F460028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 239 | 530 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300049743|Ga0501081_0280909|Ga0501081_0280909_477_1205 |
| Length | 242 |
| Sequence | VRTPPLAIIDTVRTVELGGIARIPADGLEYFGMGKPRVLLADDHTLLLGAFEKLLAEECEIVGQVSDGRALVAAAEDLTPDLIVLDISMPLLNGLEAGRQIKQKLRNVKLVFLTMNEDADLAAEAFRSGASGYLLKRSASSELATAIREVMQGRSYVTPLVTEGLVGSLLNQDDTDRPSDDLTSRQREVLQLLAEGRSMKEVASVLNLTPRTVAFHKYRMMEQLKVKTTAELIQYAVKHHIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 156 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 163 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 164 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 165 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 166 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 167 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 208 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 209 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 210 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 211 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 222 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 223 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 224 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 225 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 227 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 229 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.38 |
| Nodule | 0 |
| Rhizoplane | 5.28 |
| Rhizosphere | 94.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1373379 | 2162886007 | Bacteria | 1244 |
| 2 | MRS1b_contig_6792041 | 2162886011 | Unclassified | 1398 |
| 3 | MRS1b_contig_7604879 | 2162886011 | Bacteria | 2392 |
| 4 | MBSR1b_contig_10852347 | 2162886012 | Bacteria | 1579 |
| 5 | MBSR1b_contig_11074376 | 2162886012 | Unclassified | 825 |
| 6 | Ga0058861_10791624 | 3300004800 | Bacteria | 1285 |
| 7 | Ga0065704_10084830 | 3300005289 | Bacteria | 3290 |
| 8 | Ga0065712_10000605 | 3300005290 | Bacteria | 13608 |
| 9 | Ga0065712_10260229 | 3300005290 | Unclassified | 938 |
| 10 | Ga0065715_10014392 | 3300005293 | Bacteria | 2744 |
| 11 | Ga0065715_10144202 | 3300005293 | Bacteria | 1811 |
| 12 | Ga0065715_10190882 | 3300005293 | Bacteria | 1416 |
| 13 | Ga0065715_10199920 | 3300005293 | Bacteria | 1367 |
| 14 | Ga0065715_10424076 | 3300005293 | Unclassified | 854 |
| 15 | Ga0065715_10597132 | 3300005293 | Unclassified | 710 |
| 16 | Ga0065707_10020564 | 3300005295 | Unclassified | 1723 |
| 17 | Ga0065707_10113165 | 3300005295 | Bacteria | 2336 |
| 18 | Ga0070676_10045532 | 3300005328 | Bacteria | 2555 |
| 19 | Ga0070676_10208697 | 3300005328 | Bacteria | 1284 |
| 20 | Ga0070676_10487708 | 3300005328 | Bacteria | 873 |
| 21 | Ga0070683_100003660 | 3300005329 | Bacteria | 12527 |
| 22 | Ga0070690_100034912 | 3300005330 | Bacteria | 3153 |
| 23 | Ga0070670_101253149 | 3300005331 | Unclassified | 678 |
| 24 | Ga0070677_10476944 | 3300005333 | Bacteria | 672 |
| 25 | Ga0068869_100046029 | 3300005334 | Bacteria | 3144 |
| 26 | Ga0068869_100136191 | 3300005334 | Bacteria | 1892 |
| 27 | Ga0070666_10009961 | 3300005335 | Bacteria | 5932 |
| 28 | Ga0070666_10685199 | 3300005335 | Unclassified | 751 |
| 29 | Ga0070666_10707905 | 3300005335 | Bacteria | 739 |
| 30 | Ga0070682_100168024 | 3300005337 | Bacteria | 1522 |
| 31 | Ga0070660_100367561 | 3300005339 | Bacteria | 1186 |
| 32 | Ga0070689_100009451 | 3300005340 | Bacteria | 6912 |
| 33 | Ga0070689_100029458 | 3300005340 | Bacteria | 4155 |
| 34 | Ga0070689_100140369 | 3300005340 | Bacteria | 1943 |
| 35 | Ga0070691_10000290 | 3300005341 | Bacteria | 17494 |
| 36 | Ga0070661_100096727 | 3300005344 | Bacteria | 2191 |
| 37 | Ga0070668_100076998 | 3300005347 | Bacteria | 2607 |
| 38 | Ga0070668_100097891 | 3300005347 | Bacteria | 2320 |
| 39 | Ga0070668_100178576 | 3300005347 | Bacteria | 1733 |
| 40 | Ga0070669_100005559 | 3300005353 | Bacteria | 9106 |
| 41 | Ga0070669_100018408 | 3300005353 | Bacteria | 4992 |
| 42 | Ga0070669_100039752 | 3300005353 | Unclassified | 3418 |
| 43 | Ga0070669_100081646 | 3300005353 | Bacteria | 2409 |
| 44 | Ga0070669_100096273 | 3300005353 | Bacteria | 2227 |
| 45 | Ga0070669_100121996 | 3300005353 | Bacteria | 1989 |
| 46 | Ga0070675_100169530 | 3300005354 | Unclassified | 1882 |
| 47 | Ga0070675_100713553 | 3300005354 | Bacteria | 914 |
| 48 | Ga0070671_100003359 | 3300005355 | Bacteria | 12483 |
| 49 | Ga0070671_100143662 | 3300005355 | Unclassified | 2014 |
| 50 | Ga0070671_100424287 | 3300005355 | Bacteria | 1139 |
| 51 | Ga0070674_100009078 | 3300005356 | Bacteria | 5946 |
| 52 | Ga0070674_100017542 | 3300005356 | Bacteria | 4507 |
| 53 | Ga0070674_100018623 | 3300005356 | Bacteria | 4395 |
| 54 | Ga0070674_100036984 | 3300005356 | Unclassified | 3281 |
| 55 | Ga0070674_100477286 | 3300005356 | Bacteria | 1034 |
| 56 | Ga0070673_100005004 | 3300005364 | Bacteria | 8451 |
| 57 | Ga0070673_100066802 | 3300005364 | Bacteria | 2874 |
| 58 | Ga0070673_100182916 | 3300005364 | Bacteria | 1795 |
| 59 | Ga0070673_100363558 | 3300005364 | Bacteria | 1287 |
| 60 | Ga0070673_100585435 | 3300005364 | Bacteria | 1016 |
| 61 | Ga0070688_100013809 | 3300005365 | Bacteria | 4566 |
| 62 | Ga0070688_100128764 | 3300005365 | Bacteria | 1705 |
| 63 | Ga0070688_100744737 | 3300005365 | Unclassified | 762 |
| 64 | Ga0070659_100095355 | 3300005366 | Bacteria | 2390 |
| 65 | Ga0070659_100102968 | 3300005366 | Bacteria | 2299 |
| 66 | Ga0070667_100048408 | 3300005367 | Unclassified | 3578 |
| 67 | Ga0070667_100090381 | 3300005367 | Bacteria | 2632 |
| 68 | Ga0070667_100623749 | 3300005367 | Bacteria | 994 |
| 69 | Ga0070667_100647360 | 3300005367 | Bacteria | 976 |
| 70 | Ga0070703_10071145 | 3300005406 | Bacteria | 1162 |
| 71 | Ga0070701_10002670 | 3300005438 | Bacteria | 6916 |
| 72 | Ga0070701_10019396 | 3300005438 | Unclassified | 3211 |
| 73 | Ga0070705_100008956 | 3300005440 | Bacteria | 4964 |
| 74 | Ga0070705_100244076 | 3300005440 | Bacteria | 1257 |
| 75 | Ga0070700_100000383 | 3300005441 | Bacteria | 22722 |
| 76 | Ga0070700_100254069 | 3300005441 | Bacteria | 1262 |
| 77 | Ga0070700_100480352 | 3300005441 | Bacteria | 952 |
| 78 | Ga0070694_100001320 | 3300005444 | Bacteria | 14433 |
| 79 | Ga0070694_100095616 | 3300005444 | Bacteria | 2092 |
| 80 | Ga0070708_100465153 | 3300005445 | Bacteria | 1193 |
| 81 | Ga0070663_100175017 | 3300005455 | Bacteria | 1661 |
| 82 | Ga0070663_100255093 | 3300005455 | Unclassified | 1389 |
| 83 | Ga0070663_100753812 | 3300005455 | Bacteria | 831 |
| 84 | Ga0070678_100089917 | 3300005456 | Bacteria | 2351 |
| 85 | Ga0070662_100073927 | 3300005457 | Unclassified | 2520 |
| 86 | Ga0070681_10501894 | 3300005458 | Bacteria | 1126 |
| 87 | Ga0068867_100016814 | 3300005459 | Bacteria | 5198 |
| 88 | Ga0068867_100036462 | 3300005459 | Bacteria | 3570 |
| 89 | Ga0068867_100043804 | 3300005459 | Bacteria | 3277 |
| 90 | Ga0068867_100277042 | 3300005459 | Bacteria | 1374 |
| 91 | Ga0068867_100839910 | 3300005459 | Bacteria | 822 |
| 92 | Ga0070684_100004122 | 3300005535 | Bacteria | 10999 |
| 93 | Ga0070684_100456504 | 3300005535 | Bacteria | 1181 |
| 94 | Ga0070672_100004805 | 3300005543 | Bacteria | 8873 |
| 95 | Ga0070686_100023526 | 3300005544 | Unclassified | 3683 |
| 96 | Ga0070686_100093918 | 3300005544 | Bacteria | 2012 |
| 97 | Ga0070686_100143309 | 3300005544 | Bacteria | 1665 |
| 98 | Ga0070695_100020122 | 3300005545 | Bacteria | 4071 |
| 99 | Ga0070695_100033455 | 3300005545 | Bacteria | 3216 |
| 100 | Ga0070695_100037646 | 3300005545 | Bacteria | 3050 |
| 101 | Ga0070696_100003529 | 3300005546 | Bacteria | 10406 |
| 102 | Ga0070693_100008382 | 3300005547 | Bacteria | 5093 |
| 103 | Ga0070693_100010937 | 3300005547 | Bacteria | 4559 |
| 104 | Ga0070693_100068592 | 3300005547 | Bacteria | 2082 |
| 105 | Ga0070665_100019581 | 3300005548 | Bacteria | 6794 |
| 106 | Ga0070665_100396254 | 3300005548 | Unclassified | 1388 |
| 107 | Ga0070704_100004714 | 3300005549 | Bacteria | 7888 |
| 108 | Ga0070704_100031227 | 3300005549 | Bacteria | 3581 |
| 109 | Ga0070704_100038691 | 3300005549 | Unclassified | 3269 |
| 110 | Ga0068855_100416342 | 3300005563 | Bacteria | 1470 |
| 111 | Ga0070664_100033339 | 3300005564 | Unclassified | 4313 |
| 112 | Ga0068857_100242682 | 3300005577 | Bacteria | 1650 |
| 113 | Ga0068854_100010252 | 3300005578 | Bacteria | 6075 |
| 114 | Ga0068854_100058649 | 3300005578 | Bacteria | 2779 |
| 115 | Ga0070702_100000083 | 3300005615 | Bacteria | 27572 |
| 116 | Ga0070702_100044768 | 3300005615 | Bacteria | 2500 |
| 117 | Ga0070702_100377920 | 3300005615 | Bacteria | 1006 |
| 118 | Ga0070702_100504382 | 3300005615 | Unclassified | 889 |
| 119 | Ga0068859_100021906 | 3300005617 | Bacteria | 6407 |
| 120 | Ga0068859_100087614 | 3300005617 | Bacteria | 3162 |
| 121 | Ga0068866_10009288 | 3300005718 | Bacteria | 4169 |
| 122 | Ga0068866_10025264 | 3300005718 | Bacteria | 2790 |
| 123 | Ga0068861_100000910 | 3300005719 | Bacteria | 17939 |
| 124 | Ga0068861_100062330 | 3300005719 | Bacteria | 2864 |
| 125 | Ga0068861_100089558 | 3300005719 | Unclassified | 2425 |
| 126 | Ga0068851_10174417 | 3300005834 | Bacteria | 1188 |
| 127 | Ga0068863_100003058 | 3300005841 | Bacteria | 16534 |
| 128 | Ga0068863_100060928 | 3300005841 | Bacteria | 3568 |
