ga0114129_10012628 3300009147 Bacteria 12025
204 Ga0114129_10029264 3300009147 Bacteria 7801
205 Ga0114129_10218169 3300009147 Unclassified 2575
206 Ga0114129_10462937 3300009147 Bacteria 1661
207 Ga0114129_11216577 3300009147 Unclassified 937
208 Ga0114129_11776734 3300009147 Bacteria 750
209 Ga0105243_10012656 3300009148 Bacteria 6373
210 Ga0105243_10015769 3300009148 Bacteria 5715
211 Ga0105243_10018166 3300009148 Bacteria 5323
212 Ga0105241_10174830 3300009174 Bacteria 1776
213 Ga0105242_10009583 3300009176 Bacteria 7422
214 Ga0105242_10009773 3300009176 Bacteria 7351
215 Ga0105242_10017211 3300009176 Bacteria 5628
216 Ga0105242_10030156 3300009176 Bacteria 4331
217 Ga0105242_10177808 3300009176 Bacteria 1875
218 Ga0105242_10299834 3300009176 Bacteria 1466
219 Ga0105242_10437967 3300009176 Bacteria 1229
220 Ga0105242_10700626 3300009176 Unclassified 991
221 Ga0105248_10006534 3300009177 Bacteria 12785
222 Ga0105248_10008866 3300009177 Bacteria 11053
223 Ga0105248_10014906 3300009177 Bacteria 8560
224 Ga0105248_10030352 3300009177 Bacteria 6035
225 Ga0105248_10086249 3300009177 Bacteria 3533
226 Ga0105248_10186255 3300009177 Unclassified 2339
227 Ga0105248_10298922 3300009177 Unclassified 1813
228 Ga0105248_10319874 3300009177 Unclassified 1748
229 Ga0105248_10438998 3300009177 Bacteria 1470
230 Ga0105248_10539385 3300009177 Unclassified 1316
231 Ga0105248_10688492 3300009177 Bacteria 1153
232 Ga0105237_10159854 3300009545 Bacteria 2251
233 Ga0105249_10004224 3300009553 Bacteria 12417
234 Ga0105249_10062519 3300009553 Bacteria 3418
235 Ga0105249_10223362 3300009553 Bacteria 1854
236 Ga0105249_10443827 3300009553 Unclassified 1335
237 Ga0105249_10586215 3300009553 Bacteria 1168
238 Ga0105249_10734816 3300009553 Unclassified 1049
239 Ga0105249_11030283 3300009553 Bacteria 892
240 Ga0105239_10102512 3300010375 Bacteria 3167
241 Ga0157370_10564069 3300013104 Bacteria 1043
242 Ga0157374_10943993 3300013296 Bacteria 881
243 Ga0157378_10453023 3300013297 Bacteria 1274
244 Ga0157378_11412493 3300013297 Unclassified 739
245 Ga0157375_10027120 3300013308 Bacteria 5350
246 Ga0157375_10838687 3300013308 Bacteria 1066
247 Ga0163163_10000025 3300014325 Bacteria 182686
248 Ga0157380_10093652 3300014326 Bacteria 2484
249 Ga0157380_10153899 3300014326 Unclassified 1991
250 Ga0157380_10160535 3300014326 Unclassified 1953
251 Ga0157380_10442189 3300014326 Bacteria 1246
252 Ga0157380_10737206 3300014326 Bacteria 995
253 Ga0157377_10055872 3300014745 Bacteria 2240
254 Ga0157377_10461372 3300014745 Bacteria 879
255 Ga0157379_10030371 3300014968 Unclassified 4809
256 Ga0157379_10100418 3300014968 Unclassified 2597
257 Ga0157379_10757236 3300014968 Bacteria 915
258 Ga0157379_10790390 3300014968 Unclassified 895
259 Ga0157376_10039285 3300014969 Bacteria 3858
260 Ga0157376_10044128 3300014969 Bacteria 3663
261 Ga0157376_10400611 3300014969 Bacteria 1327
262 Ga0157376_10502547 3300014969 Bacteria 1192
263 Ga0163161_10436647 3300017792 Bacteria 1056
264 Ga0207697_10008668 3300025315 Bacteria 4434
265 Ga0207697_10105570 3300025315 Bacteria 1203
266 Ga0207642_10048016 3300025899 Bacteria 1911
267 Ga0207642_10155175 3300025899 Bacteria 1223
268 Ga0207688_10195229 3300025901 Bacteria 1212
269 Ga0207680_10025934 3300025903 Bacteria 3240
270 Ga0207680_10261071 3300025903 Bacteria 1199
271 Ga0207680_10657948 3300025903 Bacteria 750
272 Ga0207685_10030700 3300025905 Unclassified 1916
273 Ga0207645_10004657 3300025907 Bacteria 10105
274 Ga0207645_10014101 3300025907 Bacteria 5356
275 Ga0207645_10027370 3300025907 Bacteria 3682
276 Ga0207707_10433331 3300025912 Bacteria 1126
277 Ga0207662_10002451 3300025918 Bacteria 9301
278 Ga0207662_10055802 3300025918 Unclassified 2358
279 Ga0207649_10185604 3300025920 Bacteria 1459
280 Ga0207649_10416961 3300025920 Bacteria 1008
281 Ga0207681_10082691 3300025923 Bacteria 2270
282 Ga0207681_10293450 3300025923 Unclassified 1284
283 Ga0207687_10056528 3300025927 Bacteria 2753
284 Ga0207687_10057149 3300025927 Unclassified 2740
285 Ga0207644_10004228 3300025931 Bacteria 9319
286 Ga0207644_10389138 3300025931 Bacteria 1138
287 Ga0207644_10764247 3300025931 Bacteria 808
288 Ga0207706_10093754 3300025933 Unclassified 2640
289 Ga0207706_10121688 3300025933 Unclassified 2295
290 Ga0207706_10365115 3300025933 Bacteria 1254
291 Ga0207686_10083856 3300025934 Bacteria 2087
292 Ga0207686_10086378 3300025934 Bacteria 2060
293 Ga0207686_10103346 3300025934 Unclassified 1906
294 Ga0207686_10170450 3300025934 Unclassified 1534
295 Ga0207686_10324460 3300025934 Bacteria 1151
296 Ga0207709_10107587 3300025935 Bacteria 1857
297 Ga0207670_10051533 3300025936 Unclassified 2764
298 Ga0207670_10074957 3300025936 Bacteria 2350
299 Ga0207670_10399439 3300025936 Unclassified 1098
300 Ga0207669_10035382 3300025937 Bacteria 2841
301 Ga0207669_10452996 3300025937 Bacteria 1017
302 Ga0207704_10011067 3300025938 Bacteria 4426
303 Ga0207704_10058936 3300025938 Bacteria 2367
304 Ga0207704_10114350 3300025938 Unclassified 1832
305 Ga0207704_10117190 3300025938 Bacteria 1814
306 Ga0207691_10011113 3300025940 Bacteria 8642
307 Ga0207691_10025367 3300025940 Bacteria 5567
308 Ga0207691_10378288 3300025940 Bacteria 1209
309 Ga0207711_10051201 3300025941 Bacteria 3536
310 Ga0207711_10052186 3300025941 Bacteria 3504
311 Ga0207711_10089484 3300025941 Unclassified 2705
312 Ga0207711_10179318 3300025941 Unclassified 1925
313 Ga0207711_10230611 3300025941 Unclassified 1696
314 Ga0207711_10466694 3300025941 Bacteria 1176
315 Ga0207711_10842554 3300025941 Bacteria 853
316 Ga0207689_10052829 3300025942 Bacteria 3348
317 Ga0207679_10002789 3300025945 Bacteria 10820
318 Ga0207651_10001960 3300025960 Bacteria 9678
319 Ga0207651_10103786 3300025960 Bacteria 2116
320 Ga0207651_10159153 3300025960 Bacteria 1768
321 Ga0207651_10307457 3300025960 Bacteria 1321
322 Ga0207651_10332366 3300025960 Unclassified 1274
323 Ga0207712_10018045 3300025961 Bacteria 4591
324 Ga0207712_10568387 3300025961 Bacteria 977
325 Ga0207712_10787245 3300025961 Bacteria 835
326 Ga0207668_10046419 3300025972 Bacteria 2968
327 Ga0207658_10042563 3300025986 Bacteria 3296
328 Ga0207658_10056019 3300025986 Bacteria 2924
329 Ga0207677_10063699 3300026023 Bacteria 2564
330 Ga0207677_10320662 3300026023 Bacteria 1287