| 129 | Ga0068863_100382895 | 3300005841 | Unclassified | 1374 |
| 130 | Ga0068863_101304310 | 3300005841 | Bacteria | 733 |
| 131 | Ga0068858_100054780 | 3300005842 | Bacteria | 3688 |
| 132 | Ga0068858_100151771 | 3300005842 | Unclassified | 2179 |
| 133 | Ga0068858_100302158 | 3300005842 | Unclassified | 1527 |
| 134 | Ga0068858_101062702 | 3300005842 | Bacteria | 794 |
| 135 | Ga0068860_100149615 | 3300005843 | Bacteria | 2248 |
| 136 | Ga0068860_100160061 | 3300005843 | Bacteria | 2170 |
| 137 | Ga0068860_100231935 | 3300005843 | Unclassified | 1794 |
| 138 | Ga0068860_100298888 | 3300005843 | Unclassified | 1577 |
| 139 | Ga0068862_100119335 | 3300005844 | Bacteria | 2323 |
| 140 | Ga0068862_100176127 | 3300005844 | Bacteria | 1917 |
| 141 | Ga0068862_100358571 | 3300005844 | Bacteria | 1354 |
| 142 | Ga0068862_100390324 | 3300005844 | Unclassified | 1300 |
| 143 | Ga0068862_100514191 | 3300005844 | Bacteria | 1138 |
| 144 | Ga0075365_10402678 | 3300006038 | Bacteria | 966 |
| 145 | Ga0097621_100008632 | 3300006237 | Bacteria | 7351 |
| 146 | Ga0097621_100056717 | 3300006237 | Bacteria | 3201 |
| 147 | Ga0097621_100232803 | 3300006237 | Bacteria | 1609 |
| 148 | Ga0097621_100541954 | 3300006237 | Bacteria | 1058 |
| 149 | Ga0068871_100002602 | 3300006358 | Bacteria | 12320 |
| 150 | Ga0068871_100006540 | 3300006358 | Bacteria | 8256 |
| 151 | Ga0068871_100070051 | 3300006358 | Bacteria | 2882 |
| 152 | Ga0068871_100099710 | 3300006358 | Bacteria | 2432 |
| 153 | Ga0068871_100538731 | 3300006358 | Bacteria | 1056 |
| 154 | Ga0068871_100927568 | 3300006358 | Bacteria | 808 |
| 155 | Ga0075428_100025217 | 3300006844 | Bacteria | 6580 |
| 156 | Ga0075428_100042717 | 3300006844 | Bacteria | 4984 |
| 157 | Ga0075428_100080253 | 3300006844 | Bacteria | 3560 |
| 158 | Ga0075428_100239581 | 3300006844 | Bacteria | 1957 |
| 159 | Ga0075428_100490386 | 3300006844 | Bacteria | 1315 |
| 160 | Ga0075428_100662196 | 3300006844 | Unclassified | 1113 |
| 161 | Ga0075428_100840923 | 3300006844 | Unclassified | 975 |
| 162 | Ga0075430_100144333 | 3300006846 | Bacteria | 1982 |
| 163 | Ga0075431_100052128 | 3300006847 | Bacteria | 4219 |
| 164 | Ga0075431_100095620 | 3300006847 | Bacteria | 3067 |
| 165 | Ga0075431_100098062 | 3300006847 | Unclassified | 3026 |
| 166 | Ga0075431_100158716 | 3300006847 | Bacteria | 2326 |
| 167 | Ga0075431_100306574 | 3300006847 | Bacteria | 1603 |
| 168 | Ga0075431_100467139 | 3300006847 | Bacteria | 1256 |
| 169 | Ga0075433_10065001 | 3300006852 | Bacteria | 3199 |
| 170 | Ga0075433_10100752 | 3300006852 | Bacteria | 2558 |
| 171 | Ga0075433_10111144 | 3300006852 | Unclassified | 2431 |
| 172 | Ga0075433_10586807 | 3300006852 | Unclassified | 979 |
| 173 | Ga0075434_100061110 | 3300006871 | Unclassified | 3748 |
| 174 | Ga0075434_100131045 | 3300006871 | Bacteria | 2526 |
| 175 | Ga0075434_100337826 | 3300006871 | Unclassified | 1527 |
| 176 | Ga0075429_100002883 | 3300006880 | Bacteria | 14567 |
| 177 | Ga0075429_100022602 | 3300006880 | Bacteria | 5451 |
| 178 | Ga0075429_100038404 | 3300006880 | Bacteria | 4167 |
| 179 | Ga0075429_100289722 | 3300006880 | Bacteria | 1434 |
| 180 | Ga0068865_100010956 | 3300006881 | Bacteria | 5658 |
| 181 | Ga0068865_100307721 | 3300006881 | Bacteria | 1270 |
| 182 | Ga0068865_100623205 | 3300006881 | Bacteria | 914 |
| 183 | Ga0075436_100371464 | 3300006914 | Unclassified | 1033 |
| 184 | Ga0097620_100021906 | 3300006931 | Bacteria | 6407 |
| 185 | Ga0097620_100087611 | 3300006931 | Bacteria | 3162 |
| 186 | Ga0075435_100005626 | 3300007076 | Bacteria | 8778 |
| 187 | Ga0075435_100011809 | 3300007076 | Bacteria | 6446 |
| 188 | Ga0075435_100155743 | 3300007076 | Bacteria | 1922 |
| 189 | Ga0075435_100653818 | 3300007076 | Bacteria | 912 |
| 190 | Ga0105251_10063378 | 3300009011 | Unclassified | 1734 |
| 191 | Ga0111539_10001664 | 3300009094 | Bacteria | 29674 |
| 192 | Ga0111539_10006629 | 3300009094 | Bacteria | 14912 |
| 193 | Ga0111539_10038689 | 3300009094 | Bacteria | 5756 |
| 194 | Ga0111539_10041435 | 3300009094 | Bacteria | 5537 |
| 195 | Ga0111539_10041566 | 3300009094 | Bacteria | 5526 |
| 196 | Ga0111539_10070770 | 3300009094 | Bacteria | 4117 |
| 197 | Ga0111539_11536617 | 3300009094 | Bacteria | 772 |
| 198 | Ga0105245_10081382 | 3300009098 | Unclassified | 2960 |
| 199 | Ga0105245_10221922 | 3300009098 | Bacteria | 1824 |
| 200 | Ga0105245_10585161 | 3300009098 | Bacteria | 1141 |
| 201 | Ga0105247_10440268 | 3300009101 | Unclassified | 937 |
| 202 | Ga0114129_10003469 | 3300009147 | Bacteria | 22175 |
| 203 | Ga0114129_10012628 | 3300009147 | Bacteria | 12025 |
| 204 | Ga0114129_10029264 | 3300009147 | Bacteria | 7801 |
| 205 | Ga0114129_10218169 | 3300009147 | Unclassified | 2575 |
| 206 | Ga0114129_10462937 | 3300009147 | Bacteria | 1661 |
| 207 | Ga0114129_11216577 | 3300009147 | Unclassified | 937 |
| 208 | Ga0114129_11776734 | 3300009147 | Bacteria | 750 |
| 209 | Ga0105243_10012656 | 3300009148 | Bacteria | 6373 |
| 210 | Ga0105243_10015769 | 3300009148 | Bacteria | 5715 |
| 211 | Ga0105243_10018166 | 3300009148 | Bacteria | 5323 |
| 212 | Ga0105241_10174830 | 3300009174 | Bacteria | 1776 |
| 213 | Ga0105242_10009583 | 3300009176 | Bacteria | 7422 |
| 214 | Ga0105242_10009773 | 3300009176 | Bacteria | 7351 |
| 215 | Ga0105242_10017211 | 3300009176 | Bacteria | 5628 |
| 216 | Ga0105242_10030156 | 3300009176 | Bacteria | 4331 |
| 217 | Ga0105242_10177808 | 3300009176 | Bacteria | 1875 |
| 218 | Ga0105242_10299834 | 3300009176 | Bacteria | 1466 |
| 219 | Ga0105242_10437967 | 3300009176 | Bacteria | 1229 |
| 220 | Ga0105242_10700626 | 3300009176 | Unclassified | 991 |
| 221 | Ga0105248_10006534 | 3300009177 | Bacteria | 12785 |
| 222 | Ga0105248_10008866 | 3300009177 | Bacteria | 11053 |
| 223 | Ga0105248_10014906 | 3300009177 | Bacteria | 8560 |
| 224 | Ga0105248_10030352 | 3300009177 | Bacteria | 6035 |
| 225 | Ga0105248_10086249 | 3300009177 | Bacteria | 3533 |
| 226 | Ga0105248_10186255 | 3300009177 | Unclassified | 2339 |
| 227 | Ga0105248_10298922 | 3300009177 | Unclassified | 1813 |
| 228 | Ga0105248_10319874 | 3300009177 | Unclassified | 1748 |
| 229 | Ga0105248_10438998 | 3300009177 | Bacteria | 1470 |
| 230 | Ga0105248_10539385 | 3300009177 | Unclassified | 1316 |
| 231 | Ga0105248_10688492 | 3300009177 | Bacteria | 1153 |
| 232 | Ga0105237_10159854 | 3300009545 | Bacteria | 2251 |
| 233 | Ga0105249_10004224 | 3300009553 | Bacteria | 12417 |
| 234 | Ga0105249_10062519 | 3300009553 | Bacteria | 3418 |
| 235 | Ga0105249_10223362 | 3300009553 | Bacteria | 1854 |
| 236 | Ga0105249_10443827 | 3300009553 | Unclassified | 1335 |
| 237 | Ga0105249_10586215 | 3300009553 | Bacteria | 1168 |
| 238 | Ga0105249_10734816 | 3300009553 | Unclassified | 1049 |
| 239 | Ga0105249_11030283 | 3300009553 | Bacteria | 892 |
| 240 | Ga0105239_10102512 | 3300010375 | Bacteria | 3167 |
| 241 | Ga0157370_10564069 | 3300013104 | Bacteria | 1043 |
| 242 | Ga0157374_10943993 | 3300013296 | Bacteria | 881 |
| 243 | Ga0157378_10453023 | 3300013297 | Bacteria | 1274 |
| 244 | Ga0157378_11412493 | 3300013297 | Unclassified | 739 |
| 245 | Ga0157375_10027120 | 3300013308 | Bacteria | 5350 |
| 246 | Ga0157375_10838687 | 3300013308 | Bacteria | 1066 |
| 247 | Ga0163163_10000025 | 3300014325 | Bacteria | 182686 |
| 248 | Ga0157380_10093652 | 3300014326 | Bacteria | 2484 |
| 249 | Ga0157380_10153899 | 3300014326 | Unclassified | 1991 |
| 250 | Ga0157380_10160535 | 3300014326 | Unclassified | 1953 |
| 251 | Ga0157380_10442189 | 3300014326 | Bacteria | 1246 |
| 252 | Ga0157380_10737206 | 3300014326 | Bacteria | 995 |
| 253 | Ga0157377_10055872 | 3300014745 | Bacteria | 2240 |
| 254 | Ga0157377_10461372 | 3300014745 | Bacteria | 879 |
| 255 | Ga0157379_10030371 | 3300014968 | Unclassified | 4809 |
| 256 | Ga0157379_10100418 | 3300014968 | Unclassified | 2597 |
| 257 | Ga0157379_10757236 | 3300014968 | Bacteria | 915 |
| 258 | Ga0157379_10790390 | 3300014968 | Unclassified | 895 |
| 259 | Ga0157376_10039285 | 3300014969 | Bacteria | 3858 |
| 260 | Ga0157376_10044128 | 3300014969 | Bacteria | 3663 |
| 261 | Ga0157376_10400611 | 3300014969 | Bacteria | 1327 |
| 262 | Ga0157376_10502547 | 3300014969 | Bacteria | 1192 |
| 263 | Ga0163161_10436647 | 3300017792 | Bacteria | 1056 |
| 264 | Ga0207697_10008668 | 3300025315 | Bacteria | 4434 |
| 265 | Ga0207697_10105570 | 3300025315 | Bacteria | 1203 |
| 266 | Ga0207642_10048016 | 3300025899 | Bacteria | 1911 |
| 267 | Ga0207642_10155175 | 3300025899 | Bacteria | 1223 |
| 268 | Ga0207688_10195229 | 3300025901 | Bacteria | 1212 |
| 269 | Ga0207680_10025934 | 3300025903 | Bacteria | 3240 |
| 270 | Ga0207680_10261071 | 3300025903 | Bacteria | 1199 |
| 271 | Ga0207680_10657948 | 3300025903 | Bacteria | 750 |
| 272 | Ga0207685_10030700 | 3300025905 | Unclassified | 1916 |
| 273 | Ga0207645_10004657 | 3300025907 | Bacteria | 10105 |
| 274 | Ga0207645_10014101 | 3300025907 | Bacteria | 5356 |
| 275 | Ga0207645_10027370 | 3300025907 | Bacteria | 3682 |
| 276 | Ga0207707_10433331 | 3300025912 | Bacteria | 1126 |
| 277 | Ga0207662_10002451 | 3300025918 | Bacteria | 9301 |
| 278 | Ga0207662_10055802 | 3300025918 | Unclassified | 2358 |
| 279 | Ga0207649_10185604 | 3300025920 | Bacteria | 1459 |
| 280 | Ga0207649_10416961 | 3300025920 | Bacteria | 1008 |
| 281 | Ga0207681_10082691 | 3300025923 | Bacteria | 2270 |
| 282 | Ga0207681_10293450 | 3300025923 | Unclassified | 1284 |
| 283 | Ga0207687_10056528 | 3300025927 | Bacteria | 2753 |
| 284 | Ga0207687_10057149 | 3300025927 | Unclassified | 2740 |
| 285 | Ga0207644_10004228 | 3300025931 | Bacteria | 9319 |
| 286 | Ga0207644_10389138 | 3300025931 | Bacteria | 1138 |
| 287 | Ga0207644_10764247 | 3300025931 | Bacteria | 808 |
| 288 | Ga0207706_10093754 | 3300025933 | Unclassified | 2640 |
| 289 | Ga0207706_10121688 | 3300025933 | Unclassified | 2295 |
| 290 | Ga0207706_10365115 | 3300025933 | Bacteria | 1254 |
| 291 | Ga0207686_10083856 | 3300025934 | Bacteria | 2087 |
| 292 | Ga0207686_10086378 | 3300025934 | Bacteria | 2060 |
| 293 | Ga0207686_10103346 | 3300025934 | Unclassified | 1906 |
| 294 | Ga0207686_10170450 | 3300025934 | Unclassified | 1534 |
| 295 | Ga0207686_10324460 | 3300025934 | Bacteria | 1151 |
| 296 | Ga0207709_10107587 | 3300025935 | Bacteria | 1857 |
| 297 | Ga0207670_10051533 | 3300025936 | Unclassified | 2764 |
| 298 | Ga0207670_10074957 | 3300025936 | Bacteria | 2350 |
| 299 | Ga0207670_10399439 | 3300025936 | Unclassified | 1098 |
| 300 | Ga0207669_10035382 | 3300025937 | Bacteria | 2841 |
| 301 | Ga0207669_10452996 | 3300025937 | Bacteria | 1017 |
| 302 | Ga0207704_10011067 | 3300025938 | Bacteria | 4426 |
| 303 | Ga0207704_10058936 | 3300025938 | Bacteria | 2367 |
| 304 | Ga0207704_10114350 | 3300025938 | Unclassified | 1832 |
| 305 | Ga0207704_10117190 | 3300025938 | Bacteria | 1814 |
| 306 | Ga0207691_10011113 | 3300025940 | Bacteria | 8642 |
| 307 | Ga0207691_10025367 | 3300025940 | Bacteria | 5567 |
| 308 | Ga0207691_10378288 | 3300025940 | Bacteria | 1209 |
| 309 | Ga0207711_10051201 | 3300025941 | Bacteria | 3536 |
| 310 | Ga0207711_10052186 | 3300025941 | Bacteria | 3504 |
| 311 | Ga0207711_10089484 | 3300025941 | Unclassified | 2705 |
| 312 | Ga0207711_10179318 | 3300025941 | Unclassified | 1925 |
| 313 | Ga0207711_10230611 | 3300025941 | Unclassified | 1696 |
| 314 | Ga0207711_10466694 | 3300025941 | Bacteria | 1176 |
| 315 | Ga0207711_10842554 | 3300025941 | Bacteria | 853 |
| 316 | Ga0207689_10052829 | 3300025942 | Bacteria | 3348 |
| 317 | Ga0207679_10002789 | 3300025945 | Bacteria | 10820 |
| 318 | Ga0207651_10001960 | 3300025960 | Bacteria | 9678 |
| 319 | Ga0207651_10103786 | 3300025960 | Bacteria | 2116 |
| 320 | Ga0207651_10159153 | 3300025960 | Bacteria | 1768 |
| 321 | Ga0207651_10307457 | 3300025960 | Bacteria | 1321 |
| 322 | Ga0207651_10332366 | 3300025960 | Unclassified | 1274 |
| 323 | Ga0207712_10018045 | 3300025961 | Bacteria | 4591 |
| 324 | Ga0207712_10568387 | 3300025961 | Bacteria | 977 |
| 325 | Ga0207712_10787245 | 3300025961 | Bacteria | 835 |
| 326 | Ga0207668_10046419 | 3300025972 | Bacteria | 2968 |
| 327 | Ga0207658_10042563 | 3300025986 | Bacteria | 3296 |
| 328 | Ga0207658_10056019 | 3300025986 | Bacteria | 2924 |
| 329 | Ga0207677_10063699 | 3300026023 | Bacteria | 2564 |
| 330 | Ga0207677_10320662 | 3300026023 | Bacteria | 1287 |
| 331 | Ga0207703_10159240 | 3300026035 | Unclassified | 1976 |
| 332 | Ga0207703_10226652 | 3300026035 | Bacteria | 1673 |
| 333 | Ga0207703_10547810 | 3300026035 | Unclassified | 1090 |
| 334 | Ga0207678_10151577 | 3300026067 | Bacteria | 1980 |
| 335 | Ga0207678_10303273 | 3300026067 | Unclassified | 1373 |
| 336 | Ga0207678_10344769 | 3300026067 | Bacteria | 1284 |
| 337 | Ga0207708_10000437 | 3300026075 | Bacteria | 32494 |
| 338 | Ga0207708_10017803 | 3300026075 | Bacteria | 5347 |
| 339 | Ga0207708_10283732 | 3300026075 | Bacteria | 1342 |
| 340 | Ga0207708_10608230 | 3300026075 | Unclassified | 927 |
| 341 | Ga0207641_10002253 | 3300026088 | Bacteria | 17995 |
| 342 | Ga0207648_10009049 | 3300026089 | Bacteria | 9579 |
| 343 | Ga0207648_10031637 | 3300026089 | Bacteria | 4678 |
| 344 | Ga0207648_10438375 | 3300026089 | Unclassified | 1188 |
| 345 | Ga0207648_11180724 | 3300026089 | Bacteria | 719 |
| 346 | Ga0207676_11269652 | 3300026095 | Unclassified | 731 |
| 347 | Ga0207675_100001535 | 3300026118 | Bacteria | 23144 |
| 348 | Ga0207675_100035740 | 3300026118 | Bacteria | 4634 |
| 349 | Ga0207675_100078208 | 3300026118 | Unclassified | 3099 |
| 350 | Ga0207683_10157692 | 3300026121 | Bacteria | 2050 |
| 351 | Ga0207698_10093503 | 3300026142 | Bacteria | 2469 |
| 352 | Ga0207428_10000985 | 3300027907 | Bacteria | 31530 |
| 353 | Ga0207428_10016753 | 3300027907 | Bacteria | 6302 |
| 354 | Ga0207428_10082411 | 3300027907 | Bacteria | 2510 |
| 355 | Ga0268266_10006086 | 3300028379 | Bacteria | 11114 |
| 356 | Ga0268266_11105666 | 3300028379 | Bacteria | 767 |
| 357 | Ga0268265_10048105 | 3300028380 | Bacteria | 3200 |
| 358 | Ga0268265_10163193 | 3300028380 | Bacteria | 1895 |
| 359 | Ga0268265_10180659 | 3300028380 | Bacteria | 1812 |
| 360 | Ga0268265_10939890 | 3300028380 | Bacteria | 851 |
| 361 | Ga0268264_10070599 | 3300028381 | Unclassified | 2957 |
| 362 | Ga0268264_10195614 | 3300028381 | Unclassified | 1846 |
| 363 | Ga0307408_100002960 | 3300031548 | Bacteria | 11774 |
| 364 | Ga0307408_100007702 | 3300031548 | Bacteria | 7125 |
| 365 | Ga0307408_100074701 | 3300031548 | Bacteria | 2516 |
| 366 | Ga0307405_10042186 | 3300031731 | Unclassified | 2776 |
| 367 | Ga0307413_10048156 | 3300031824 | Bacteria | 2546 |
| 368 | Ga0307406_10015839 | 3300031901 | Bacteria | 4371 |
| 369 | Ga0307407_10394987 | 3300031903 | Bacteria | 991 |
| 370 | Ga0307412_10037028 | 3300031911 | Bacteria | 3131 |
| 371 | Ga0307412_10194046 | 3300031911 | Bacteria | 1537 |
| 372 | Ga0307409_100355843 | 3300031995 | Bacteria | 1383 |
| 373 | Ga0307409_100562053 | 3300031995 | Unclassified | 1122 |
| 374 | Ga0307416_100046885 | 3300032002 | Bacteria | 3415 |
| 375 | Ga0307416_100812392 | 3300032002 | Unclassified | 1031 |
| 376 | Ga0307411_10011191 | 3300032005 | Bacteria | 4828 |
| 377 | Ga0307411_10169281 | 3300032005 | Bacteria | 1646 |
| 378 | Ga0307415_100311779 | 3300032126 | Unclassified | 1308 |
| 379 | Ga0373934_0002020 | 3300035086 | Bacteria | 7457 |
| 380 | Ga0373944_0054706 | 3300035089 | Bacteria | 1266 |
| 381 | Ga0373939_0122962 | 3300035114 | Bacteria | 918 |
| 382 | Ga0373956_0003145 | 3300035119 | Bacteria | 6676 |
| 383 | Ga0373956_0053040 | 3300035119 | Bacteria | 1825 |
| 384 | Ga0373957_0016045 | 3300035120 | Bacteria | 2588 |
| 385 | Ga0373943_0284916 | 3300035170 | Viruses | 935 |
| 386 | Ga0373943_0290172 | 3300035170 | Unclassified | 927 |
| 387 | Ga0373955_0001206 | 3300035172 | Bacteria | 10992 |
| 388 | Ga0373955_0461782 | 3300035172 | Bacteria | 774 |
| 389 | Ga0373942_0102174 | 3300035207 | Bacteria | 877 |
| 390 | Ga0373962_0026053 | 3300035242 | Bacteria | 1574 |
| 391 | Ga0373924_0135223 | 3300035410 | Bacteria | 1074 |
| 392 | Ga0373931_0126900 | 3300035691 | Bacteria | 1464 |
| 393 | Ga0373937_0011384 | 3300036401 | Bacteria | 7805 |
| 394 | Ga0373937_0120987 | 3300036401 | Bacteria | 2439 |
| 395 | Ga0373937_0261246 | 3300036401 | Bacteria | 1633 |
| 396 | Ga0373925_0526825 | 3300037068 | Unclassified | 971 |
| 397 | Ga0373925_0761737 | 3300037068 | Bacteria | 798 |
| 398 | Ga0395898_0490368 | 3300037466 | Unclassified | 1169 |
| 399 | Ga0451853_3294492 | 3300041512 | Unclassified | 781 |
| 400 | Ga0439450_000552 | 3300042008 | Bacteria | 4910 |
| 401 | Ga0439435_0025987 | 3300042436 | Bacteria | 1556 |
| 402 | Ga0439435_0036910 | 3300042436 | Bacteria | 1352 |
| 403 | Ga0439435_0061635 | 3300042436 | Bacteria | 1094 |
| 404 | Ga0439464_0001308 | 3300042439 | Bacteria | 5802 |
| 405 | Ga0439460_0014500 | 3300042461 | Bacteria | 2073 |
| 406 | Ga0450916_031316 | 3300042530 | Bacteria | 776 |
| 407 | Ga0439440_0066219 | 3300042993 | Unclassified | 932 |
| 408 | Ga0451576_0143527 | 3300045051 | Bacteria | 2489 |
| 409 | Ga0451576_0279944 | 3300045051 | Bacteria | 1744 |
| 410 | Ga0495592_0102906 | 3300046454 | Bacteria | 2033 |
| 411 | Ga0495603_0096840 | 3300046455 | Unclassified | 1724 |
| 412 | Ga0495651_0016618 | 3300046462 | Bacteria | 5699 |
| 413 | Ga0495651_0279655 | 3300046462 | Unclassified | 1128 |
| 414 | Ga0495594_0185334 | 3300046499 | Bacteria | 1185 |
| 415 | Ga0495618_0498362 | 3300046514 | Bacteria | 734 |
| 416 | Ga0495628_0301510 | 3300046516 | Bacteria | 1186 |
| 417 | Ga0495652_0161421 | 3300046529 | Bacteria | 1739 |
| 418 | Ga0495640_0145856 | 3300046533 | Bacteria | 1523 |
| 419 | Ga0495587_0076980 | 3300046536 | Bacteria | 1937 |
| 420 | Ga0495587_0085213 | 3300046536 | Unclassified | 1830 |
| 421 | Ga0495645_0060087 | 3300046543 | Bacteria | 2755 |
| 422 | Ga0495667_0137614 | 3300046559 | Unclassified | 1574 |
| 423 | Ga0495667_0301761 | 3300046559 | Bacteria | 1014 |
| 424 | Ga0495634_0209491 | 3300046642 | Unclassified | 1207 |
| 425 | Ga0495635_0067698 | 3300046663 | Bacteria | 2449 |
| 426 | Ga0495599_0314049 | 3300046678 | Bacteria | 944 |
| 427 | Ga0495623_0014988 | 3300046679 | Bacteria | 5010 |
| 428 | Ga0495623_0063308 | 3300046679 | Bacteria | 2316 |
| 429 | Ga0495647_0105647 | 3300046681 | Bacteria | 1170 |
| 430 | Ga0495658_0362563 | 3300046683 | Bacteria | 922 |
| 431 | Ga0495613_0202969 | 3300046689 | Unclassified | 1397 |
| 432 | Ga0495600_0124336 | 3300046809 | Bacteria | 1678 |