331 Ga0207703_10159240 3300026035 Unclassified 1976
332 Ga0207703_10226652 3300026035 Bacteria 1673
333 Ga0207703_10547810 3300026035 Unclassified 1090
334 Ga0207678_10151577 3300026067 Bacteria 1980
335 Ga0207678_10303273 3300026067 Unclassified 1373
336 Ga0207678_10344769 3300026067 Bacteria 1284
337 Ga0207708_10000437 3300026075 Bacteria 32494
338 Ga0207708_10017803 3300026075 Bacteria 5347
339 Ga0207708_10283732 3300026075 Bacteria 1342
340 Ga0207708_10608230 3300026075 Unclassified 927
341 Ga0207641_10002253 3300026088 Bacteria 17995
342 Ga0207648_10009049 3300026089 Bacteria 9579
343 Ga0207648_10031637 3300026089 Bacteria 4678
344 Ga0207648_10438375 3300026089 Unclassified 1188
345 Ga0207648_11180724 3300026089 Bacteria 719
346 Ga0207676_11269652 3300026095 Unclassified 731
347 Ga0207675_100001535 3300026118 Bacteria 23144
348 Ga0207675_100035740 3300026118 Bacteria 4634
349 Ga0207675_100078208 3300026118 Unclassified 3099
350 Ga0207683_10157692 3300026121 Bacteria 2050
351 Ga0207698_10093503 3300026142 Bacteria 2469
352 Ga0207428_10000985 3300027907 Bacteria 31530
353 Ga0207428_10016753 3300027907 Bacteria 6302
354 Ga0207428_10082411 3300027907 Bacteria 2510
355 Ga0268266_10006086 3300028379 Bacteria 11114
356 Ga0268266_11105666 3300028379 Bacteria 767
357 Ga0268265_10048105 3300028380 Bacteria 3200
358 Ga0268265_10163193 3300028380 Bacteria 1895
359 Ga0268265_10180659 3300028380 Bacteria 1812
360 Ga0268265_10939890 3300028380 Bacteria 851
361 Ga0268264_10070599 3300028381 Unclassified 2957
362 Ga0268264_10195614 3300028381 Unclassified 1846
363 Ga0307408_100002960 3300031548 Bacteria 11774
364 Ga0307408_100007702 3300031548 Bacteria 7125
365 Ga0307408_100074701 3300031548 Bacteria 2516
366 Ga0307405_10042186 3300031731 Unclassified 2776
367 Ga0307413_10048156 3300031824 Bacteria 2546
368 Ga0307406_10015839 3300031901 Bacteria 4371
369 Ga0307407_10394987 3300031903 Bacteria 991
370 Ga0307412_10037028 3300031911 Bacteria 3131
371 Ga0307412_10194046 3300031911 Bacteria 1537
372 Ga0307409_100355843 3300031995 Bacteria 1383
373 Ga0307409_100562053 3300031995 Unclassified 1122
374 Ga0307416_100046885 3300032002 Bacteria 3415
375 Ga0307416_100812392 3300032002 Unclassified 1031
376 Ga0307411_10011191 3300032005 Bacteria 4828
377 Ga0307411_10169281 3300032005 Bacteria 1646
378 Ga0307415_100311779 3300032126 Unclassified 1308
379 Ga0373934_0002020 3300035086 Bacteria 7457
380 Ga0373944_0054706 3300035089 Bacteria 1266
381 Ga0373939_0122962 3300035114 Bacteria 918
382 Ga0373956_0003145 3300035119 Bacteria 6676
383 Ga0373956_0053040 3300035119 Bacteria 1825
384 Ga0373957_0016045 3300035120 Bacteria 2588
385 Ga0373943_0284916 3300035170 Viruses 935
386 Ga0373943_0290172 3300035170 Unclassified 927
387 Ga0373955_0001206 3300035172 Bacteria 10992
388 Ga0373955_0461782 3300035172 Bacteria 774
389 Ga0373942_0102174 3300035207 Bacteria 877
390 Ga0373962_0026053 3300035242 Bacteria 1574
391 Ga0373924_0135223 3300035410 Bacteria 1074
392 Ga0373931_0126900 3300035691 Bacteria 1464
393 Ga0373937_0011384 3300036401 Bacteria 7805
394 Ga0373937_0120987 3300036401 Bacteria 2439
395 Ga0373937_0261246 3300036401 Bacteria 1633
396 Ga0373925_0526825 3300037068 Unclassified 971
397 Ga0373925_0761737 3300037068 Bacteria 798
398 Ga0395898_0490368 3300037466 Unclassified 1169
399 Ga0451853_3294492 3300041512 Unclassified 781
400 Ga0439450_000552 3300042008 Bacteria 4910
401 Ga0439435_0025987 3300042436 Bacteria 1556
402 Ga0439435_0036910 3300042436 Bacteria 1352
403 Ga0439435_0061635 3300042436 Bacteria 1094
404 Ga0439464_0001308 3300042439 Bacteria 5802
405 Ga0439460_0014500 3300042461 Bacteria 2073
406 Ga0450916_031316 3300042530 Bacteria 776
407 Ga0439440_0066219 3300042993 Unclassified 932
408 Ga0451576_0143527 3300045051 Bacteria 2489
409 Ga0451576_0279944 3300045051 Bacteria 1744
410 Ga0495592_0102906 3300046454 Bacteria 2033
411 Ga0495603_0096840 3300046455 Unclassified 1724
412 Ga0495651_0016618 3300046462 Bacteria 5699
413 Ga0495651_0279655 3300046462 Unclassified 1128
414 Ga0495594_0185334 3300046499 Bacteria 1185
415 Ga0495618_0498362 3300046514 Bacteria 734
416 Ga0495628_0301510 3300046516 Bacteria 1186
417 Ga0495652_0161421 3300046529 Bacteria 1739
418 Ga0495640_0145856 3300046533 Bacteria 1523
419 Ga0495587_0076980 3300046536 Bacteria 1937
420 Ga0495587_0085213 3300046536 Unclassified 1830
421 Ga0495645_0060087 3300046543 Bacteria 2755
422 Ga0495667_0137614 3300046559 Unclassified 1574
423 Ga0495667_0301761 3300046559 Bacteria 1014
424 Ga0495634_0209491 3300046642 Unclassified 1207
425 Ga0495635_0067698 3300046663 Bacteria 2449
426 Ga0495599_0314049 3300046678 Bacteria 944
427 Ga0495623_0014988 3300046679 Bacteria 5010
428 Ga0495623_0063308 3300046679 Bacteria 2316
429 Ga0495647_0105647 3300046681 Bacteria 1170
430 Ga0495658_0362563 3300046683 Bacteria 922
431 Ga0495613_0202969 3300046689 Unclassified 1397
432 Ga0495600_0124336 3300046809 Bacteria 1678
433 Ga0495674_0718365 3300047319 Unclassified 783
434 Ga0495675_0015080 3300047444 Bacteria 4886
435 Ga0495684_0000351 3300047471 Bacteria 37160
436 Ga0495684_0017137 3300047471 Bacteria 5579
437 Ga0495684_0145119 3300047471 Bacteria 1778
438 Ga0495602_0008376 3300048088 Bacteria 10806
439 Ga0495602_0092324 3300048088 Bacteria 2508
440 Ga0496100_0002870 3300048903 Bacteria 8833
441 Ga0496101_0000290 3300048904 Bacteria 34975
442 Ga0496102_0028410 3300048905 Bacteria 4995
443 Ga0496102_0061895 3300048905 Bacteria 3427
444 Ga0496102_0937153 3300048905 Bacteria 787
445 Ga0496103_0116173 3300048906 Bacteria 1702
446 Ga0496104_0006926 3300048907 Bacteria 9999
447 Ga0496104_0011362 3300048907 Bacteria 7969
448 Ga0496104_0075772 3300048907 Unclassified 3203
449 Ga0496105_0016934 3300048908 Bacteria 5832
450 Ga0496105_0069848 3300048908 Bacteria 2903
451 Ga0496106_0009161 3300048909 Bacteria 7311
452 Ga0496106_0059644 3300048909 Bacteria 2891
453 Ga0496106_0198274 3300048909 Bacteria 1597
454 Ga0496107_0214671 3300048910 Bacteria 1431
455 Ga0496108_0027842 3300048911 Bacteria 4672
456 Ga0496109_0002983 3300048912 Bacteria 14136
457 Ga0496109_0099931 3300048912 Unclassified 2691
458 Ga0496110_0071520 3300048913 Unclassified 3076
459 Ga0496110_1079800 3300048913 Bacteria 711
460 Ga0496111_0020701 3300048914 Bacteria 4584
461 Ga0496111_0072761 3300048914 Unclassified 2502
462 Ga0496112_0001961 3300048915 Bacteria 16259
463 Ga0496112_0057604 3300048915 Bacteria 3826
464 Ga0496113_0096790 3300048916 Bacteria 2282
465 Ga0496114_0000359 3300048917 Bacteria 33466
466 Ga0496114_0060433 3300048917 Bacteria 3168
467 Ga0496114_0403741 3300048917 Bacteria 1210
468 Ga0501291_009751 3300049514 Unclassified 1352
469 Ga0501292_004293 3300049515 Bacteria 1944
470 Ga0501299_003820 3300049522 Bacteria 2209
471 Ga0501299_013337 3300049522 Bacteria 1416
472 Ga0501300_025987 3300049523 Unclassified 859
473 Ga0501302_006439 3300049525 Unclassified 762
474 Ga0501031_0013149 3300049568 Bacteria 5401
475 Ga0501037_0428459 3300049573 Unclassified 905
476 Ga0501038_0072745 3300049574 Bacteria 2913
477 Ga0501040_0161417 3300049576 Unclassified 1584
478 Ga0501048_0371194 3300049582 Unclassified 1021
479 Ga0501071_0098332 3300049587 Unclassified 2156
480 Ga0501071_0216837 3300049587 Bacteria 1440
481 Ga0501072_0034519 3300049588 Bacteria 3965
482 Ga0501074_0169684 3300049590 Unclassified 1558
483 Ga0501075_0218157 3300049591 Unclassified 1455
484 Ga0501075_0680565 3300049591 Bacteria 784
485 Ga0501202_025812 3300049652 Bacteria 1199
486 Ga0501216_061444 3300049660 Unclassified 759
487 Ga0501228_005373 3300049666 Unclassified 1134
488 Ga0501258_023981 3300049687 Bacteria 734
489 Ga0501081_0108791 3300049743 Bacteria 1966
490 Ga0501081_0280909 3300049743 Unclassified 1219
491 Ga0501279_016643 3300049775 Bacteria 1026
492 Ga0501045_0036310 3300049824 Bacteria 3578
493 nmdc:mga0yw44_352219_c1 3300050492 Bacteria 991
494 nmdc:mga05p37_148384_c1 3300050507 Bacteria 2870
495 nmdc:mga05p37_22542_c1 3300050507 Bacteria 7636
496 nmdc:mga05p37_43198_c1 3300050507 Bacteria 5543
497 nmdc:mga05p37_5476_c1 3300050507 Bacteria 14906
498 nmdc:mga05p37_722787_c1 3300050507 Unclassified 1102
499 nmdc:mga09592_29673_c1 3300050508 Bacteria 4547
500 nmdc:mga09592_4554_c1 3300050508 Bacteria 11216
501 nmdc:mga0qj67_2408_c1 3300050509 Bacteria 13322
502 nmdc:mga06r32_107992_c1 3300050510 Bacteria 2735
503 nmdc:mga06r32_1420_c1 3300050510 Bacteria 21603
504 nmdc:mga06r32_429871_c1 3300050510 Bacteria 1301
505 nmdc:mga06r32_4906_c1 3300050510 Bacteria 12053
506 nmdc:mga08y16_2756_c1 3300050511 Bacteria 18000
507 nmdc:mga08y16_29638_c1 3300050511 Bacteria 5763
508 nmdc:mga08y16_364464_c1 3300050511 Unclassified 1483
509 nmdc:mga08y16_37789_c1 3300050511 Bacteria 5069
510 nmdc:mga08y16_466798_c1 3300050511 Bacteria 1286
511 nmdc:mga08y16_8973_c1 3300050511 Bacteria 10503
512 nmdc:mga0n895_179202_c1 3300050512 Bacteria 2150
513 nmdc:mga0n895_20517_c1 3300050512 Bacteria 6165
514 nmdc:mga0n895_211613_c1 3300050512 Unclassified 1969
515 nmdc:mga0n895_369823_c1 3300050512 Bacteria 1451
516 nmdc:mga0n895_727367_c1 3300050512 Bacteria 987
517 nmdc:mga0n895_883703_c1 3300050512 Bacteria 880
518 nmdc:mga0rr50_19481_c1 3300050513 Bacteria 4582
519 nmdc:mga0rr50_204153_c1 3300050513 Bacteria 1626
520 nmdc:mga0rr50_437801_c1 3300050513 Bacteria 1107
521 nmdc:mga0rr50_703554_c1 3300050513 Bacteria 862
522 nmdc:mga08x19_177458_c1 3300050514 Unclassified 1453
523 nmdc:mga0a205_247655_c1 3300050515 Unclassified 1662
524 nmdc:mga0a205_44294_c1 3300050515 Unclassified 4289
525 nmdc:mga0a205_596132_c1 3300050515 Bacteria 958
526 nmdc:mga0a205_73565_c1 3300050515 Bacteria 3301
527 nmdc:mga0a205_758338_c1 3300050515 Bacteria 819
528 Ga0495601_0028066 3300053077 Bacteria 3484
529 Ga0495601_0264610 3300053077 Unclassified 1122
530 Ga0501084_0944733 3300054114 Unclassified 725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_11180724 Ga0207648_111807242 184
2 3300013104 Ga0157370_10564069 Ga0157370_105640691 189
3 3300006847 Ga0075431_100098062 Ga0075431_1000980622 191
4 3300009094 Ga0111539_10041566 Ga0111539_100415663 192
5 3300009148 Ga0105243_10012656 Ga0105243_100126564 192
6 3300009176 Ga0105242_10177808 Ga0105242_101778082 192
7 3300042436 Ga0439435_0061635 Ga0439435_0061635_149_739 192
8 3300050511 nmdc:mga08y16_8973_c1 nmdc:mga08y16_8973_c1_7522_8112 192
9 3300050515 nmdc:mga0a205_758338_c1 nmdc:mga0a205_758338_c1_159_749 192
10 3300050492 nmdc:mga0yw44_352219_c1 nmdc:mga0yw44_352219_c1_62_670 198
11 2162886011 MRS1b_contig_7604879 MRS1b_0714.00002130 199
12 3300031548 Ga0307408_100074701 Ga0307408_1000747011 199
13 3300031824 Ga0307413_10048156 Ga0307413_100481562 199
14 3300031903 Ga0307407_10394987 Ga0307407_103949871 199
15 3300031995 Ga0307409_100355843 Ga0307409_1003558432 199
16 3300046642 Ga0495634_0209491 Ga0495634_0209491_183_794 199
17 3300049687 Ga0501258_023981 Ga0501258_023981_56_667 199
18 3300050512 nmdc:mga0n895_883703_c1 nmdc:mga0n895_883703_c1_132_746 200
19 3300050515 nmdc:mga0a205_73565_c1 nmdc:mga0a205_73565_c1_665_1279 200
20 3300005364 Ga0070673_100363558 Ga0070673_1003635581 203
21 3300005333 Ga0070677_10476944 Ga0070677_104769441 204
22 3300005341 Ga0070691_10000290 Ga0070691_100002904 204
23 3300005353 Ga0070669_100005559 Ga0070669_1000055595 204
24 3300005354 Ga0070675_100713553 Ga0070675_1007135531 204
25 3300005438 Ga0070701_10002670 Ga0070701_100026704 204
26 3300005440 Ga0070705_100008956 Ga0070705_1000089562 204
27 3300005441 Ga0070700_100000383 Ga0070700_1000003836 204
28 3300005444 Ga0070694_100001320 Ga0070694_1000013203 204
29 3300005459 Ga0068867_100016814 Ga0068867_1000168144 204
30 3300005544 Ga0070686_100093918 Ga0070686_1000939181 204
31 3300005545 Ga0070695_100020122 Ga0070695_1000201222 204
32 3300005546 Ga0070696_100003529 Ga0070696_1000035294 204
33 3300005549 Ga0070704_100004714 Ga0070704_1000047144 204
34 3300005578 Ga0068854_100010252 Ga0068854_1000102523 204
35 3300005615 Ga0070702_100000083 Ga0070702_10000008317 204
36 3300005719 Ga0068861_100000910 Ga0068861_1000009104 204
37 3300005841 Ga0068863_100382895 Ga0068863_1003828952 204
38 3300005844 Ga0068862_100390324 Ga0068862_1003903242 204
39 3300006358 Ga0068871_100002602 Ga0068871_1000026023 204
40 3300006844 Ga0075428_100662196 Ga0075428_1006621962 204
41 3300006852 Ga0075433_10065001 Ga0075433_100650012 204
42 3300009094 Ga0111539_10001664 Ga0111539_1000166410 204
43 3300009176 Ga0105242_10017211 Ga0105242_100172113 204
44 3300013297 Ga0157378_10453023 Ga0157378_104530232 204