| 433 | Ga0495674_0718365 | 3300047319 | Unclassified | 783 |
| 434 | Ga0495675_0015080 | 3300047444 | Bacteria | 4886 |
| 435 | Ga0495684_0000351 | 3300047471 | Bacteria | 37160 |
| 436 | Ga0495684_0017137 | 3300047471 | Bacteria | 5579 |
| 437 | Ga0495684_0145119 | 3300047471 | Bacteria | 1778 |
| 438 | Ga0495602_0008376 | 3300048088 | Bacteria | 10806 |
| 439 | Ga0495602_0092324 | 3300048088 | Bacteria | 2508 |
| 440 | Ga0496100_0002870 | 3300048903 | Bacteria | 8833 |
| 441 | Ga0496101_0000290 | 3300048904 | Bacteria | 34975 |
| 442 | Ga0496102_0028410 | 3300048905 | Bacteria | 4995 |
| 443 | Ga0496102_0061895 | 3300048905 | Bacteria | 3427 |
| 444 | Ga0496102_0937153 | 3300048905 | Bacteria | 787 |
| 445 | Ga0496103_0116173 | 3300048906 | Bacteria | 1702 |
| 446 | Ga0496104_0006926 | 3300048907 | Bacteria | 9999 |
| 447 | Ga0496104_0011362 | 3300048907 | Bacteria | 7969 |
| 448 | Ga0496104_0075772 | 3300048907 | Unclassified | 3203 |
| 449 | Ga0496105_0016934 | 3300048908 | Bacteria | 5832 |
| 450 | Ga0496105_0069848 | 3300048908 | Bacteria | 2903 |
| 451 | Ga0496106_0009161 | 3300048909 | Bacteria | 7311 |
| 452 | Ga0496106_0059644 | 3300048909 | Bacteria | 2891 |
| 453 | Ga0496106_0198274 | 3300048909 | Bacteria | 1597 |
| 454 | Ga0496107_0214671 | 3300048910 | Bacteria | 1431 |
| 455 | Ga0496108_0027842 | 3300048911 | Bacteria | 4672 |
| 456 | Ga0496109_0002983 | 3300048912 | Bacteria | 14136 |
| 457 | Ga0496109_0099931 | 3300048912 | Unclassified | 2691 |
| 458 | Ga0496110_0071520 | 3300048913 | Unclassified | 3076 |
| 459 | Ga0496110_1079800 | 3300048913 | Bacteria | 711 |
| 460 | Ga0496111_0020701 | 3300048914 | Bacteria | 4584 |
| 461 | Ga0496111_0072761 | 3300048914 | Unclassified | 2502 |
| 462 | Ga0496112_0001961 | 3300048915 | Bacteria | 16259 |
| 463 | Ga0496112_0057604 | 3300048915 | Bacteria | 3826 |
| 464 | Ga0496113_0096790 | 3300048916 | Bacteria | 2282 |
| 465 | Ga0496114_0000359 | 3300048917 | Bacteria | 33466 |
| 466 | Ga0496114_0060433 | 3300048917 | Bacteria | 3168 |
| 467 | Ga0496114_0403741 | 3300048917 | Bacteria | 1210 |
| 468 | Ga0501291_009751 | 3300049514 | Unclassified | 1352 |
| 469 | Ga0501292_004293 | 3300049515 | Bacteria | 1944 |
| 470 | Ga0501299_003820 | 3300049522 | Bacteria | 2209 |
| 471 | Ga0501299_013337 | 3300049522 | Bacteria | 1416 |
| 472 | Ga0501300_025987 | 3300049523 | Unclassified | 859 |
| 473 | Ga0501302_006439 | 3300049525 | Unclassified | 762 |
| 474 | Ga0501031_0013149 | 3300049568 | Bacteria | 5401 |
| 475 | Ga0501037_0428459 | 3300049573 | Unclassified | 905 |
| 476 | Ga0501038_0072745 | 3300049574 | Bacteria | 2913 |
| 477 | Ga0501040_0161417 | 3300049576 | Unclassified | 1584 |
| 478 | Ga0501048_0371194 | 3300049582 | Unclassified | 1021 |
| 479 | Ga0501071_0098332 | 3300049587 | Unclassified | 2156 |
| 480 | Ga0501071_0216837 | 3300049587 | Bacteria | 1440 |
| 481 | Ga0501072_0034519 | 3300049588 | Bacteria | 3965 |
| 482 | Ga0501074_0169684 | 3300049590 | Unclassified | 1558 |
| 483 | Ga0501075_0218157 | 3300049591 | Unclassified | 1455 |
| 484 | Ga0501075_0680565 | 3300049591 | Bacteria | 784 |
| 485 | Ga0501202_025812 | 3300049652 | Bacteria | 1199 |
| 486 | Ga0501216_061444 | 3300049660 | Unclassified | 759 |
| 487 | Ga0501228_005373 | 3300049666 | Unclassified | 1134 |
| 488 | Ga0501258_023981 | 3300049687 | Bacteria | 734 |
| 489 | Ga0501081_0108791 | 3300049743 | Bacteria | 1966 |
| 490 | Ga0501081_0280909 | 3300049743 | Unclassified | 1219 |
| 491 | Ga0501279_016643 | 3300049775 | Bacteria | 1026 |
| 492 | Ga0501045_0036310 | 3300049824 | Bacteria | 3578 |
| 493 | nmdc:mga0yw44_352219_c1 | 3300050492 | Bacteria | 991 |
| 494 | nmdc:mga05p37_148384_c1 | 3300050507 | Bacteria | 2870 |
| 495 | nmdc:mga05p37_22542_c1 | 3300050507 | Bacteria | 7636 |
| 496 | nmdc:mga05p37_43198_c1 | 3300050507 | Bacteria | 5543 |
| 497 | nmdc:mga05p37_5476_c1 | 3300050507 | Bacteria | 14906 |
| 498 | nmdc:mga05p37_722787_c1 | 3300050507 | Unclassified | 1102 |
| 499 | nmdc:mga09592_29673_c1 | 3300050508 | Bacteria | 4547 |
| 500 | nmdc:mga09592_4554_c1 | 3300050508 | Bacteria | 11216 |
| 501 | nmdc:mga0qj67_2408_c1 | 3300050509 | Bacteria | 13322 |
| 502 | nmdc:mga06r32_107992_c1 | 3300050510 | Bacteria | 2735 |
| 503 | nmdc:mga06r32_1420_c1 | 3300050510 | Bacteria | 21603 |
| 504 | nmdc:mga06r32_429871_c1 | 3300050510 | Bacteria | 1301 |
| 505 | nmdc:mga06r32_4906_c1 | 3300050510 | Bacteria | 12053 |
| 506 | nmdc:mga08y16_2756_c1 | 3300050511 | Bacteria | 18000 |
| 507 | nmdc:mga08y16_29638_c1 | 3300050511 | Bacteria | 5763 |
| 508 | nmdc:mga08y16_364464_c1 | 3300050511 | Unclassified | 1483 |
| 509 | nmdc:mga08y16_37789_c1 | 3300050511 | Bacteria | 5069 |
| 510 | nmdc:mga08y16_466798_c1 | 3300050511 | Bacteria | 1286 |
| 511 | nmdc:mga08y16_8973_c1 | 3300050511 | Bacteria | 10503 |
| 512 | nmdc:mga0n895_179202_c1 | 3300050512 | Bacteria | 2150 |
| 513 | nmdc:mga0n895_20517_c1 | 3300050512 | Bacteria | 6165 |
| 514 | nmdc:mga0n895_211613_c1 | 3300050512 | Unclassified | 1969 |
| 515 | nmdc:mga0n895_369823_c1 | 3300050512 | Bacteria | 1451 |
| 516 | nmdc:mga0n895_727367_c1 | 3300050512 | Bacteria | 987 |
| 517 | nmdc:mga0n895_883703_c1 | 3300050512 | Bacteria | 880 |
| 518 | nmdc:mga0rr50_19481_c1 | 3300050513 | Bacteria | 4582 |
| 519 | nmdc:mga0rr50_204153_c1 | 3300050513 | Bacteria | 1626 |
| 520 | nmdc:mga0rr50_437801_c1 | 3300050513 | Bacteria | 1107 |
| 521 | nmdc:mga0rr50_703554_c1 | 3300050513 | Bacteria | 862 |
| 522 | nmdc:mga08x19_177458_c1 | 3300050514 | Unclassified | 1453 |
| 523 | nmdc:mga0a205_247655_c1 | 3300050515 | Unclassified | 1662 |
| 524 | nmdc:mga0a205_44294_c1 | 3300050515 | Unclassified | 4289 |
| 525 | nmdc:mga0a205_596132_c1 | 3300050515 | Bacteria | 958 |
| 526 | nmdc:mga0a205_73565_c1 | 3300050515 | Bacteria | 3301 |
| 527 | nmdc:mga0a205_758338_c1 | 3300050515 | Bacteria | 819 |
| 528 | Ga0495601_0028066 | 3300053077 | Bacteria | 3484 |
| 529 | Ga0495601_0264610 | 3300053077 | Unclassified | 1122 |
| 530 | Ga0501084_0944733 | 3300054114 | Unclassified | 725 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_11180724 | Ga0207648_111807242 | 184 |
| 2 | 3300013104 | Ga0157370_10564069 | Ga0157370_105640691 | 189 |
| 3 | 3300006847 | Ga0075431_100098062 | Ga0075431_1000980622 | 191 |
| 4 | 3300009094 | Ga0111539_10041566 | Ga0111539_100415663 | 192 |
| 5 | 3300009148 | Ga0105243_10012656 | Ga0105243_100126564 | 192 |
| 6 | 3300009176 | Ga0105242_10177808 | Ga0105242_101778082 | 192 |
| 7 | 3300042436 | Ga0439435_0061635 | Ga0439435_0061635_149_739 | 192 |
| 8 | 3300050511 | nmdc:mga08y16_8973_c1 | nmdc:mga08y16_8973_c1_7522_8112 | 192 |
| 9 | 3300050515 | nmdc:mga0a205_758338_c1 | nmdc:mga0a205_758338_c1_159_749 | 192 |
| 10 | 3300050492 | nmdc:mga0yw44_352219_c1 | nmdc:mga0yw44_352219_c1_62_670 | 198 |
| 11 | 2162886011 | MRS1b_contig_7604879 | MRS1b_0714.00002130 | 199 |
| 12 | 3300031548 | Ga0307408_100074701 | Ga0307408_1000747011 | 199 |
| 13 | 3300031824 | Ga0307413_10048156 | Ga0307413_100481562 | 199 |
| 14 | 3300031903 | Ga0307407_10394987 | Ga0307407_103949871 | 199 |
| 15 | 3300031995 | Ga0307409_100355843 | Ga0307409_1003558432 | 199 |
| 16 | 3300046642 | Ga0495634_0209491 | Ga0495634_0209491_183_794 | 199 |
| 17 | 3300049687 | Ga0501258_023981 | Ga0501258_023981_56_667 | 199 |
| 18 | 3300050512 | nmdc:mga0n895_883703_c1 | nmdc:mga0n895_883703_c1_132_746 | 200 |
| 19 | 3300050515 | nmdc:mga0a205_73565_c1 | nmdc:mga0a205_73565_c1_665_1279 | 200 |
| 20 | 3300005364 | Ga0070673_100363558 | Ga0070673_1003635581 | 203 |
| 21 | 3300005333 | Ga0070677_10476944 | Ga0070677_104769441 | 204 |
| 22 | 3300005341 | Ga0070691_10000290 | Ga0070691_100002904 | 204 |
| 23 | 3300005353 | Ga0070669_100005559 | Ga0070669_1000055595 | 204 |
| 24 | 3300005354 | Ga0070675_100713553 | Ga0070675_1007135531 | 204 |
| 25 | 3300005438 | Ga0070701_10002670 | Ga0070701_100026704 | 204 |
| 26 | 3300005440 | Ga0070705_100008956 | Ga0070705_1000089562 | 204 |
| 27 | 3300005441 | Ga0070700_100000383 | Ga0070700_1000003836 | 204 |
| 28 | 3300005444 | Ga0070694_100001320 | Ga0070694_1000013203 | 204 |
| 29 | 3300005459 | Ga0068867_100016814 | Ga0068867_1000168144 | 204 |
| 30 | 3300005544 | Ga0070686_100093918 | Ga0070686_1000939181 | 204 |
| 31 | 3300005545 | Ga0070695_100020122 | Ga0070695_1000201222 | 204 |
| 32 | 3300005546 | Ga0070696_100003529 | Ga0070696_1000035294 | 204 |
| 33 | 3300005549 | Ga0070704_100004714 | Ga0070704_1000047144 | 204 |
| 34 | 3300005578 | Ga0068854_100010252 | Ga0068854_1000102523 | 204 |
| 35 | 3300005615 | Ga0070702_100000083 | Ga0070702_10000008317 | 204 |
| 36 | 3300005719 | Ga0068861_100000910 | Ga0068861_1000009104 | 204 |
| 37 | 3300005841 | Ga0068863_100382895 | Ga0068863_1003828952 | 204 |
| 38 | 3300005844 | Ga0068862_100390324 | Ga0068862_1003903242 | 204 |
| 39 | 3300006358 | Ga0068871_100002602 | Ga0068871_1000026023 | 204 |
| 40 | 3300006844 | Ga0075428_100662196 | Ga0075428_1006621962 | 204 |
| 41 | 3300006852 | Ga0075433_10065001 | Ga0075433_100650012 | 204 |
| 42 | 3300009094 | Ga0111539_10001664 | Ga0111539_1000166410 | 204 |
| 43 | 3300009176 | Ga0105242_10017211 | Ga0105242_100172113 | 204 |
| 44 | 3300013297 | Ga0157378_10453023 | Ga0157378_104530232 | 204 |
| 45 | 3300013308 | Ga0157375_10838687 | Ga0157375_108386872 | 204 |
| 46 | 3300025905 | Ga0207685_10030700 | Ga0207685_100307002 | 204 |
| 47 | 3300025907 | Ga0207645_10004657 | Ga0207645_100046574 | 204 |
| 48 | 3300025934 | Ga0207686_10324460 | Ga0207686_103244602 | 204 |
| 49 | 3300025935 | Ga0207709_10107587 | Ga0207709_101075872 | 204 |
| 50 | 3300026035 | Ga0207703_10226652 | Ga0207703_102266521 | 204 |
| 51 | 3300026075 | Ga0207708_10000437 | Ga0207708_1000043713 | 204 |
| 52 | 3300026089 | Ga0207648_10031637 | Ga0207648_100316372 | 204 |
| 53 | 3300026118 | Ga0207675_100001535 | Ga0207675_10000153510 | 204 |
| 54 | 3300027907 | Ga0207428_10000985 | Ga0207428_1000098510 | 204 |
| 55 | 3300027907 | Ga0207428_10016753 | Ga0207428_100167532 | 204 |
| 56 | 3300035119 | Ga0373956_0053040 | Ga0373956_0053040_649_1269 | 204 |
| 57 | 3300035172 | Ga0373955_0461782 | Ga0373955_0461782_122_742 | 204 |
| 58 | 3300037068 | Ga0373925_0526825 | Ga0373925_0526825_28_648 | 204 |
| 59 | 3300048903 | Ga0496100_0002870 | Ga0496100_0002870_3043_3663 | 204 |
| 60 | 3300048904 | Ga0496101_0000290 | Ga0496101_0000290_7629_8249 | 204 |
| 61 | 3300048905 | Ga0496102_0061895 | Ga0496102_0061895_587_1207 | 204 |
| 62 | 3300048907 | Ga0496104_0011362 | Ga0496104_0011362_2324_2944 | 204 |
| 63 | 3300048908 | Ga0496105_0069848 | Ga0496105_0069848_1531_2151 | 204 |
| 64 | 3300048909 | Ga0496106_0198274 | Ga0496106_0198274_587_1207 | 204 |
| 65 | 3300048917 | Ga0496114_0000359 | Ga0496114_0000359_18171_18791 | 204 |
| 66 | 3300050511 | nmdc:mga08y16_2756_c1 | nmdc:mga08y16_2756_c1_14058_14684 | 204 |
| 67 | 2162886011 | MRS1b_contig_6792041 | MRS1b_0141.00001950 | 205 |
| 68 | 2162886012 | MBSR1b_contig_10852347 | MBSR1b_0778.00006470 | 205 |
| 69 | 2162886012 | MBSR1b_contig_11074376 | MBSR1b_0403.00002100 | 205 |
| 70 | 3300004800 | Ga0058861_10791624 | Ga0058861_107916242 | 205 |
| 71 | 3300005290 | Ga0065712_10000605 | Ga0065712_100006052 | 205 |
| 72 | 3300005290 | Ga0065712_10260229 | Ga0065712_102602291 | 205 |
| 73 | 3300005293 | Ga0065715_10014392 | Ga0065715_100143922 | 205 |
| 74 | 3300005293 | Ga0065715_10144202 | Ga0065715_101442021 | 205 |
| 75 | 3300005293 | Ga0065715_10190882 | Ga0065715_101908823 | 205 |
| 76 | 3300005293 | Ga0065715_10199920 | Ga0065715_101999202 | 205 |
| 77 | 3300005293 | Ga0065715_10424076 | Ga0065715_104240761 | 205 |
| 78 | 3300005295 | Ga0065707_10020564 | Ga0065707_100205642 | 205 |
| 79 | 3300005328 | Ga0070676_10045532 | Ga0070676_100455322 | 205 |
| 80 | 3300005328 | Ga0070676_10208697 | Ga0070676_102086972 | 205 |
| 81 | 3300005328 | Ga0070676_10487708 | Ga0070676_104877081 | 205 |
| 82 | 3300005329 | Ga0070683_100003660 | Ga0070683_1000036603 | 205 |
| 83 | 3300005330 | Ga0070690_100034912 | Ga0070690_1000349122 | 205 |
| 84 | 3300005331 | Ga0070670_101253149 | Ga0070670_1012531491 | 205 |
| 85 | 3300005334 | Ga0068869_100046029 | Ga0068869_1000460293 | 205 |
| 86 | 3300005334 | Ga0068869_100136191 | Ga0068869_1001361913 | 205 |
| 87 | 3300005335 | Ga0070666_10009961 | Ga0070666_100099617 | 205 |
| 88 | 3300005335 | Ga0070666_10685199 | Ga0070666_106851991 | 205 |
| 89 | 3300005335 | Ga0070666_10707905 | Ga0070666_107079051 | 205 |
| 90 | 3300005337 | Ga0070682_100168024 | Ga0070682_1001680243 | 205 |
| 91 | 3300005339 | Ga0070660_100367561 | Ga0070660_1003675612 | 205 |
| 92 | 3300005340 | Ga0070689_100029458 | Ga0070689_1000294582 | 205 |
| 93 | 3300005340 | Ga0070689_100140369 | Ga0070689_1001403693 | 205 |
| 94 | 3300005344 | Ga0070661_100096727 | Ga0070661_1000967272 | 205 |
| 95 | 3300005347 | Ga0070668_100076998 | Ga0070668_1000769984 | 205 |
| 96 | 3300005347 | Ga0070668_100097891 | Ga0070668_1000978912 | 205 |
| 97 | 3300005347 | Ga0070668_100178576 | Ga0070668_1001785762 | 205 |
| 98 | 3300005353 | Ga0070669_100018408 | Ga0070669_1000184082 | 205 |
| 99 | 3300005353 | Ga0070669_100039752 | Ga0070669_1000397522 | 205 |
| 100 | 3300005353 | Ga0070669_100081646 | Ga0070669_1000816463 | 205 |
| 101 | 3300005353 | Ga0070669_100096273 | Ga0070669_1000962732 | 205 |
| 102 | 3300005353 | Ga0070669_100121996 | Ga0070669_1001219962 | 205 |
| 103 | 3300005354 | Ga0070675_100169530 | Ga0070675_1001695302 | 205 |
| 104 | 3300005355 | Ga0070671_100003359 | Ga0070671_1000033597 | 205 |
| 105 | 3300005355 | Ga0070671_100143662 | Ga0070671_1001436621 | 205 |
| 106 | 3300005356 | Ga0070674_100009078 | Ga0070674_1000090786 | 205 |
| 107 | 3300005356 | Ga0070674_100017542 | Ga0070674_1000175422 | 205 |
| 108 | 3300005356 | Ga0070674_100018623 | Ga0070674_1000186232 | 205 |
| 109 | 3300005356 | Ga0070674_100036984 | Ga0070674_1000369842 | 205 |
| 110 | 3300005356 | Ga0070674_100477286 | Ga0070674_1004772861 | 205 |
| 111 | 3300005364 | Ga0070673_100005004 | Ga0070673_1000050043 | 205 |
| 112 | 3300005364 | Ga0070673_100066802 | Ga0070673_1000668022 | 205 |
| 113 | 3300005364 | Ga0070673_100182916 | Ga0070673_1001829162 | 205 |
| 114 | 3300005364 | Ga0070673_100585435 | Ga0070673_1005854351 | 205 |
| 115 | 3300005365 | Ga0070688_100128764 | Ga0070688_1001287642 | 205 |
| 116 | 3300005365 | Ga0070688_100744737 | Ga0070688_1007447371 | 205 |
| 117 | 3300005366 | Ga0070659_100095355 | Ga0070659_1000953551 | 205 |
| 118 | 3300005366 | Ga0070659_100102968 | Ga0070659_1001029683 | 205 |
| 119 | 3300005367 | Ga0070667_100048408 | Ga0070667_1000484084 | 205 |
| 120 | 3300005367 | Ga0070667_100090381 | Ga0070667_1000903813 | 205 |
| 121 | 3300005367 | Ga0070667_100647360 | Ga0070667_1006473602 | 205 |
| 122 | 3300005406 | Ga0070703_10071145 | Ga0070703_100711451 | 205 |
| 123 | 3300005438 | Ga0070701_10019396 | Ga0070701_100193964 | 205 |
| 124 | 3300005440 | Ga0070705_100244076 | Ga0070705_1002440762 | 205 |
| 125 | 3300005441 | Ga0070700_100254069 | Ga0070700_1002540692 | 205 |
| 126 | 3300005441 | Ga0070700_100480352 | Ga0070700_1004803521 | 205 |
| 127 | 3300005444 | Ga0070694_100095616 | Ga0070694_1000956161 | 205 |
| 128 | 3300005445 | Ga0070708_100465153 | Ga0070708_1004651532 | 205 |
| 129 | 3300005455 | Ga0070663_100175017 | Ga0070663_1001750172 | 205 |
| 130 | 3300005455 | Ga0070663_100255093 | Ga0070663_1002550932 | 205 |
| 131 | 3300005455 | Ga0070663_100753812 | Ga0070663_1007538121 | 205 |
| 132 | 3300005456 | Ga0070678_100089917 | Ga0070678_1000899171 | 205 |
| 133 | 3300005457 | Ga0070662_100073927 | Ga0070662_1000739274 | 205 |
| 134 | 3300005458 | Ga0070681_10501894 | Ga0070681_105018941 | 205 |
| 135 | 3300005459 | Ga0068867_100036462 | Ga0068867_1000364622 | 205 |
| 136 | 3300005459 | Ga0068867_100043804 | Ga0068867_1000438042 | 205 |
| 137 | 3300005459 | Ga0068867_100277042 | Ga0068867_1002770422 | 205 |
| 138 | 3300005459 | Ga0068867_100839910 | Ga0068867_1008399101 | 205 |
| 139 | 3300005535 | Ga0070684_100004122 | Ga0070684_1000041224 | 205 |
| 140 | 3300005535 | Ga0070684_100456504 | Ga0070684_1004565042 | 205 |
| 141 | 3300005543 | Ga0070672_100004805 | Ga0070672_1000048057 | 205 |
| 142 | 3300005544 | Ga0070686_100023526 | Ga0070686_1000235264 | 205 |
| 143 | 3300005544 | Ga0070686_100143309 | Ga0070686_1001433092 | 205 |
| 144 | 3300005545 | Ga0070695_100033455 | Ga0070695_1000334553 | 205 |
| 145 | 3300005545 | Ga0070695_100037646 | Ga0070695_1000376463 | 205 |
| 146 | 3300005547 | Ga0070693_100008382 | Ga0070693_1000083826 | 205 |
| 147 | 3300005547 | Ga0070693_100010937 | Ga0070693_1000109373 | 205 |
| 148 | 3300005547 | Ga0070693_100068592 | Ga0070693_1000685923 | 205 |
| 149 | 3300005548 | Ga0070665_100019581 | Ga0070665_1000195812 | 205 |
| 150 | 3300005548 | Ga0070665_100396254 | Ga0070665_1003962542 | 205 |
| 151 | 3300005549 | Ga0070704_100031227 | Ga0070704_1000312273 | 205 |
| 152 | 3300005549 | Ga0070704_100038691 | Ga0070704_1000386912 | 205 |
| 153 | 3300005563 | Ga0068855_100416342 | Ga0068855_1004163422 | 205 |
| 154 | 3300005564 | Ga0070664_100033339 | Ga0070664_1000333393 | 205 |
| 155 | 3300005577 | Ga0068857_100242682 | Ga0068857_1002426822 | 205 |
| 156 | 3300005578 | Ga0068854_100058649 | Ga0068854_1000586494 | 205 |
| 157 | 3300005615 | Ga0070702_100044768 | Ga0070702_1000447683 | 205 |
| 158 | 3300005615 | Ga0070702_100377920 | Ga0070702_1003779202 | 205 |
| 159 | 3300005615 | Ga0070702_100504382 | Ga0070702_1005043821 | 205 |
| 160 | 3300005617 | Ga0068859_100021906 | Ga0068859_1000219064 | 205 |
| 161 | 3300005617 | Ga0068859_100087614 | Ga0068859_1000876143 | 205 |
| 162 | 3300005718 | Ga0068866_10009288 | Ga0068866_100092882 | 205 |
| 163 | 3300005718 | Ga0068866_10025264 | Ga0068866_100252643 | 205 |
| 164 | 3300005719 | Ga0068861_100062330 | Ga0068861_1000623302 | 205 |
| 165 | 3300005719 | Ga0068861_100089558 | Ga0068861_1000895582 | 205 |
| 166 | 3300005834 | Ga0068851_10174417 | Ga0068851_101744171 | 205 |
| 167 | 3300005841 | Ga0068863_100003058 | Ga0068863_1000030583 | 205 |
| 168 | 3300005841 | Ga0068863_100060928 | Ga0068863_1000609284 | 205 |
| 169 | 3300005841 | Ga0068863_101304310 | Ga0068863_1013043101 | 205 |
| 170 | 3300005842 | Ga0068858_100054780 | Ga0068858_1000547802 | 205 |
| 171 | 3300005842 | Ga0068858_100151771 | Ga0068858_1001517712 | 205 |
| 172 | 3300005842 | Ga0068858_100302158 | Ga0068858_1003021582 | 205 |
| 173 | 3300005843 | Ga0068860_100149615 | Ga0068860_1001496152 | 205 |
| 174 | 3300005843 | Ga0068860_100160061 | Ga0068860_1001600613 | 205 |