45 3300013308 Ga0157375_10838687 Ga0157375_108386872 204
46 3300025905 Ga0207685_10030700 Ga0207685_100307002 204
47 3300025907 Ga0207645_10004657 Ga0207645_100046574 204
48 3300025934 Ga0207686_10324460 Ga0207686_103244602 204
49 3300025935 Ga0207709_10107587 Ga0207709_101075872 204
50 3300026035 Ga0207703_10226652 Ga0207703_102266521 204
51 3300026075 Ga0207708_10000437 Ga0207708_1000043713 204
52 3300026089 Ga0207648_10031637 Ga0207648_100316372 204
53 3300026118 Ga0207675_100001535 Ga0207675_10000153510 204
54 3300027907 Ga0207428_10000985 Ga0207428_1000098510 204
55 3300027907 Ga0207428_10016753 Ga0207428_100167532 204
56 3300035119 Ga0373956_0053040 Ga0373956_0053040_649_1269 204
57 3300035172 Ga0373955_0461782 Ga0373955_0461782_122_742 204
58 3300037068 Ga0373925_0526825 Ga0373925_0526825_28_648 204
59 3300048903 Ga0496100_0002870 Ga0496100_0002870_3043_3663 204
60 3300048904 Ga0496101_0000290 Ga0496101_0000290_7629_8249 204
61 3300048905 Ga0496102_0061895 Ga0496102_0061895_587_1207 204
62 3300048907 Ga0496104_0011362 Ga0496104_0011362_2324_2944 204
63 3300048908 Ga0496105_0069848 Ga0496105_0069848_1531_2151 204
64 3300048909 Ga0496106_0198274 Ga0496106_0198274_587_1207 204
65 3300048917 Ga0496114_0000359 Ga0496114_0000359_18171_18791 204
66 3300050511 nmdc:mga08y16_2756_c1 nmdc:mga08y16_2756_c1_14058_14684 204
67 2162886011 MRS1b_contig_6792041 MRS1b_0141.00001950 205
68 2162886012 MBSR1b_contig_10852347 MBSR1b_0778.00006470 205
69 2162886012 MBSR1b_contig_11074376 MBSR1b_0403.00002100 205
70 3300004800 Ga0058861_10791624 Ga0058861_107916242 205
71 3300005290 Ga0065712_10000605 Ga0065712_100006052 205
72 3300005290 Ga0065712_10260229 Ga0065712_102602291 205
73 3300005293 Ga0065715_10014392 Ga0065715_100143922 205
74 3300005293 Ga0065715_10144202 Ga0065715_101442021 205
75 3300005293 Ga0065715_10190882 Ga0065715_101908823 205
76 3300005293 Ga0065715_10199920 Ga0065715_101999202 205
77 3300005293 Ga0065715_10424076 Ga0065715_104240761 205
78 3300005295 Ga0065707_10020564 Ga0065707_100205642 205
79 3300005328 Ga0070676_10045532 Ga0070676_100455322 205
80 3300005328 Ga0070676_10208697 Ga0070676_102086972 205
81 3300005328 Ga0070676_10487708 Ga0070676_104877081 205
82 3300005329 Ga0070683_100003660 Ga0070683_1000036603 205
83 3300005330 Ga0070690_100034912 Ga0070690_1000349122 205
84 3300005331 Ga0070670_101253149 Ga0070670_1012531491 205
85 3300005334 Ga0068869_100046029 Ga0068869_1000460293 205
86 3300005334 Ga0068869_100136191 Ga0068869_1001361913 205
87 3300005335 Ga0070666_10009961 Ga0070666_100099617 205
88 3300005335 Ga0070666_10685199 Ga0070666_106851991 205
89 3300005335 Ga0070666_10707905 Ga0070666_107079051 205
90 3300005337 Ga0070682_100168024 Ga0070682_1001680243 205
91 3300005339 Ga0070660_100367561 Ga0070660_1003675612 205
92 3300005340 Ga0070689_100029458 Ga0070689_1000294582 205
93 3300005340 Ga0070689_100140369 Ga0070689_1001403693 205
94 3300005344 Ga0070661_100096727 Ga0070661_1000967272 205
95 3300005347 Ga0070668_100076998 Ga0070668_1000769984 205
96 3300005347 Ga0070668_100097891 Ga0070668_1000978912 205
97 3300005347 Ga0070668_100178576 Ga0070668_1001785762 205
98 3300005353 Ga0070669_100018408 Ga0070669_1000184082 205
99 3300005353 Ga0070669_100039752 Ga0070669_1000397522 205
100 3300005353 Ga0070669_100081646 Ga0070669_1000816463 205
101 3300005353 Ga0070669_100096273 Ga0070669_1000962732 205
102 3300005353 Ga0070669_100121996 Ga0070669_1001219962 205
103 3300005354 Ga0070675_100169530 Ga0070675_1001695302 205
104 3300005355 Ga0070671_100003359 Ga0070671_1000033597 205
105 3300005355 Ga0070671_100143662 Ga0070671_1001436621 205
106 3300005356 Ga0070674_100009078 Ga0070674_1000090786 205
107 3300005356 Ga0070674_100017542 Ga0070674_1000175422 205
108 3300005356 Ga0070674_100018623 Ga0070674_1000186232 205
109 3300005356 Ga0070674_100036984 Ga0070674_1000369842 205
110 3300005356 Ga0070674_100477286 Ga0070674_1004772861 205
111 3300005364 Ga0070673_100005004 Ga0070673_1000050043 205
112 3300005364 Ga0070673_100066802 Ga0070673_1000668022 205
113 3300005364 Ga0070673_100182916 Ga0070673_1001829162 205
114 3300005364 Ga0070673_100585435 Ga0070673_1005854351 205
115 3300005365 Ga0070688_100128764 Ga0070688_1001287642 205
116 3300005365 Ga0070688_100744737 Ga0070688_1007447371 205
117 3300005366 Ga0070659_100095355 Ga0070659_1000953551 205
118 3300005366 Ga0070659_100102968 Ga0070659_1001029683 205
119 3300005367 Ga0070667_100048408 Ga0070667_1000484084 205
120 3300005367 Ga0070667_100090381 Ga0070667_1000903813 205
121 3300005367 Ga0070667_100647360 Ga0070667_1006473602 205
122 3300005406 Ga0070703_10071145 Ga0070703_100711451 205
123 3300005438 Ga0070701_10019396 Ga0070701_100193964 205
124 3300005440 Ga0070705_100244076 Ga0070705_1002440762 205
125 3300005441 Ga0070700_100254069 Ga0070700_1002540692 205
126 3300005441 Ga0070700_100480352 Ga0070700_1004803521 205
127 3300005444 Ga0070694_100095616 Ga0070694_1000956161 205
128 3300005445 Ga0070708_100465153 Ga0070708_1004651532 205
129 3300005455 Ga0070663_100175017 Ga0070663_1001750172 205
130 3300005455 Ga0070663_100255093 Ga0070663_1002550932 205
131 3300005455 Ga0070663_100753812 Ga0070663_1007538121 205
132 3300005456 Ga0070678_100089917 Ga0070678_1000899171 205
133 3300005457 Ga0070662_100073927 Ga0070662_1000739274 205
134 3300005458 Ga0070681_10501894 Ga0070681_105018941 205
135 3300005459 Ga0068867_100036462 Ga0068867_1000364622 205
136 3300005459 Ga0068867_100043804 Ga0068867_1000438042 205
137 3300005459 Ga0068867_100277042 Ga0068867_1002770422 205
138 3300005459 Ga0068867_100839910 Ga0068867_1008399101 205
139 3300005535 Ga0070684_100004122 Ga0070684_1000041224 205
140 3300005535 Ga0070684_100456504 Ga0070684_1004565042 205
141 3300005543 Ga0070672_100004805 Ga0070672_1000048057 205
142 3300005544 Ga0070686_100023526 Ga0070686_1000235264 205
143 3300005544 Ga0070686_100143309 Ga0070686_1001433092 205
144 3300005545 Ga0070695_100033455 Ga0070695_1000334553 205
145 3300005545 Ga0070695_100037646 Ga0070695_1000376463 205
146 3300005547 Ga0070693_100008382 Ga0070693_1000083826 205
147 3300005547 Ga0070693_100010937 Ga0070693_1000109373 205
148 3300005547 Ga0070693_100068592 Ga0070693_1000685923 205
149 3300005548 Ga0070665_100019581 Ga0070665_1000195812 205