| 175 | 3300005843 | Ga0068860_100231935 | Ga0068860_1002319352 | 205 |
| 176 | 3300005843 | Ga0068860_100298888 | Ga0068860_1002988883 | 205 |
| 177 | 3300005844 | Ga0068862_100119335 | Ga0068862_1001193352 | 205 |
| 178 | 3300005844 | Ga0068862_100176127 | Ga0068862_1001761273 | 205 |
| 179 | 3300005844 | Ga0068862_100358571 | Ga0068862_1003585712 | 205 |
| 180 | 3300006038 | Ga0075365_10402678 | Ga0075365_104026781 | 205 |
| 181 | 3300006237 | Ga0097621_100008632 | Ga0097621_1000086325 | 205 |
| 182 | 3300006237 | Ga0097621_100056717 | Ga0097621_1000567172 | 205 |
| 183 | 3300006237 | Ga0097621_100232803 | Ga0097621_1002328032 | 205 |
| 184 | 3300006237 | Ga0097621_100541954 | Ga0097621_1005419542 | 205 |
| 185 | 3300006358 | Ga0068871_100006540 | Ga0068871_10000654010 | 205 |
| 186 | 3300006358 | Ga0068871_100070051 | Ga0068871_1000700514 | 205 |
| 187 | 3300006358 | Ga0068871_100099710 | Ga0068871_1000997102 | 205 |
| 188 | 3300006358 | Ga0068871_100538731 | Ga0068871_1005387312 | 205 |
| 189 | 3300006358 | Ga0068871_100927568 | Ga0068871_1009275681 | 205 |
| 190 | 3300006844 | Ga0075428_100025217 | Ga0075428_1000252175 | 205 |
| 191 | 3300006844 | Ga0075428_100042717 | Ga0075428_1000427175 | 205 |
| 192 | 3300006844 | Ga0075428_100490386 | Ga0075428_1004903862 | 205 |
| 193 | 3300006844 | Ga0075428_100840923 | Ga0075428_1008409232 | 205 |
| 194 | 3300006846 | Ga0075430_100144333 | Ga0075430_1001443333 | 205 |
| 195 | 3300006847 | Ga0075431_100052128 | Ga0075431_1000521282 | 205 |
| 196 | 3300006847 | Ga0075431_100095620 | Ga0075431_1000956204 | 205 |
| 197 | 3300006847 | Ga0075431_100158716 | Ga0075431_1001587163 | 205 |
| 198 | 3300006847 | Ga0075431_100306574 | Ga0075431_1003065743 | 205 |
| 199 | 3300006847 | Ga0075431_100467139 | Ga0075431_1004671392 | 205 |
| 200 | 3300006852 | Ga0075433_10100752 | Ga0075433_101007522 | 205 |
| 201 | 3300006852 | Ga0075433_10111144 | Ga0075433_101111443 | 205 |
| 202 | 3300006852 | Ga0075433_10586807 | Ga0075433_105868071 | 205 |
| 203 | 3300006871 | Ga0075434_100061110 | Ga0075434_1000611103 | 205 |
| 204 | 3300006871 | Ga0075434_100131045 | Ga0075434_1001310452 | 205 |
| 205 | 3300006871 | Ga0075434_100337826 | Ga0075434_1003378262 | 205 |
| 206 | 3300006880 | Ga0075429_100002883 | Ga0075429_10000288310 | 205 |
| 207 | 3300006880 | Ga0075429_100022602 | Ga0075429_1000226024 | 205 |
| 208 | 3300006880 | Ga0075429_100038404 | Ga0075429_1000384043 | 205 |
| 209 | 3300006880 | Ga0075429_100289722 | Ga0075429_1002897223 | 205 |
| 210 | 3300006881 | Ga0068865_100010956 | Ga0068865_1000109566 | 205 |
| 211 | 3300006881 | Ga0068865_100307721 | Ga0068865_1003077212 | 205 |
| 212 | 3300006881 | Ga0068865_100623205 | Ga0068865_1006232052 | 205 |
| 213 | 3300006914 | Ga0075436_100371464 | Ga0075436_1003714642 | 205 |
| 214 | 3300006931 | Ga0097620_100021906 | Ga0097620_1000219064 | 205 |
| 215 | 3300006931 | Ga0097620_100087611 | Ga0097620_1000876114 | 205 |
| 216 | 3300007076 | Ga0075435_100005626 | Ga0075435_1000056263 | 205 |
| 217 | 3300007076 | Ga0075435_100011809 | Ga0075435_1000118097 | 205 |
| 218 | 3300007076 | Ga0075435_100155743 | Ga0075435_1001557432 | 205 |
| 219 | 3300007076 | Ga0075435_100653818 | Ga0075435_1006538182 | 205 |
| 220 | 3300009011 | Ga0105251_10063378 | Ga0105251_100633783 | 205 |
| 221 | 3300009094 | Ga0111539_10006629 | Ga0111539_100066299 | 205 |
| 222 | 3300009094 | Ga0111539_10038689 | Ga0111539_100386894 | 205 |
| 223 | 3300009094 | Ga0111539_10041435 | Ga0111539_100414352 | 205 |
| 224 | 3300009094 | Ga0111539_10070770 | Ga0111539_100707702 | 205 |
| 225 | 3300009094 | Ga0111539_11536617 | Ga0111539_115366171 | 205 |
| 226 | 3300009098 | Ga0105245_10081382 | Ga0105245_100813824 | 205 |
| 227 | 3300009098 | Ga0105245_10221922 | Ga0105245_102219222 | 205 |
| 228 | 3300009098 | Ga0105245_10585161 | Ga0105245_105851612 | 205 |
| 229 | 3300009101 | Ga0105247_10440268 | Ga0105247_104402682 | 205 |
| 230 | 3300009147 | Ga0114129_10003469 | Ga0114129_1000346918 | 205 |
| 231 | 3300009147 | Ga0114129_10012628 | Ga0114129_100126282 | 205 |
| 232 | 3300009147 | Ga0114129_10029264 | Ga0114129_100292645 | 205 |
| 233 | 3300009147 | Ga0114129_10218169 | Ga0114129_102181692 | 205 |
| 234 | 3300009147 | Ga0114129_10462937 | Ga0114129_104629372 | 205 |
| 235 | 3300009147 | Ga0114129_11216577 | Ga0114129_112165771 | 205 |
| 236 | 3300009147 | Ga0114129_11776734 | Ga0114129_117767341 | 205 |
| 237 | 3300009148 | Ga0105243_10015769 | Ga0105243_100157694 | 205 |
| 238 | 3300009148 | Ga0105243_10018166 | Ga0105243_100181662 | 205 |
| 239 | 3300009174 | Ga0105241_10174830 | Ga0105241_101748302 | 205 |
| 240 | 3300009176 | Ga0105242_10009583 | Ga0105242_1000958310 | 205 |
| 241 | 3300009176 | Ga0105242_10009773 | Ga0105242_100097732 | 205 |
| 242 | 3300009176 | Ga0105242_10030156 | Ga0105242_100301562 | 205 |
| 243 | 3300009176 | Ga0105242_10299834 | Ga0105242_102998342 | 205 |
| 244 | 3300009176 | Ga0105242_10437967 | Ga0105242_104379672 | 205 |
| 245 | 3300009176 | Ga0105242_10700626 | Ga0105242_107006261 | 205 |
| 246 | 3300009177 | Ga0105248_10006534 | Ga0105248_100065349 | 205 |
| 247 | 3300009177 | Ga0105248_10008866 | Ga0105248_100088669 | 205 |
| 248 | 3300009177 | Ga0105248_10014906 | Ga0105248_100149064 | 205 |
| 249 | 3300009177 | Ga0105248_10030352 | Ga0105248_100303526 | 205 |
| 250 | 3300009177 | Ga0105248_10086249 | Ga0105248_100862492 | 205 |
| 251 | 3300009177 | Ga0105248_10186255 | Ga0105248_101862553 | 205 |
| 252 | 3300009177 | Ga0105248_10298922 | Ga0105248_102989222 | 205 |
| 253 | 3300009177 | Ga0105248_10319874 | Ga0105248_103198742 | 205 |
| 254 | 3300009177 | Ga0105248_10539385 | Ga0105248_105393852 | 205 |
| 255 | 3300009177 | Ga0105248_10688492 | Ga0105248_106884922 | 205 |
| 256 | 3300009545 | Ga0105237_10159854 | Ga0105237_101598541 | 205 |
| 257 | 3300009553 | Ga0105249_10004224 | Ga0105249_100042243 | 205 |
| 258 | 3300009553 | Ga0105249_10062519 | Ga0105249_100625194 | 205 |
| 259 | 3300009553 | Ga0105249_10223362 | Ga0105249_102233623 | 205 |
| 260 | 3300009553 | Ga0105249_10586215 | Ga0105249_105862151 | 205 |
| 261 | 3300009553 | Ga0105249_10734816 | Ga0105249_107348162 | 205 |
| 262 | 3300010375 | Ga0105239_10102512 | Ga0105239_101025122 | 205 |
| 263 | 3300013296 | Ga0157374_10943993 | Ga0157374_109439931 | 205 |
| 264 | 3300013297 | Ga0157378_11412493 | Ga0157378_114124931 | 205 |
| 265 | 3300013308 | Ga0157375_10027120 | Ga0157375_100271202 | 205 |
| 266 | 3300014325 | Ga0163163_10000025 | Ga0163163_10000025141 | 205 |
| 267 | 3300014326 | Ga0157380_10093652 | Ga0157380_100936522 | 205 |
| 268 | 3300014326 | Ga0157380_10153899 | Ga0157380_101538991 | 205 |
| 269 | 3300014326 | Ga0157380_10160535 | Ga0157380_101605352 | 205 |
| 270 | 3300014326 | Ga0157380_10442189 | Ga0157380_104421892 | 205 |
| 271 | 3300014326 | Ga0157380_10737206 | Ga0157380_107372061 | 205 |
| 272 | 3300014745 | Ga0157377_10055872 | Ga0157377_100558723 | 205 |
| 273 | 3300014745 | Ga0157377_10461372 | Ga0157377_104613721 | 205 |
| 274 | 3300014968 | Ga0157379_10030371 | Ga0157379_100303714 | 205 |
| 275 | 3300014968 | Ga0157379_10100418 | Ga0157379_101004184 | 205 |
| 276 | 3300014968 | Ga0157379_10757236 | Ga0157379_107572362 | 205 |
| 277 | 3300014968 | Ga0157379_10790390 | Ga0157379_107903901 | 205 |
| 278 | 3300014969 | Ga0157376_10039285 | Ga0157376_100392853 | 205 |
| 279 | 3300014969 | Ga0157376_10044128 | Ga0157376_100441282 | 205 |
| 280 | 3300014969 | Ga0157376_10400611 | Ga0157376_104006112 | 205 |
| 281 | 3300014969 | Ga0157376_10502547 | Ga0157376_105025472 | 205 |
| 282 | 3300017792 | Ga0163161_10436647 | Ga0163161_104366472 | 205 |
| 283 | 3300025315 | Ga0207697_10008668 | Ga0207697_100086683 | 205 |
| 284 | 3300025315 | Ga0207697_10105570 | Ga0207697_101055702 | 205 |
| 285 | 3300025899 | Ga0207642_10048016 | Ga0207642_100480162 | 205 |
| 286 | 3300025899 | Ga0207642_10155175 | Ga0207642_101551752 | 205 |
| 287 | 3300025901 | Ga0207688_10195229 | Ga0207688_101952292 | 205 |
| 288 | 3300025903 | Ga0207680_10025934 | Ga0207680_100259344 | 205 |
| 289 | 3300025903 | Ga0207680_10261071 | Ga0207680_102610712 | 205 |
| 290 | 3300025903 | Ga0207680_10657948 | Ga0207680_106579481 | 205 |
| 291 | 3300025907 | Ga0207645_10014101 | Ga0207645_100141012 | 205 |
| 292 | 3300025907 | Ga0207645_10027370 | Ga0207645_100273703 | 205 |
| 293 | 3300025912 | Ga0207707_10433331 | Ga0207707_104333312 | 205 |
| 294 | 3300025918 | Ga0207662_10002451 | Ga0207662_100024514 | 205 |
| 295 | 3300025918 | Ga0207662_10055802 | Ga0207662_100558023 | 205 |
| 296 | 3300025920 | Ga0207649_10185604 | Ga0207649_101856042 | 205 |
| 297 | 3300025920 | Ga0207649_10416961 | Ga0207649_104169612 | 205 |
| 298 | 3300025923 | Ga0207681_10082691 | Ga0207681_100826911 | 205 |
| 299 | 3300025923 | Ga0207681_10293450 | Ga0207681_102934502 | 205 |
| 300 | 3300025927 | Ga0207687_10056528 | Ga0207687_100565282 | 205 |
| 301 | 3300025927 | Ga0207687_10057149 | Ga0207687_100571494 | 205 |
| 302 | 3300025931 | Ga0207644_10004228 | Ga0207644_100042288 | 205 |
| 303 | 3300025931 | Ga0207644_10389138 | Ga0207644_103891382 | 205 |
| 304 | 3300025933 | Ga0207706_10093754 | Ga0207706_100937542 | 205 |
| 305 | 3300025933 | Ga0207706_10365115 | Ga0207706_103651151 | 205 |
| 306 | 3300025934 | Ga0207686_10083856 | Ga0207686_100838561 | 205 |
| 307 | 3300025934 | Ga0207686_10086378 | Ga0207686_100863782 | 205 |
| 308 | 3300025934 | Ga0207686_10103346 | Ga0207686_101033463 | 205 |
| 309 | 3300025934 | Ga0207686_10170450 | Ga0207686_101704503 | 205 |
| 310 | 3300025936 | Ga0207670_10074957 | Ga0207670_100749572 | 205 |
| 311 | 3300025936 | Ga0207670_10399439 | Ga0207670_103994392 | 205 |
| 312 | 3300025937 | Ga0207669_10035382 | Ga0207669_100353822 | 205 |
| 313 | 3300025937 | Ga0207669_10452996 | Ga0207669_104529961 | 205 |
| 314 | 3300025938 | Ga0207704_10011067 | Ga0207704_100110672 | 205 |
| 315 | 3300025938 | Ga0207704_10058936 | Ga0207704_100589363 | 205 |
| 316 | 3300025938 | Ga0207704_10114350 | Ga0207704_101143502 | 205 |
| 317 | 3300025938 | Ga0207704_10117190 | Ga0207704_101171903 | 205 |
| 318 | 3300025940 | Ga0207691_10011113 | Ga0207691_100111138 | 205 |
| 319 | 3300025940 | Ga0207691_10025367 | Ga0207691_100253674 | 205 |
| 320 | 3300025940 | Ga0207691_10378288 | Ga0207691_103782882 | 205 |
| 321 | 3300025941 | Ga0207711_10051201 | Ga0207711_100512013 | 205 |
| 322 | 3300025941 | Ga0207711_10052186 | Ga0207711_100521863 | 205 |
| 323 | 3300025941 | Ga0207711_10089484 | Ga0207711_100894842 | 205 |
| 324 | 3300025941 | Ga0207711_10179318 | Ga0207711_101793182 | 205 |
| 325 | 3300025941 | Ga0207711_10230611 | Ga0207711_102306112 | 205 |
| 326 | 3300025941 | Ga0207711_10466694 | Ga0207711_104666942 | 205 |
| 327 | 3300025941 | Ga0207711_10842554 | Ga0207711_108425542 | 205 |
| 328 | 3300025942 | Ga0207689_10052829 | Ga0207689_100528292 | 205 |
| 329 | 3300025945 | Ga0207679_10002789 | Ga0207679_100027895 | 205 |
| 330 | 3300025960 | Ga0207651_10001960 | Ga0207651_100019607 | 205 |
| 331 | 3300025960 | Ga0207651_10103786 | Ga0207651_101037862 | 205 |
| 332 | 3300025960 | Ga0207651_10159153 | Ga0207651_101591532 | 205 |
| 333 | 3300025960 | Ga0207651_10307457 | Ga0207651_103074571 | 205 |
| 334 | 3300025960 | Ga0207651_10332366 | Ga0207651_103323662 | 205 |
| 335 | 3300025961 | Ga0207712_10018045 | Ga0207712_100180455 | 205 |
| 336 | 3300025961 | Ga0207712_10568387 | Ga0207712_105683871 | 205 |
| 337 | 3300025961 | Ga0207712_10787245 | Ga0207712_107872451 | 205 |
| 338 | 3300025972 | Ga0207668_10046419 | Ga0207668_100464192 | 205 |
| 339 | 3300025986 | Ga0207658_10042563 | Ga0207658_100425633 | 205 |
| 340 | 3300025986 | Ga0207658_10056019 | Ga0207658_100560193 | 205 |
| 341 | 3300026023 | Ga0207677_10063699 | Ga0207677_100636992 | 205 |
| 342 | 3300026023 | Ga0207677_10320662 | Ga0207677_103206622 | 205 |
| 343 | 3300026035 | Ga0207703_10159240 | Ga0207703_101592401 | 205 |
| 344 | 3300026035 | Ga0207703_10547810 | Ga0207703_105478102 | 205 |
| 345 | 3300026067 | Ga0207678_10151577 | Ga0207678_101515773 | 205 |
| 346 | 3300026067 | Ga0207678_10303273 | Ga0207678_103032732 | 205 |
| 347 | 3300026067 | Ga0207678_10344769 | Ga0207678_103447691 | 205 |
| 348 | 3300026075 | Ga0207708_10017803 | Ga0207708_100178034 | 205 |
| 349 | 3300026075 | Ga0207708_10283732 | Ga0207708_102837321 | 205 |
| 350 | 3300026075 | Ga0207708_10608230 | Ga0207708_106082302 | 205 |
| 351 | 3300026088 | Ga0207641_10002253 | Ga0207641_100022533 | 205 |
| 352 | 3300026089 | Ga0207648_10009049 | Ga0207648_100090499 | 205 |
| 353 | 3300026089 | Ga0207648_10438375 | Ga0207648_104383752 | 205 |
| 354 | 3300026095 | Ga0207676_11269652 | Ga0207676_112696521 | 205 |
| 355 | 3300026118 | Ga0207675_100035740 | Ga0207675_1000357404 | 205 |
| 356 | 3300026118 | Ga0207675_100078208 | Ga0207675_1000782082 | 205 |
| 357 | 3300026121 | Ga0207683_10157692 | Ga0207683_101576922 | 205 |
| 358 | 3300026142 | Ga0207698_10093503 | Ga0207698_100935032 | 205 |
| 359 | 3300027907 | Ga0207428_10082411 | Ga0207428_100824112 | 205 |
| 360 | 3300028379 | Ga0268266_10006086 | Ga0268266_100060864 | 205 |
| 361 | 3300028379 | Ga0268266_11105666 | Ga0268266_111056661 | 205 |
| 362 | 3300028380 | Ga0268265_10048105 | Ga0268265_100481052 | 205 |
| 363 | 3300028380 | Ga0268265_10163193 | Ga0268265_101631933 | 205 |
| 364 | 3300028380 | Ga0268265_10180659 | Ga0268265_101806591 | 205 |
| 365 | 3300028380 | Ga0268265_10939890 | Ga0268265_109398902 | 205 |
| 366 | 3300028381 | Ga0268264_10070599 | Ga0268264_100705992 | 205 |
| 367 | 3300028381 | Ga0268264_10195614 | Ga0268264_101956141 | 205 |
| 368 | 3300031548 | Ga0307408_100002960 | Ga0307408_1000029609 | 205 |
| 369 | 3300031548 | Ga0307408_100007702 | Ga0307408_1000077021 | 205 |
| 370 | 3300031731 | Ga0307405_10042186 | Ga0307405_100421863 | 205 |
| 371 | 3300031901 | Ga0307406_10015839 | Ga0307406_100158395 | 205 |
| 372 | 3300031911 | Ga0307412_10037028 | Ga0307412_100370283 | 205 |
| 373 | 3300031911 | Ga0307412_10194046 | Ga0307412_101940462 | 205 |
| 374 | 3300031995 | Ga0307409_100562053 | Ga0307409_1005620532 | 205 |
| 375 | 3300032002 | Ga0307416_100046885 | Ga0307416_1000468854 | 205 |
| 376 | 3300032002 | Ga0307416_100812392 | Ga0307416_1008123922 | 205 |
| 377 | 3300032005 | Ga0307411_10011191 | Ga0307411_100111913 | 205 |
| 378 | 3300032005 | Ga0307411_10169281 | Ga0307411_101692812 | 205 |
| 379 | 3300032126 | Ga0307415_100311779 | Ga0307415_1003117791 | 205 |
| 380 | 3300035086 | Ga0373934_0002020 | Ga0373934_0002020_2294_2923 | 205 |
| 381 | 3300035089 | Ga0373944_0054706 | Ga0373944_0054706_541_1173 | 205 |
| 382 | 3300035114 | Ga0373939_0122962 | Ga0373939_0122962_203_835 | 205 |
| 383 | 3300035119 | Ga0373956_0003145 | Ga0373956_0003145_2145_2774 | 205 |
| 384 | 3300035120 | Ga0373957_0016045 | Ga0373957_0016045_1540_2169 | 205 |
| 385 | 3300035170 | Ga0373943_0290172 | Ga0373943_0290172_18_650 | 205 |
| 386 | 3300035172 | Ga0373955_0001206 | Ga0373955_0001206_4601_5230 | 205 |
| 387 | 3300035207 | Ga0373942_0102174 | Ga0373942_0102174_58_690 | 205 |
| 388 | 3300035242 | Ga0373962_0026053 | Ga0373962_0026053_492_1130 | 205 |
| 389 | 3300035410 | Ga0373924_0135223 | Ga0373924_0135223_17_646 | 205 |
| 390 | 3300035691 | Ga0373931_0126900 | Ga0373931_0126900_580_1212 | 205 |
| 391 | 3300036401 | Ga0373937_0011384 | Ga0373937_0011384_2535_3164 | 205 |
| 392 | 3300036401 | Ga0373937_0261246 | Ga0373937_0261246_741_1379 | 205 |
| 393 | 3300037068 | Ga0373925_0761737 | Ga0373925_0761737_34_666 | 205 |
| 394 | 3300037466 | Ga0395898_0490368 | Ga0395898_0490368_256_885 | 205 |
| 395 | 3300041512 | Ga0451853_3294492 | Ga0451853_3294492_24_653 | 205 |
| 396 | 3300042008 | Ga0439450_000552 | Ga0439450_000552_1202_1831 | 205 |
| 397 | 3300042436 | Ga0439435_0025987 | Ga0439435_0025987_316_951 | 205 |
| 398 | 3300042436 | Ga0439435_0036910 | Ga0439435_0036910_101_730 | 205 |
| 399 | 3300042439 | Ga0439464_0001308 | Ga0439464_0001308_215_844 | 205 |
| 400 | 3300042461 | Ga0439460_0014500 | Ga0439460_0014500_1227_1862 | 205 |
| 401 | 3300042530 | Ga0450916_031316 | Ga0450916_031316_47_676 | 205 |
| 402 | 3300042993 | Ga0439440_0066219 | Ga0439440_0066219_189_818 | 205 |
| 403 | 3300045051 | Ga0451576_0143527 | Ga0451576_0143527_287_925 | 205 |
| 404 | 3300045051 | Ga0451576_0279944 | Ga0451576_0279944_855_1484 | 205 |
| 405 | 3300046455 | Ga0495603_0096840 | Ga0495603_0096840_281_913 | 205 |
| 406 | 3300046499 | Ga0495594_0185334 | Ga0495594_0185334_111_740 | 205 |
| 407 | 3300046516 | Ga0495628_0301510 | Ga0495628_0301510_245_874 | 205 |
| 408 | 3300046533 | Ga0495640_0145856 | Ga0495640_0145856_22_651 | 205 |
| 409 | 3300046536 | Ga0495587_0085213 | Ga0495587_0085213_605_1234 | 205 |
| 410 | 3300046543 | Ga0495645_0060087 | Ga0495645_0060087_1532_2161 | 205 |
| 411 | 3300046663 | Ga0495635_0067698 | Ga0495635_0067698_717_1346 | 205 |
| 412 | 3300046678 | Ga0495599_0314049 | Ga0495599_0314049_95_724 | 205 |
| 413 | 3300046681 | Ga0495647_0105647 | Ga0495647_0105647_170_802 | 205 |
| 414 | 3300046683 | Ga0495658_0362563 | Ga0495658_0362563_58_690 | 205 |
| 415 | 3300046809 | Ga0495600_0124336 | Ga0495600_0124336_46_675 | 205 |
| 416 | 3300047471 | Ga0495684_0145119 | Ga0495684_0145119_899_1528 | 205 |
| 417 | 3300048905 | Ga0496102_0028410 | Ga0496102_0028410_2127_2759 | 205 |
| 418 | 3300048905 | Ga0496102_0937153 | Ga0496102_0937153_104_736 | 205 |
| 419 | 3300048906 | Ga0496103_0116173 | Ga0496103_0116173_883_1515 | 205 |
| 420 | 3300048907 | Ga0496104_0006926 | Ga0496104_0006926_6430_7062 | 205 |
| 421 | 3300048907 | Ga0496104_0075772 | Ga0496104_0075772_631_1260 | 205 |
| 422 | 3300048908 | Ga0496105_0016934 | Ga0496105_0016934_4653_5285 | 205 |
| 423 | 3300048909 | Ga0496106_0009161 | Ga0496106_0009161_4628_5260 | 205 |
| 424 | 3300048909 | Ga0496106_0059644 | Ga0496106_0059644_1737_2369 | 205 |
| 425 | 3300048910 | Ga0496107_0214671 | Ga0496107_0214671_256_888 | 205 |
| 426 | 3300048911 | Ga0496108_0027842 | Ga0496108_0027842_2289_2921 | 205 |
| 427 | 3300048912 | Ga0496109_0002983 | Ga0496109_0002983_4974_5606 | 205 |
| 428 | 3300048912 | Ga0496109_0099931 | Ga0496109_0099931_405_1034 | 205 |
| 429 | 3300048913 | Ga0496110_0071520 | Ga0496110_0071520_1895_2527 | 205 |
| 430 | 3300048913 | Ga0496110_1079800 | Ga0496110_1079800_28_660 | 205 |
| 431 | 3300048914 | Ga0496111_0020701 | Ga0496111_0020701_2520_3152 | 205 |
| 432 | 3300048914 | Ga0496111_0072761 | Ga0496111_0072761_1627_2256 | 205 |
| 433 | 3300048915 | Ga0496112_0001961 | Ga0496112_0001961_9209_9838 | 205 |