150 3300005548 Ga0070665_100396254 Ga0070665_1003962542 205
151 3300005549 Ga0070704_100031227 Ga0070704_1000312273 205
152 3300005549 Ga0070704_100038691 Ga0070704_1000386912 205
153 3300005563 Ga0068855_100416342 Ga0068855_1004163422 205
154 3300005564 Ga0070664_100033339 Ga0070664_1000333393 205
155 3300005577 Ga0068857_100242682 Ga0068857_1002426822 205
156 3300005578 Ga0068854_100058649 Ga0068854_1000586494 205
157 3300005615 Ga0070702_100044768 Ga0070702_1000447683 205
158 3300005615 Ga0070702_100377920 Ga0070702_1003779202 205
159 3300005615 Ga0070702_100504382 Ga0070702_1005043821 205
160 3300005617 Ga0068859_100021906 Ga0068859_1000219064 205
161 3300005617 Ga0068859_100087614 Ga0068859_1000876143 205
162 3300005718 Ga0068866_10009288 Ga0068866_100092882 205
163 3300005718 Ga0068866_10025264 Ga0068866_100252643 205
164 3300005719 Ga0068861_100062330 Ga0068861_1000623302 205
165 3300005719 Ga0068861_100089558 Ga0068861_1000895582 205
166 3300005834 Ga0068851_10174417 Ga0068851_101744171 205
167 3300005841 Ga0068863_100003058 Ga0068863_1000030583 205
168 3300005841 Ga0068863_100060928 Ga0068863_1000609284 205
169 3300005841 Ga0068863_101304310 Ga0068863_1013043101 205
170 3300005842 Ga0068858_100054780 Ga0068858_1000547802 205
171 3300005842 Ga0068858_100151771 Ga0068858_1001517712 205
172 3300005842 Ga0068858_100302158 Ga0068858_1003021582 205
173 3300005843 Ga0068860_100149615 Ga0068860_1001496152 205
174 3300005843 Ga0068860_100160061 Ga0068860_1001600613 205
175 3300005843 Ga0068860_100231935 Ga0068860_1002319352 205
176 3300005843 Ga0068860_100298888 Ga0068860_1002988883 205
177 3300005844 Ga0068862_100119335 Ga0068862_1001193352 205
178 3300005844 Ga0068862_100176127 Ga0068862_1001761273 205
179 3300005844 Ga0068862_100358571 Ga0068862_1003585712 205
180 3300006038 Ga0075365_10402678 Ga0075365_104026781 205
181 3300006237 Ga0097621_100008632 Ga0097621_1000086325 205
182 3300006237 Ga0097621_100056717 Ga0097621_1000567172 205
183 3300006237 Ga0097621_100232803 Ga0097621_1002328032 205
184 3300006237 Ga0097621_100541954 Ga0097621_1005419542 205
185 3300006358 Ga0068871_100006540 Ga0068871_10000654010 205
186 3300006358 Ga0068871_100070051 Ga0068871_1000700514 205
187 3300006358 Ga0068871_100099710 Ga0068871_1000997102 205
188 3300006358 Ga0068871_100538731 Ga0068871_1005387312 205
189 3300006358 Ga0068871_100927568 Ga0068871_1009275681 205
190 3300006844 Ga0075428_100025217 Ga0075428_1000252175 205
191 3300006844 Ga0075428_100042717 Ga0075428_1000427175 205
192 3300006844 Ga0075428_100490386 Ga0075428_1004903862 205
193 3300006844 Ga0075428_100840923 Ga0075428_1008409232 205
194 3300006846 Ga0075430_100144333 Ga0075430_1001443333 205
195 3300006847 Ga0075431_100052128 Ga0075431_1000521282 205
196 3300006847 Ga0075431_100095620 Ga0075431_1000956204 205
197 3300006847 Ga0075431_100158716 Ga0075431_1001587163 205
198 3300006847 Ga0075431_100306574 Ga0075431_1003065743 205
199 3300006847 Ga0075431_100467139 Ga0075431_1004671392 205
200 3300006852 Ga0075433_10100752 Ga0075433_101007522 205
201 3300006852 Ga0075433_10111144 Ga0075433_101111443 205
202 3300006852 Ga0075433_10586807 Ga0075433_105868071 205
203 3300006871 Ga0075434_100061110 Ga0075434_1000611103 205
204 3300006871 Ga0075434_100131045 Ga0075434_1001310452 205
205 3300006871 Ga0075434_100337826 Ga0075434_1003378262 205
206 3300006880 Ga0075429_100002883 Ga0075429_10000288310 205
207 3300006880 Ga0075429_100022602 Ga0075429_1000226024 205
208 3300006880 Ga0075429_100038404 Ga0075429_1000384043 205
209 3300006880 Ga0075429_100289722 Ga0075429_1002897223 205
210 3300006881 Ga0068865_100010956 Ga0068865_1000109566 205
211 3300006881 Ga0068865_100307721 Ga0068865_1003077212 205
212 3300006881 Ga0068865_100623205 Ga0068865_1006232052 205
213 3300006914 Ga0075436_100371464 Ga0075436_1003714642 205
214 3300006931 Ga0097620_100021906 Ga0097620_1000219064 205
215 3300006931 Ga0097620_100087611 Ga0097620_1000876114 205
216 3300007076 Ga0075435_100005626 Ga0075435_1000056263 205
217 3300007076 Ga0075435_100011809 Ga0075435_1000118097 205
218 3300007076 Ga0075435_100155743 Ga0075435_1001557432 205
219 3300007076 Ga0075435_100653818 Ga0075435_1006538182 205
220 3300009011 Ga0105251_10063378 Ga0105251_100633783 205
221 3300009094 Ga0111539_10006629 Ga0111539_100066299 205
222 3300009094 Ga0111539_10038689 Ga0111539_100386894 205
223 3300009094 Ga0111539_10041435 Ga0111539_100414352 205
224 3300009094 Ga0111539_10070770 Ga0111539_100707702 205
225 3300009094 Ga0111539_11536617 Ga0111539_115366171 205
226 3300009098 Ga0105245_10081382 Ga0105245_100813824 205
227 3300009098 Ga0105245_10221922 Ga0105245_102219222 205
228 3300009098 Ga0105245_10585161 Ga0105245_105851612 205
229 3300009101 Ga0105247_10440268 Ga0105247_104402682 205
230 3300009147 Ga0114129_10003469 Ga0114129_1000346918 205
231 3300009147 Ga0114129_10012628 Ga0114129_100126282 205
232 3300009147 Ga0114129_10029264 Ga0114129_100292645 205
233 3300009147 Ga0114129_10218169 Ga0114129_102181692 205
234 3300009147 Ga0114129_10462937 Ga0114129_104629372 205
235 3300009147 Ga0114129_11216577 Ga0114129_112165771 205
236 3300009147 Ga0114129_11776734 Ga0114129_117767341 205
237 3300009148 Ga0105243_10015769 Ga0105243_100157694 205
238 3300009148 Ga0105243_10018166 Ga0105243_100181662 205
239 3300009174 Ga0105241_10174830 Ga0105241_101748302 205
240 3300009176 Ga0105242_10009583 Ga0105242_1000958310 205
241 3300009176 Ga0105242_10009773 Ga0105242_100097732 205
242 3300009176 Ga0105242_10030156 Ga0105242_100301562 205
243 3300009176 Ga0105242_10299834 Ga0105242_102998342 205
244 3300009176 Ga0105242_10437967 Ga0105242_104379672 205
245 3300009176 Ga0105242_10700626 Ga0105242_107006261 205
246 3300009177 Ga0105248_10006534 Ga0105248_100065349 205
247 3300009177 Ga0105248_10008866 Ga0105248_100088669 205
248 3300009177 Ga0105248_10014906 Ga0105248_100149064 205
249 3300009177 Ga0105248_10030352 Ga0105248_100303526 205
250 3300009177 Ga0105248_10086249 Ga0105248_100862492 205
251 3300009177 Ga0105248_10186255 Ga0105248_101862553 205
252 3300009177 Ga0105248_10298922 Ga0105248_102989222 205
253 3300009177 Ga0105248_10319874 Ga0105248_103198742 205
254 3300009177 Ga0105248_10539385 Ga0105248_105393852 205
255 3300009177 Ga0105248_10688492 Ga0105248_106884922 205
256 3300009545 Ga0105237_10159854 Ga0105237_101598541 205
257 3300009553 Ga0105249_10004224 Ga0105249_100042243 205
258 3300009553 Ga0105249_10062519 Ga0105249_100625194 205
259 3300009553 Ga0105249_10223362 Ga0105249_102233623 205
260 3300009553 Ga0105249_10586215 Ga0105249_105862151 205
261 3300009553 Ga0105249_10734816 Ga0105249_107348162 205
262 3300010375 Ga0105239_10102512 Ga0105239_101025122 205
263 3300013296 Ga0157374_10943993 Ga0157374_109439931 205
264 3300013297 Ga0157378_11412493 Ga0157378_114124931 205
265 3300013308 Ga0157375_10027120 Ga0157375_100271202 205
266 3300014325 Ga0163163_10000025 Ga0163163_10000025141 205
267 3300014326 Ga0157380_10093652 Ga0157380_100936522 205
268 3300014326 Ga0157380_10153899 Ga0157380_101538991 205
269 3300014326 Ga0157380_10160535 Ga0157380_101605352 205
270 3300014326 Ga0157380_10442189 Ga0157380_104421892 205
271 3300014326 Ga0157380_10737206 Ga0157380_107372061 205
272 3300014745 Ga0157377_10055872 Ga0157377_100558723 205
273 3300014745 Ga0157377_10461372 Ga0157377_104613721 205
274 3300014968 Ga0157379_10030371 Ga0157379_100303714 205
275 3300014968 Ga0157379_10100418 Ga0157379_101004184 205
276 3300014968 Ga0157379_10757236 Ga0157379_107572362 205
277 3300014968 Ga0157379_10790390 Ga0157379_107903901 205
278 3300014969 Ga0157376_10039285 Ga0157376_100392853 205
279 3300014969 Ga0157376_10044128 Ga0157376_100441282 205
280 3300014969 Ga0157376_10400611 Ga0157376_104006112 205
281 3300014969 Ga0157376_10502547 Ga0157376_105025472 205
282 3300017792 Ga0163161_10436647 Ga0163161_104366472 205
283 3300025315 Ga0207697_10008668 Ga0207697_100086683 205
284 3300025315 Ga0207697_10105570 Ga0207697_101055702 205
285 3300025899 Ga0207642_10048016 Ga0207642_100480162 205
286 3300025899 Ga0207642_10155175 Ga0207642_101551752 205
287 3300025901 Ga0207688_10195229 Ga0207688_101952292 205
288 3300025903 Ga0207680_10025934 Ga0207680_100259344 205
289 3300025903 Ga0207680_10261071 Ga0207680_102610712 205
290 3300025903 Ga0207680_10657948 Ga0207680_106579481 205
291 3300025907 Ga0207645_10014101 Ga0207645_100141012 205
292 3300025907 Ga0207645_10027370 Ga0207645_100273703 205
293 3300025912 Ga0207707_10433331 Ga0207707_104333312 205
294 3300025918 Ga0207662_10002451 Ga0207662_100024514 205
295 3300025918 Ga0207662_10055802 Ga0207662_100558023 205
296 3300025920 Ga0207649_10185604 Ga0207649_101856042 205
297 3300025920 Ga0207649_10416961 Ga0207649_104169612 205
298 3300025923 Ga0207681_10082691 Ga0207681_100826911 205
299 3300025923 Ga0207681_10293450 Ga0207681_102934502 205
300 3300025927 Ga0207687_10056528 Ga0207687_100565282 205
301 3300025927 Ga0207687_10057149 Ga0207687_100571494 205
302 3300025931 Ga0207644_10004228 Ga0207644_100042288 205
303 3300025931 Ga0207644_10389138 Ga0207644_103891382 205
304 3300025933 Ga0207706_10093754 Ga0207706_100937542 205
305 3300025933 Ga0207706_10365115 Ga0207706_103651151 205
306 3300025934 Ga0207686_10083856 Ga0207686_100838561 205
307 3300025934 Ga0207686_10086378 Ga0207686_100863782 205
308 3300025934 Ga0207686_10103346 Ga0207686_101033463 205
309 3300025934 Ga0207686_10170450 Ga0207686_101704503 205
310 3300025936 Ga0207670_10074957 Ga0207670_100749572 205
311 3300025936 Ga0207670_10399439 Ga0207670_103994392 205
312 3300025937 Ga0207669_10035382 Ga0207669_100353822 205
313 3300025937 Ga0207669_10452996 Ga0207669_104529961 205
314 3300025938 Ga0207704_10011067 Ga0207704_100110672 205
315 3300025938 Ga0207704_10058936 Ga0207704_100589363 205
316 3300025938 Ga0207704_10114350 Ga0207704_101143502 205
317 3300025938 Ga0207704_10117190 Ga0207704_101171903 205
318 3300025940 Ga0207691_10011113 Ga0207691_100111138 205
319 3300025940 Ga0207691_10025367 Ga0207691_100253674 205
320 3300025940 Ga0207691_10378288 Ga0207691_103782882 205
321 3300025941 Ga0207711_10051201 Ga0207711_100512013 205
322 3300025941 Ga0207711_10052186 Ga0207711_100521863 205
323 3300025941 Ga0207711_10089484 Ga0207711_100894842 205
324 3300025941 Ga0207711_10179318 Ga0207711_101793182 205
325 3300025941 Ga0207711_10230611 Ga0207711_102306112 205
326 3300025941 Ga0207711_10466694 Ga0207711_104666942 205
327 3300025941 Ga0207711_10842554 Ga0207711_108425542 205
328 3300025942 Ga0207689_10052829 Ga0207689_100528292 205
329 3300025945 Ga0207679_10002789 Ga0207679_100027895 205
330 3300025960 Ga0207651_10001960 Ga0207651_100019607 205
331 3300025960 Ga0207651_10103786 Ga0207651_101037862 205
332 3300025960 Ga0207651_10159153 Ga0207651_101591532 205
333 3300025960 Ga0207651_10307457 Ga0207651_103074571 205
334 3300025960 Ga0207651_10332366 Ga0207651_103323662 205
335 3300025961 Ga0207712_10018045 Ga0207712_100180455 205
336 3300025961 Ga0207712_10568387 Ga0207712_105683871 205
337 3300025961 Ga0207712_10787245 Ga0207712_107872451 205
338 3300025972 Ga0207668_10046419 Ga0207668_100464192 205
339 3300025986 Ga0207658_10042563 Ga0207658_100425633 205
340 3300025986 Ga0207658_10056019 Ga0207658_100560193 205
341 3300026023 Ga0207677_10063699 Ga0207677_100636992 205
342 3300026023 Ga0207677_10320662 Ga0207677_103206622 205
343 3300026035 Ga0207703_10159240 Ga0207703_101592401 205
344 3300026035 Ga0207703_10547810 Ga0207703_105478102 205
345 3300026067 Ga0207678_10151577 Ga0207678_101515773 205
346 3300026067 Ga0207678_10303273 Ga0207678_103032732 205
347 3300026067 Ga0207678_10344769 Ga0207678_103447691 205
348 3300026075 Ga0207708_10017803 Ga0207708_100178034 205
349 3300026075 Ga0207708_10283732 Ga0207708_102837321 205
350 3300026075 Ga0207708_10608230 Ga0207708_106082302 205
351 3300026088 Ga0207641_10002253 Ga0207641_100022533 205
352 3300026089 Ga0207648_10009049 Ga0207648_100090499 205
353 3300026089 Ga0207648_10438375 Ga0207648_104383752 205
354 3300026095 Ga0207676_11269652 Ga0207676_112696521 205
355 3300026118 Ga0207675_100035740 Ga0207675_1000357404 205
356 3300026118 Ga0207675_100078208 Ga0207675_1000782082 205
357 3300026121 Ga0207683_10157692 Ga0207683_101576922 205
358 3300026142 Ga0207698_10093503 Ga0207698_100935032 205
359 3300027907 Ga0207428_10082411 Ga0207428_100824112 205
360 3300028379 Ga0268266_10006086 Ga0268266_100060864 205
361 3300028379 Ga0268266_11105666 Ga0268266_111056661 205
362 3300028380 Ga0268265_10048105 Ga0268265_100481052 205
363 3300028380 Ga0268265_10163193 Ga0268265_101631933 205
364 3300028380 Ga0268265_10180659 Ga0268265_101806591 205
365 3300028380 Ga0268265_10939890 Ga0268265_109398902 205
366 3300028381 Ga0268264_10070599 Ga0268264_100705992 205
367 3300028381 Ga0268264_10195614 Ga0268264_101956141 205
368 3300031548 Ga0307408_100002960 Ga0307408_1000029609 205
369 3300031548 Ga0307408_100007702 Ga0307408_1000077021 205
370 3300031731 Ga0307405_10042186 Ga0307405_100421863 205
371 3300031901 Ga0307406_10015839 Ga0307406_100158395 205
372 3300031911 Ga0307412_10037028 Ga0307412_100370283 205
373 3300031911 Ga0307412_10194046 Ga0307412_101940462 205
374 3300031995 Ga0307409_100562053 Ga0307409_1005620532 205
375 3300032002 Ga0307416_100046885 Ga0307416_1000468854 205
376 3300032002 Ga0307416_100812392 Ga0307416_1008123922 205
377 3300032005 Ga0307411_10011191 Ga0307411_100111913 205
378 3300032005 Ga0307411_10169281 Ga0307411_101692812 205
379 3300032126 Ga0307415_100311779 Ga0307415_1003117791 205
380 3300035086 Ga0373934_0002020 Ga0373934_0002020_2294_2923 205
381 3300035089 Ga0373944_0054706 Ga0373944_0054706_541_1173 205
382 3300035114 Ga0373939_0122962 Ga0373939_0122962_203_835 205
383 3300035119 Ga0373956_0003145 Ga0373956_0003145_2145_2774 205
384 3300035120 Ga0373957_0016045 Ga0373957_0016045_1540_2169 205
385 3300035170 Ga0373943_0290172 Ga0373943_0290172_18_650 205
386 3300035172 Ga0373955_0001206 Ga0373955_0001206_4601_5230 205
387 3300035207 Ga0373942_0102174 Ga0373942_0102174_58_690 205
388 3300035242 Ga0373962_0026053 Ga0373962_0026053_492_1130 205
389 3300035410 Ga0373924_0135223 Ga0373924_0135223_17_646 205
390 3300035691 Ga0373931_0126900 Ga0373931_0126900_580_1212 205
391 3300036401 Ga0373937_0011384 Ga0373937_0011384_2535_3164 205
392 3300036401 Ga0373937_0261246 Ga0373937_0261246_741_1379 205
393 3300037068 Ga0373925_0761737 Ga0373925_0761737_34_666 205
394 3300037466 Ga0395898_0490368 Ga0395898_0490368_256_885 205
395 3300041512 Ga0451853_3294492 Ga0451853_3294492_24_653 205
396 3300042008 Ga0439450_000552 Ga0439450_000552_1202_1831 205
397 3300042436 Ga0439435_0025987 Ga0439435_0025987_316_951 205
398 3300042436 Ga0439435_0036910 Ga0439435_0036910_101_730 205
399 3300042439 Ga0439464_0001308 Ga0439464_0001308_215_844 205
400 3300042461 Ga0439460_0014500 Ga0439460_0014500_1227_1862 205
401 3300042530 Ga0450916_031316 Ga0450916_031316_47_676 205
402 3300042993 Ga0439440_0066219 Ga0439440_0066219_189_818 205
403 3300045051 Ga0451576_0143527 Ga0451576_0143527_287_925 205
404 3300045051 Ga0451576_0279944 Ga0451576_0279944_855_1484 205
405 3300046455 Ga0495603_0096840 Ga0495603_0096840_281_913 205
406 3300046499 Ga0495594_0185334 Ga0495594_0185334_111_740 205
407 3300046516 Ga0495628_0301510 Ga0495628_0301510_245_874 205
408 3300046533 Ga0495640_0145856 Ga0495640_0145856_22_651 205
409 3300046536 Ga0495587_0085213 Ga0495587_0085213_605_1234 205
410 3300046543 Ga0495645_0060087 Ga0495645_0060087_1532_2161 205
411 3300046663 Ga0495635_0067698 Ga0495635_0067698_717_1346 205
412 3300046678 Ga0495599_0314049 Ga0495599_0314049_95_724 205
413 3300046681 Ga0495647_0105647 Ga0495647_0105647_170_802 205
414 3300046683 Ga0495658_0362563 Ga0495658_0362563_58_690 205
415 3300046809 Ga0495600_0124336 Ga0495600_0124336_46_675 205
416 3300047471 Ga0495684_0145119 Ga0495684_0145119_899_1528 205
417 3300048905 Ga0496102_0028410 Ga0496102_0028410_2127_2759 205
418 3300048905 Ga0496102_0937153 Ga0496102_0937153_104_736 205
419 3300048906 Ga0496103_0116173 Ga0496103_0116173_883_1515 205
420 3300048907 Ga0496104_0006926 Ga0496104_0006926_6430_7062 205
421 3300048907 Ga0496104_0075772 Ga0496104_0075772_631_1260 205
422 3300048908 Ga0496105_0016934 Ga0496105_0016934_4653_5285 205
423 3300048909 Ga0496106_0009161 Ga0496106_0009161_4628_5260 205
424 3300048909 Ga0496106_0059644 Ga0496106_0059644_1737_2369 205
425 3300048910 Ga0496107_0214671 Ga0496107_0214671_256_888 205
426 3300048911 Ga0496108_0027842 Ga0496108_0027842_2289_2921 205
427 3300048912 Ga0496109_0002983 Ga0496109_0002983_4974_5606 205
428 3300048912 Ga0496109_0099931 Ga0496109_0099931_405_1034 205
429 3300048913 Ga0496110_0071520 Ga0496110_0071520_1895_2527 205
430 3300048913 Ga0496110_1079800 Ga0496110_1079800_28_660 205
431 3300048914 Ga0496111_0020701 Ga0496111_0020701_2520_3152 205
432 3300048914 Ga0496111_0072761 Ga0496111_0072761_1627_2256 205
433 3300048915 Ga0496112_0001961 Ga0496112_0001961_9209_9838 205
434 3300048915 Ga0496112_0057604 Ga0496112_0057604_3089_3718 205
435 3300048916 Ga0496113_0096790 Ga0496113_0096790_1637_2269 205
436 3300048917 Ga0496114_0060433 Ga0496114_0060433_2102_2731 205
437 3300048917 Ga0496114_0403741 Ga0496114_0403741_488_1120 205
438 3300049514 Ga0501291_009751 Ga0501291_009751_592_1221 205
439 3300049515 Ga0501292_004293 Ga0501292_004293_1095_1724 205
440 3300049522 Ga0501299_003820 Ga0501299_003820_677_1306 205
441 3300049522 Ga0501299_013337 Ga0501299_013337_349_978 205
442 3300049523 Ga0501300_025987 Ga0501300_025987_74_703 205
443 3300049525 Ga0501302_006439 Ga0501302_006439_16_645 205
444 3300049568 Ga0501031_0013149 Ga0501031_0013149_4757_5383 205
445 3300049573 Ga0501037_0428459 Ga0501037_0428459_165_791 205
446 3300049574 Ga0501038_0072745 Ga0501038_0072745_464_1090 205
447 3300049576 Ga0501040_0161417 Ga0501040_0161417_625_1251 205
448 3300049582 Ga0501048_0371194 Ga0501048_0371194_91_780 205
449 3300049587 Ga0501071_0098332 Ga0501071_0098332_905_1531 205
450 3300049587 Ga0501071_0216837 Ga0501071_0216837_577_1206 205
451 3300049588 Ga0501072_0034519 Ga0501072_0034519_1446_2072 205
452 3300049590 Ga0501074_0169684 Ga0501074_0169684_763_1389 205
453 3300049591 Ga0501075_0218157 Ga0501075_0218157_717_1343 205
454 3300049591 Ga0501075_0680565 Ga0501075_0680565_29_658 205
455 3300049652 Ga0501202_025812 Ga0501202_025812_460_1089 205
456 3300049660 Ga0501216_061444 Ga0501216_061444_101_730 205
457 3300049666 Ga0501228_005373 Ga0501228_005373_124_753 205
458 3300049743 Ga0501081_0108791 Ga0501081_0108791_204_830 205
459 3300049743 Ga0501081_0280909 Ga0501081_0280909_477_1205 205
460 3300049775 Ga0501279_016643 Ga0501279_016643_241_870 205
461 3300049824 Ga0501045_0036310 Ga0501045_0036310_82_708 205
462 3300050507 nmdc:mga05p37_148384_c1 nmdc:mga05p37_148384_c1_598_1230 205
463 3300050507 nmdc:mga05p37_22542_c1 nmdc:mga05p37_22542_c1_6780_7412 205
464 3300050507 nmdc:mga05p37_43198_c1 nmdc:mga05p37_43198_c1_4660_5292 205
465 3300050507 nmdc:mga05p37_5476_c1 nmdc:mga05p37_5476_c1_12290_12919 205
466 3300050507 nmdc:mga05p37_722787_c1 nmdc:mga05p37_722787_c1_168_800 205
467 3300050508 nmdc:mga09592_29673_c1 nmdc:mga09592_29673_c1_1872_2507 205
468 3300050508 nmdc:mga09592_4554_c1 nmdc:mga09592_4554_c1_9007_9636 205
469 3300050509 nmdc:mga0qj67_2408_c1 nmdc:mga0qj67_2408_c1_10339_10974 205
470 3300050510 nmdc:mga06r32_107992_c1 nmdc:mga06r32_107992_c1_945_1574 205
471 3300050510 nmdc:mga06r32_1420_c1 nmdc:mga06r32_1420_c1_13490_14119 205
472 3300050510 nmdc:mga06r32_429871_c1 nmdc:mga06r32_429871_c1_374_1003 205
473 3300050510 nmdc:mga06r32_4906_c1 nmdc:mga06r32_4906_c1_11268_11903 205
474 3300050511 nmdc:mga08y16_29638_c1 nmdc:mga08y16_29638_c1_2131_2763 205
475 3300050511 nmdc:mga08y16_364464_c1 nmdc:mga08y16_364464_c1_638_1267 205
476 3300050511 nmdc:mga08y16_37789_c1 nmdc:mga08y16_37789_c1_960_1592 205
477 3300050511 nmdc:mga08y16_466798_c1 nmdc:mga08y16_466798_c1_230_859 205
478 3300050512 nmdc:mga0n895_179202_c1 nmdc:mga0n895_179202_c1_182_814 205
479 3300050512 nmdc:mga0n895_20517_c1 nmdc:mga0n895_20517_c1_63_695 205
480 3300050512 nmdc:mga0n895_211613_c1 nmdc:mga0n895_211613_c1_783_1415 205
481 3300050512 nmdc:mga0n895_369823_c1 nmdc:mga0n895_369823_c1_264_896 205
482 3300050512 nmdc:mga0n895_727367_c1 nmdc:mga0n895_727367_c1_341_973 205
483 3300050513 nmdc:mga0rr50_19481_c1 nmdc:mga0rr50_19481_c1_1648_2280 205
484 3300050513 nmdc:mga0rr50_204153_c1 nmdc:mga0rr50_204153_c1_251_883 205
485 3300050513 nmdc:mga0rr50_437801_c1 nmdc:mga0rr50_437801_c1_391_1020 205
486 3300050513 nmdc:mga0rr50_703554_c1 nmdc:mga0rr50_703554_c1_64_693 205
487 3300050514 nmdc:mga08x19_177458_c1 nmdc:mga08x19_177458_c1_624_1256 205
488 3300050515 nmdc:mga0a205_247655_c1 nmdc:mga0a205_247655_c1_769_1401 205
489 3300050515 nmdc:mga0a205_44294_c1 nmdc:mga0a205_44294_c1_1327_1959 205
490 3300050515 nmdc:mga0a205_596132_c1 nmdc:mga0a205_596132_c1_138_791 205
491 3300053077 Ga0495601_0028066 Ga0495601_0028066_1821_2450 205
492 3300053077 Ga0495601_0264610 Ga0495601_0264610_33_671 205
493 3300054114 Ga0501084_0944733 Ga0501084_0944733_63_692 205
494 3300005293 Ga0065715_10597132 Ga0065715_105971321 206
495 3300025933 Ga0207706_10121688 Ga0207706_101216882 206
496 3300047319 Ga0495674_0718365 Ga0495674_0718365_15_641 206
497 3300009177 Ga0105248_10438998 Ga0105248_104389982 207
498 3300035170 Ga0373943_0284916 Ga0373943_0284916_126_749 207
499 3300005355 Ga0070671_100424287 Ga0070671_1004242871 208
500 3300025931 Ga0207644_10764247 Ga0207644_107642471 208
501 3300036401 Ga0373937_0120987 Ga0373937_0120987_332_967 210
502 3300046454 Ga0495592_0102906 Ga0495592_0102906_1272_1907 210
503 3300046462 Ga0495651_0016618 Ga0495651_0016618_180_815 210
504 3300046514 Ga0495618_0498362 Ga0495618_0498362_76_711 210
505 3300046536 Ga0495587_0076980 Ga0495587_0076980_120_755 210
506 3300046559 Ga0495667_0301761 Ga0495667_0301761_285_920 210
507 3300046679 Ga0495623_0014988 Ga0495623_0014988_57_692 210
508 3300047444 Ga0495675_0015080 Ga0495675_0015080_115_750 210
509 3300047471 Ga0495684_0000351 Ga0495684_0000351_91_726 210
510 3300048088 Ga0495602_0008376 Ga0495602_0008376_10002_10637 210
511 3300006844 Ga0075428_100239581 Ga0075428_1002395812 211
512 3300009553 Ga0105249_10443827 Ga0105249_104438272 211
513 3300046462 Ga0495651_0279655 Ga0495651_0279655_305_946 211
514 3300046529 Ga0495652_0161421 Ga0495652_0161421_406_1047 211
515 3300046559 Ga0495667_0137614 Ga0495667_0137614_346_987 211
516 3300046679 Ga0495623_0063308 Ga0495623_0063308_815_1456 211
517 3300046689 Ga0495613_0202969 Ga0495613_0202969_51_692 211
518 3300047471 Ga0495684_0017137 Ga0495684_0017137_834_1475 211
519 3300048088 Ga0495602_0092324 Ga0495602_0092324_879_1520 211
520 2162886007 SwRhRL2b_contig_1373379 SwRhRL2b_0575.00002160 212
521 3300005289 Ga0065704_10084830 Ga0065704_100848303 212
522 3300005295 Ga0065707_10113165 Ga0065707_101131654 212
523 3300005340 Ga0070689_100009451 Ga0070689_1000094512 212
524 3300005365 Ga0070688_100013809 Ga0070688_1000138094 212
525 3300005367 Ga0070667_100623749 Ga0070667_1006237492 212
526 3300005842 Ga0068858_101062702 Ga0068858_1010627021 212
527 3300005844 Ga0068862_100514191 Ga0068862_1005141911 212
528 3300006844 Ga0075428_100080253 Ga0075428_1000802533 212
529 3300009553 Ga0105249_11030283 Ga0105249_110302831 212
530 3300025936 Ga0207670_10051533 Ga0207670_100515332 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

38

148

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

180

236

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

180

224

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9811 149 212
6jqs-assembly1.cif.gz_A structure of transcription factor, gere 0.9729 148 211
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9637 150 204
1fse-assembly1.cif.gz_A crystal structure of the bacillus subtilis regulatory protein gere 0.9559 152 212
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9541 3 118
ID Description Score Start End Superfamily
1fseC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9811 149 212 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9785 148 204 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9783 150 208 1.10.10.10
af_P07026_177_240_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9742 150 208 1.10.10.10
6jqsA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9729 148 211 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A532E981-F1-model_v4 Response regulator transcription factor 0.9804 1 138 GO:0000160
GO:0003677
AF-A0A2V9XY68-F1-model_v4 Response regulatory domain-containing protein 0.9797 3 129 GO:0000160
AF-A0A2V9XTX2-F1-model_v4 Response regulatory domain-containing protein 0.9796 2 129 GO:0000160
AF-A0A2V8SNV1-F1-model_v4 Response regulatory domain-containing protein 0.9791 3 129 GO:0000160
GO:0003677
AF-A0A1F2T8S5-F1-model_v4 Response regulatory domain-containing protein 0.9778 1 129 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
89.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map