| 434 | 3300048915 | Ga0496112_0057604 | Ga0496112_0057604_3089_3718 | 205 |
| 435 | 3300048916 | Ga0496113_0096790 | Ga0496113_0096790_1637_2269 | 205 |
| 436 | 3300048917 | Ga0496114_0060433 | Ga0496114_0060433_2102_2731 | 205 |
| 437 | 3300048917 | Ga0496114_0403741 | Ga0496114_0403741_488_1120 | 205 |
| 438 | 3300049514 | Ga0501291_009751 | Ga0501291_009751_592_1221 | 205 |
| 439 | 3300049515 | Ga0501292_004293 | Ga0501292_004293_1095_1724 | 205 |
| 440 | 3300049522 | Ga0501299_003820 | Ga0501299_003820_677_1306 | 205 |
| 441 | 3300049522 | Ga0501299_013337 | Ga0501299_013337_349_978 | 205 |
| 442 | 3300049523 | Ga0501300_025987 | Ga0501300_025987_74_703 | 205 |
| 443 | 3300049525 | Ga0501302_006439 | Ga0501302_006439_16_645 | 205 |
| 444 | 3300049568 | Ga0501031_0013149 | Ga0501031_0013149_4757_5383 | 205 |
| 445 | 3300049573 | Ga0501037_0428459 | Ga0501037_0428459_165_791 | 205 |
| 446 | 3300049574 | Ga0501038_0072745 | Ga0501038_0072745_464_1090 | 205 |
| 447 | 3300049576 | Ga0501040_0161417 | Ga0501040_0161417_625_1251 | 205 |
| 448 | 3300049582 | Ga0501048_0371194 | Ga0501048_0371194_91_780 | 205 |
| 449 | 3300049587 | Ga0501071_0098332 | Ga0501071_0098332_905_1531 | 205 |
| 450 | 3300049587 | Ga0501071_0216837 | Ga0501071_0216837_577_1206 | 205 |
| 451 | 3300049588 | Ga0501072_0034519 | Ga0501072_0034519_1446_2072 | 205 |
| 452 | 3300049590 | Ga0501074_0169684 | Ga0501074_0169684_763_1389 | 205 |
| 453 | 3300049591 | Ga0501075_0218157 | Ga0501075_0218157_717_1343 | 205 |
| 454 | 3300049591 | Ga0501075_0680565 | Ga0501075_0680565_29_658 | 205 |
| 455 | 3300049652 | Ga0501202_025812 | Ga0501202_025812_460_1089 | 205 |
| 456 | 3300049660 | Ga0501216_061444 | Ga0501216_061444_101_730 | 205 |
| 457 | 3300049666 | Ga0501228_005373 | Ga0501228_005373_124_753 | 205 |
| 458 | 3300049743 | Ga0501081_0108791 | Ga0501081_0108791_204_830 | 205 |
| 459 | 3300049743 | Ga0501081_0280909 | Ga0501081_0280909_477_1205 | 205 |
| 460 | 3300049775 | Ga0501279_016643 | Ga0501279_016643_241_870 | 205 |
| 461 | 3300049824 | Ga0501045_0036310 | Ga0501045_0036310_82_708 | 205 |
| 462 | 3300050507 | nmdc:mga05p37_148384_c1 | nmdc:mga05p37_148384_c1_598_1230 | 205 |
| 463 | 3300050507 | nmdc:mga05p37_22542_c1 | nmdc:mga05p37_22542_c1_6780_7412 | 205 |
| 464 | 3300050507 | nmdc:mga05p37_43198_c1 | nmdc:mga05p37_43198_c1_4660_5292 | 205 |
| 465 | 3300050507 | nmdc:mga05p37_5476_c1 | nmdc:mga05p37_5476_c1_12290_12919 | 205 |
| 466 | 3300050507 | nmdc:mga05p37_722787_c1 | nmdc:mga05p37_722787_c1_168_800 | 205 |
| 467 | 3300050508 | nmdc:mga09592_29673_c1 | nmdc:mga09592_29673_c1_1872_2507 | 205 |
| 468 | 3300050508 | nmdc:mga09592_4554_c1 | nmdc:mga09592_4554_c1_9007_9636 | 205 |
| 469 | 3300050509 | nmdc:mga0qj67_2408_c1 | nmdc:mga0qj67_2408_c1_10339_10974 | 205 |
| 470 | 3300050510 | nmdc:mga06r32_107992_c1 | nmdc:mga06r32_107992_c1_945_1574 | 205 |
| 471 | 3300050510 | nmdc:mga06r32_1420_c1 | nmdc:mga06r32_1420_c1_13490_14119 | 205 |
| 472 | 3300050510 | nmdc:mga06r32_429871_c1 | nmdc:mga06r32_429871_c1_374_1003 | 205 |
| 473 | 3300050510 | nmdc:mga06r32_4906_c1 | nmdc:mga06r32_4906_c1_11268_11903 | 205 |
| 474 | 3300050511 | nmdc:mga08y16_29638_c1 | nmdc:mga08y16_29638_c1_2131_2763 | 205 |
| 475 | 3300050511 | nmdc:mga08y16_364464_c1 | nmdc:mga08y16_364464_c1_638_1267 | 205 |
| 476 | 3300050511 | nmdc:mga08y16_37789_c1 | nmdc:mga08y16_37789_c1_960_1592 | 205 |
| 477 | 3300050511 | nmdc:mga08y16_466798_c1 | nmdc:mga08y16_466798_c1_230_859 | 205 |
| 478 | 3300050512 | nmdc:mga0n895_179202_c1 | nmdc:mga0n895_179202_c1_182_814 | 205 |
| 479 | 3300050512 | nmdc:mga0n895_20517_c1 | nmdc:mga0n895_20517_c1_63_695 | 205 |
| 480 | 3300050512 | nmdc:mga0n895_211613_c1 | nmdc:mga0n895_211613_c1_783_1415 | 205 |
| 481 | 3300050512 | nmdc:mga0n895_369823_c1 | nmdc:mga0n895_369823_c1_264_896 | 205 |
| 482 | 3300050512 | nmdc:mga0n895_727367_c1 | nmdc:mga0n895_727367_c1_341_973 | 205 |
| 483 | 3300050513 | nmdc:mga0rr50_19481_c1 | nmdc:mga0rr50_19481_c1_1648_2280 | 205 |
| 484 | 3300050513 | nmdc:mga0rr50_204153_c1 | nmdc:mga0rr50_204153_c1_251_883 | 205 |
| 485 | 3300050513 | nmdc:mga0rr50_437801_c1 | nmdc:mga0rr50_437801_c1_391_1020 | 205 |
| 486 | 3300050513 | nmdc:mga0rr50_703554_c1 | nmdc:mga0rr50_703554_c1_64_693 | 205 |
| 487 | 3300050514 | nmdc:mga08x19_177458_c1 | nmdc:mga08x19_177458_c1_624_1256 | 205 |
| 488 | 3300050515 | nmdc:mga0a205_247655_c1 | nmdc:mga0a205_247655_c1_769_1401 | 205 |
| 489 | 3300050515 | nmdc:mga0a205_44294_c1 | nmdc:mga0a205_44294_c1_1327_1959 | 205 |
| 490 | 3300050515 | nmdc:mga0a205_596132_c1 | nmdc:mga0a205_596132_c1_138_791 | 205 |
| 491 | 3300053077 | Ga0495601_0028066 | Ga0495601_0028066_1821_2450 | 205 |
| 492 | 3300053077 | Ga0495601_0264610 | Ga0495601_0264610_33_671 | 205 |
| 493 | 3300054114 | Ga0501084_0944733 | Ga0501084_0944733_63_692 | 205 |
| 494 | 3300005293 | Ga0065715_10597132 | Ga0065715_105971321 | 206 |
| 495 | 3300025933 | Ga0207706_10121688 | Ga0207706_101216882 | 206 |
| 496 | 3300047319 | Ga0495674_0718365 | Ga0495674_0718365_15_641 | 206 |
| 497 | 3300009177 | Ga0105248_10438998 | Ga0105248_104389982 | 207 |
| 498 | 3300035170 | Ga0373943_0284916 | Ga0373943_0284916_126_749 | 207 |
| 499 | 3300005355 | Ga0070671_100424287 | Ga0070671_1004242871 | 208 |
| 500 | 3300025931 | Ga0207644_10764247 | Ga0207644_107642471 | 208 |
| 501 | 3300036401 | Ga0373937_0120987 | Ga0373937_0120987_332_967 | 210 |
| 502 | 3300046454 | Ga0495592_0102906 | Ga0495592_0102906_1272_1907 | 210 |
| 503 | 3300046462 | Ga0495651_0016618 | Ga0495651_0016618_180_815 | 210 |
| 504 | 3300046514 | Ga0495618_0498362 | Ga0495618_0498362_76_711 | 210 |
| 505 | 3300046536 | Ga0495587_0076980 | Ga0495587_0076980_120_755 | 210 |
| 506 | 3300046559 | Ga0495667_0301761 | Ga0495667_0301761_285_920 | 210 |
| 507 | 3300046679 | Ga0495623_0014988 | Ga0495623_0014988_57_692 | 210 |
| 508 | 3300047444 | Ga0495675_0015080 | Ga0495675_0015080_115_750 | 210 |
| 509 | 3300047471 | Ga0495684_0000351 | Ga0495684_0000351_91_726 | 210 |
| 510 | 3300048088 | Ga0495602_0008376 | Ga0495602_0008376_10002_10637 | 210 |
| 511 | 3300006844 | Ga0075428_100239581 | Ga0075428_1002395812 | 211 |
| 512 | 3300009553 | Ga0105249_10443827 | Ga0105249_104438272 | 211 |
| 513 | 3300046462 | Ga0495651_0279655 | Ga0495651_0279655_305_946 | 211 |
| 514 | 3300046529 | Ga0495652_0161421 | Ga0495652_0161421_406_1047 | 211 |
| 515 | 3300046559 | Ga0495667_0137614 | Ga0495667_0137614_346_987 | 211 |
| 516 | 3300046679 | Ga0495623_0063308 | Ga0495623_0063308_815_1456 | 211 |
| 517 | 3300046689 | Ga0495613_0202969 | Ga0495613_0202969_51_692 | 211 |
| 518 | 3300047471 | Ga0495684_0017137 | Ga0495684_0017137_834_1475 | 211 |
| 519 | 3300048088 | Ga0495602_0092324 | Ga0495602_0092324_879_1520 | 211 |
| 520 | 2162886007 | SwRhRL2b_contig_1373379 | SwRhRL2b_0575.00002160 | 212 |
| 521 | 3300005289 | Ga0065704_10084830 | Ga0065704_100848303 | 212 |
| 522 | 3300005295 | Ga0065707_10113165 | Ga0065707_101131654 | 212 |
| 523 | 3300005340 | Ga0070689_100009451 | Ga0070689_1000094512 | 212 |
| 524 | 3300005365 | Ga0070688_100013809 | Ga0070688_1000138094 | 212 |
| 525 | 3300005367 | Ga0070667_100623749 | Ga0070667_1006237492 | 212 |
| 526 | 3300005842 | Ga0068858_101062702 | Ga0068858_1010627021 | 212 |
| 527 | 3300005844 | Ga0068862_100514191 | Ga0068862_1005141911 | 212 |
| 528 | 3300006844 | Ga0075428_100080253 | Ga0075428_1000802533 | 212 |
| 529 | 3300009553 | Ga0105249_11030283 | Ga0105249_110302831 | 212 |
| 530 | 3300025936 | Ga0207670_10051533 | Ga0207670_100515332 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fse-assembly2.cif.gz_C | crystal structure of the bacillus subtilis regulatory protein gere | 0.9811 | 149 | 212 |
| 6jqs-assembly1.cif.gz_A | structure of transcription factor, gere | 0.9729 | 148 | 211 |
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.9637 | 150 | 204 |
| 1fse-assembly1.cif.gz_A | crystal structure of the bacillus subtilis regulatory protein gere | 0.9559 | 152 | 212 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.9541 | 3 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fseC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9811 | 149 | 212 | 1.10.10.10 |
| 3cloC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9785 | 148 | 204 | 1.10.10.10 |
| 4hyeB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9783 | 150 | 208 | 1.10.10.10 |
| af_P07026_177_240_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9742 | 150 | 208 | 1.10.10.10 |
| 6jqsA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9729 | 148 | 211 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A532E981-F1-model_v4 | Response regulator transcription factor | 0.9804 | 1 | 138 |
GO:0000160
GO:0003677 |
| AF-A0A2V9XY68-F1-model_v4 | Response regulatory domain-containing protein | 0.9797 | 3 | 129 |
GO:0000160
|
| AF-A0A2V9XTX2-F1-model_v4 | Response regulatory domain-containing protein | 0.9796 | 2 | 129 |
GO:0000160
|
| AF-A0A2V8SNV1-F1-model_v4 | Response regulatory domain-containing protein | 0.9791 | 3 | 129 |
GO:0000160
GO:0003677 |
| AF-A0A1F2T8S5-F1-model_v4 | Response regulatory domain-containing protein | 0.9778 | 1 | 129 |
GO:0000160
GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar