metagRoot

F460033

General Info

Members	Datasets	Scaffolds	Average Seq Length
530	297	491	340

Family's Representative Sequence

Representative Sequence	3300053131\|Ga0500652_000447\|Ga0500652_000447_338_1561
Length	407
Sequence	MNQTYGGHSLLRRIKKVLMMHPPLRATQHHLPAGSECINEGARGDGATGRGRILSRPAPDEHFQELRMLTRRHILGSALAVPAILRCGIGTAQAATTLKISHQFPGGTIDNGDFRDRLVRTFAAAIAKQSGGDLVAEVYPDSSLIKADAQFSAMRKGTLDLSLYPLPYAGNELPEANIGLMPGLVSTYDQGLRWKNLPIGKALSDILADKGIMLLTWVWQAGGVASRSRPLVVPEDAKGLTVRGGSREMNMMLQTAGARVLSMPSNEIYAAMKSGACDAGITSSTSLISFKLSEVAKHLTSGAGASYWFMLEPLLMSKAVFDKLPKAHQDILVSVGGEMEAFGKAGAQQDDVEVSRVYEKAGAKVSALDAATVGKWRDIARDTAWKDYVAKTPLTANLLKLALDVPA

Samples

	Sample ID	Description	Type	Environment
1	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
2	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
3	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
4	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
5	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
6	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
7	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
8	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
9	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
10	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
11	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
12	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
13	2831864461	Roseateles noduli HZ7	Isolate	Nodule
14	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
15	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
16	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
17	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
18	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
19	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
20	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
21	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
22	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
23	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
24	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
25	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
26	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
27	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
28	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
29	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
30	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
31	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
32	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
33	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
34	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
35	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
36	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
37	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
38	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
39	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
40	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
41	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
42	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
43	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
44	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
45	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
46	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
47	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
48	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
49	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
50	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
51	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
52	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
53	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
54	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
55	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
56	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
57	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
58	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
59	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
60	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
61	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
62	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
63	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
64	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
65	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
66	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
67	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
68	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
69	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
70	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
71	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
72	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
73	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
74	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
75	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
76	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
77	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
78	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
79	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
80	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
81	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
82	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
83	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
84	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
85	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
87	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
88	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
89	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
90	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
92	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
93	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
94	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
95	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
97	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
98	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
99	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
100	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
101	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
102	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
103	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
104	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
105	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
106	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
107	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
108	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
109	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
110	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
111	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
112	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
114	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
161	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
162	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
163	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
164	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
165	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
166	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
167	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
168	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
169	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
170	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
171	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
172	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
173	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
174	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
175	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
176	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
177	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
178	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
179	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
180	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
181	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
182	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
183	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
184	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
185	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
186	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
187	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
188	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
189	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
190	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
191	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
192	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
193	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
194	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
195	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
196	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
197	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
198	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
199	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
200	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
201	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
202	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
203	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
204	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
205	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
206	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
207	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
208	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
209	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
210	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
211	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
212	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
213	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
214	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
215	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
216	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
217	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
218	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
219	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
220	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
221	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
222	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
223	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
224	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
225	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
226	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
227	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
228	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
229	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
230	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
231	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
232	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
246	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
250	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
252	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
253	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
254	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049762	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control	Metagenome	Rhizosphere
256	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
257	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
258	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
260	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
261	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
262	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
263	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
264	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
265	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
266	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
267	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
268	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
269	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
270	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
271	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
272	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
273	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
274	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
275	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
276	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
277	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
278	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
279	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
280	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
281	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
282	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
283	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
284	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
285	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
286	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
287	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
288	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
289	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
290	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
291	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
292	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
293	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
294	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
295	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
296	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
297	8056689827	Bradyrhizobium semiaridum WSM 1704	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	92.99
Metatranscriptomes	0
Isolates	7.01

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9.06
Nodule	4.72
Rhizoplane	3.77
Rhizosphere	73.96
Stem	0
Stem Tuber	0
Unclassified	8.49

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0055526_1000698	3300003771	Bacteria	25445
2	Ga0065715_10092397	3300005293	Bacteria	5145
3	Ga0070676_10000460	3300005328	Bacteria	19460
4	Ga0070676_10170036	3300005328	Bacteria	1409
5	Ga0070690_100010159	3300005330	Bacteria	5467
6	Ga0070670_100001667	3300005331	Bacteria	18024
7	Ga0070670_100006386	3300005331	Bacteria	9980
8	Ga0070670_100024282	3300005331	Bacteria	5215
9	Ga0070670_100062540	3300005331	Bacteria	3196
10	Ga0070677_10005858	3300005333	Bacteria	4069
11	Ga0068869_100001261	3300005334	Bacteria	14959
12	Ga0068869_100003214	3300005334	Bacteria	9985
13	Ga0070666_10000439	3300005335	Bacteria	25357
14	Ga0070666_10001777	3300005335	Bacteria	13128
15	Ga0070666_10053443	3300005335	Bacteria	2724
16	Ga0070682_100003460	3300005337	Bacteria	8732
17	Ga0070682_100173271	3300005337	Bacteria	1501
18	Ga0068868_100004899	3300005338	Bacteria	9401
19	Ga0068868_100042698	3300005338	Bacteria	3540
20	Ga0070660_100387873	3300005339	Bacteria	1153
21	Ga0070689_100035890	3300005340	Bacteria	3790
22	Ga0070689_100218871	3300005340	Bacteria	1561
23	Ga0070687_100048429	3300005343	Bacteria	2185
24	Ga0070687_100114248	3300005343	Bacteria	1533
25	Ga0070668_100000714	3300005347	Bacteria	22756
26	Ga0070668_100001419	3300005347	Bacteria	17272
27	Ga0070668_100011819	3300005347	Bacteria	6503
28	Ga0070668_100138908	3300005347	Bacteria	1957
29	Ga0070669_100000685	3300005353	Bacteria	24802
30	Ga0070669_100000933	3300005353	Bacteria	21303
31	Ga0070669_100012659	3300005353	Bacteria	5988
32	Ga0070669_100017442	3300005353	Bacteria	5121
33	Ga0070675_100000769	3300005354	Bacteria	22360
34	Ga0070675_100004394	3300005354	Bacteria	10754
35	Ga0070675_100013881	3300005354	Bacteria	6342
36	Ga0070675_100015685	3300005354	Bacteria	5995
37	Ga0070675_100016115	3300005354	Bacteria	5925
38	Ga0070675_100054260	3300005354	Bacteria	3297
39	Ga0070675_100131021	3300005354	Bacteria	2137
40	Ga0070671_100021850	3300005355	Bacteria	5226
41	Ga0070671_100036886	3300005355	Bacteria	4053
42	Ga0070671_100039288	3300005355	Bacteria	3928
43	Ga0070671_100079925	3300005355	Bacteria	2733
44	Ga0070671_100201172	3300005355	Bacteria	1689
45	Ga0070674_100001488	3300005356	Bacteria	12489
46	Ga0070674_100041423	3300005356	Bacteria	3121
47	Ga0070673_100001967	3300005364	Bacteria	12390
48	Ga0070673_100003145	3300005364	Bacteria	10228
49	Ga0070673_100050204	3300005364	Bacteria	3261
50	Ga0070688_100221134	3300005365	Bacteria	1334
51	Ga0070659_100234098	3300005366	Bacteria	1518
52	Ga0070667_100001050	3300005367	Bacteria	25206
53	Ga0070667_100001175	3300005367	Bacteria	23800
54	Ga0070667_100003202	3300005367	Bacteria	14030
55	Ga0070667_100005256	3300005367	Bacteria	10826
56	Ga0070667_100024425	3300005367	Bacteria	5020
57	Ga0070667_100152733	3300005367	Bacteria	2029
58	Ga0070713_100000031	3300005436	Bacteria	88727
59	Ga0070701_10159835	3300005438	Bacteria	1304
60	Ga0070711_100203209	3300005439	Bacteria	1530
61	Ga0070705_100076808	3300005440	Bacteria	2038
62	Ga0070700_100025579	3300005441	Bacteria	3476
63	Ga0070678_100000294	3300005456	Bacteria	23120
64	Ga0070678_100106186	3300005456	Bacteria	2188
65	Ga0070678_100114288	3300005456	Bacteria	2117
66	Ga0070662_100004969	3300005457	Bacteria	8451
67	Ga0070662_100049731	3300005457	Bacteria	3024
68	Ga0070662_100148688	3300005457	Bacteria	1821
69	Ga0070662_100208843	3300005457	Bacteria	1553
70	Ga0068867_100000643	3300005459	Bacteria	23109
71	Ga0068867_100001411	3300005459	Bacteria	16603
72	Ga0068867_100009399	3300005459	Bacteria	6897
73	Ga0070698_100035120	3300005471	Bacteria	5184
74	Ga0070698_100142445	3300005471	Bacteria	2348
75	Ga0070697_100130706	3300005536	Bacteria	2105
76	Ga0068853_100285509	3300005539	Bacteria	1522
77	Ga0070672_100000181	3300005543	Bacteria	34517
78	Ga0070672_100000281	3300005543	Bacteria	28938
79	Ga0070672_100000479	3300005543	Bacteria	23258
80	Ga0070672_100002059	3300005543	Bacteria	12671
81	Ga0070672_100013829	3300005543	Bacteria	5707
82	Ga0070693_100194585	3300005547	Bacteria	1313
83	Ga0070665_100004149	3300005548	Bacteria	15244
84	Ga0070665_100006947	3300005548	Bacteria	11505
85	Ga0070665_100165228	3300005548	Bacteria	2216
86	Ga0070665_100396675	3300005548	Bacteria	1387
87	Ga0068855_100195077	3300005563	Bacteria	2282
88	Ga0070664_100015691	3300005564	Bacteria	6199
89	Ga0070664_100137658	3300005564	Bacteria	2148
90	Ga0068857_100012070	3300005577	Bacteria	7511
91	Ga0068857_100016310	3300005577	Bacteria	6509
92	Ga0068854_100016200	3300005578	Bacteria	4962
93	Ga0068854_100035613	3300005578	Bacteria	3485
94	Ga0068856_100005751	3300005614	Bacteria	12217
95	Ga0068859_100014232	3300005617	Bacteria	7978
96	Ga0068859_100016181	3300005617	Bacteria	7492
97	Ga0068859_100030492	3300005617	Bacteria	5411
98	Ga0068864_100001326	3300005618	Bacteria	20588
99	Ga0068864_100003547	3300005618	Bacteria	12904
100	Ga0068864_100015697	3300005618	Bacteria	6299
101	Ga0068864_100017959	3300005618	Bacteria	5901
102	Ga0068864_100090410	3300005618	Bacteria	2699
103	Ga0068864_100136429	3300005618	Bacteria	2209
104	Ga0068861_100009480	3300005719	Bacteria	6723
105	Ga0068861_100039812	3300005719	Bacteria	3511
106	Ga0068861_100062124	3300005719	Bacteria	2868
107	Ga0068863_100001375	3300005841	Bacteria	24143
108	Ga0068863_100004530	3300005841	Bacteria	13701
109	Ga0068863_100037535	3300005841	Bacteria	4613
110	Ga0068863_100083445	3300005841	Bacteria	3028
111	Ga0068863_100175131	3300005841	Bacteria	2059
112	Ga0068858_100001028	3300005842	Bacteria	28803
113	Ga0068858_100001135	3300005842	Bacteria	27560
114	Ga0068858_100028821	3300005842	Bacteria	5155
115	Ga0068858_100034770	3300005842	Bacteria	4675
116	Ga0068860_100007280	3300005843	Bacteria	11070
117	Ga0068860_100007749	3300005843	Bacteria	10727
118	Ga0068860_100015302	3300005843	Bacteria	7492
119	Ga0068860_100031786	3300005843	Bacteria	5075
120	Ga0068860_100059308	3300005843	Bacteria	3639
121	Ga0068862_100001268	3300005844	Bacteria	23756
122	Ga0068862_100104544	3300005844	Bacteria	2481
123	Ga0068862_100174014	3300005844	Bacteria	1928
124	Ga0081455_10002140	3300005937	Bacteria	23551
125	Ga0081539_10028192	3300005985	Bacteria	3536
126	Ga0075368_10026844	3300006042	Bacteria	2217
127	Ga0075364_10028243	3300006051	Bacteria	3591
128	Ga0075369_10007888	3300006186	Bacteria	4076
129	Ga0097621_100001008	3300006237	Bacteria	19831
130	Ga0097621_100005856	3300006237	Bacteria	8685
131	Ga0097621_100009085	3300006237	Bacteria	7202
132	Ga0097621_100052173	3300006237	Bacteria	3331
133	Ga0097621_100233326	3300006237	Bacteria	1607
134	Ga0075370_10070068	3300006353	Bacteria	2005
135	Ga0068871_100009136	3300006358	Bacteria	7163
136	Ga0068871_100019898	3300006358	Bacteria	5132
137	Ga0068871_100027298	3300006358	Bacteria	4464
138	Ga0068871_100138309	3300006358	Bacteria	2069
139	Ga0075434_100164280	3300006871	Bacteria	2240
140	Ga0068865_100001941	3300006881	Bacteria	12183
141	Ga0068865_100005487	3300006881	Bacteria	7694
142	Ga0068865_100257595	3300006881	Bacteria	1380
143	Ga0097620_100014230	3300006931	Bacteria	7978
144	Ga0097620_100016180	3300006931	Bacteria	7492
145	Ga0097620_100030493	3300006931	Bacteria	5411
146	Ga0075435_100181297	3300007076	Bacteria	1780
147	Ga0105240_10040262	3300009093	Bacteria	5978
148	Ga0105240_10549868	3300009093	Bacteria	1277
149	Ga0105245_10090582	3300009098	Bacteria	2813
150	Ga0105245_10150406	3300009098	Bacteria	2201
151	Ga0105247_10080266	3300009101	Bacteria	2054
152	Ga0105247_10215566	3300009101	Bacteria	1297
153	Ga0114129_10187261	3300009147	Bacteria	2812
154	Ga0114129_10262111	3300009147	Bacteria	2316
155	Ga0105248_10083951	3300009177	Bacteria	3583
156	Ga0105248_10127429	3300009177	Bacteria	2872
157	Ga0105248_10356301	3300009177	Bacteria	1647
158	Ga0105237_10070679	3300009545	Bacteria	3486
159	Ga0105249_10261191	3300009553	Bacteria	1721
160	Ga0105239_10067764	3300010375	Bacteria	3921
161	Ga0105246_10055551	3300011119	Bacteria	2733
162	Ga0105246_10130386	3300011119	Bacteria	1877
163	Ga0157370_10011716	3300013104	Bacteria	9154
164	Ga0157374_10007008	3300013296	Bacteria	9593
165	Ga0157374_10139703	3300013296	Bacteria	2351
166	Ga0157378_10027542	3300013297	Bacteria	5014
167	Ga0157378_10109342	3300013297	Bacteria	2532
168	Ga0163162_10013790	3300013306	Bacteria	7893
169	Ga0163162_10066554	3300013306	Bacteria	3652
170	Ga0163162_10176626	3300013306	Bacteria	2261
171	Ga0157372_10016172	3300013307	Bacteria	8005
172	Ga0157372_10263309	3300013307	Bacteria	2002
173	Ga0157375_10001449	3300013308	Bacteria	20400
174	Ga0157375_10006807	3300013308	Bacteria	9951
175	Ga0157375_10011997	3300013308	Bacteria	7673
176	Ga0157375_10023995	3300013308	Bacteria	5638
177	Ga0157375_10126885	3300013308	Bacteria	2667
178	Ga0157375_10208677	3300013308	Bacteria	2110
179	Ga0157375_10329130	3300013308	Bacteria	1693
180	Ga0163163_10008849	3300014325	Bacteria	8963
181	Ga0163163_10011339	3300014325	Bacteria	8081
182	Ga0163163_10053091	3300014325	Bacteria	4000
183	Ga0163163_10192433	3300014325	Bacteria	2088
184	Ga0163163_10218294	3300014325	Bacteria	1955
185	Ga0157380_10164792	3300014326	Bacteria	1930
186	Ga0157379_10000563	3300014968	Bacteria	29926
187	Ga0157379_10016095	3300014968	Bacteria	6577
188	Ga0157379_10025702	3300014968	Bacteria	5233
189	Ga0157379_10167890	3300014968	Bacteria	1981
190	Ga0157379_10199409	3300014968	Bacteria	1809
191	Ga0157376_10002638	3300014969	Bacteria	12199
192	Ga0157376_10008323	3300014969	Bacteria	7479
193	Ga0157376_10053579	3300014969	Bacteria	3359
194	Ga0163161_10006917	3300017792	Bacteria	7846
195	Ga0209233_1001784	3300025261	Bacteria	8290
196	Ga0209564_1000021	3300025295	Bacteria	571316
197	Ga0207697_10008562	3300025315	Bacteria	4468
198	Ga0207697_10035612	3300025315	Bacteria	2038
199	Ga0207688_10026690	3300025901	Bacteria	3177
200	Ga0207680_10000461	3300025903	Bacteria	19199
201	Ga0207680_10042570	3300025903	Bacteria	2657
202	Ga0207647_10033638	3300025904	Bacteria	3281
203	Ga0207645_10000534	3300025907	Bacteria	31590
204	Ga0207645_10004894	3300025907	Bacteria	9820
205	Ga0207645_10011328	3300025907	Bacteria	6094
206	Ga0207645_10121704	3300025907	Bacteria	1694
207	Ga0207707_10090507	3300025912	Bacteria	2674
208	Ga0207695_10057426	3300025913	Bacteria	4043
209	Ga0207671_10080320	3300025914	Bacteria	2444
210	Ga0207662_10007197	3300025918	Bacteria	6052
211	Ga0207662_10056982	3300025918	Bacteria	2335
212	Ga0207681_10000530	3300025923	Bacteria	26366
213	Ga0207681_10000565	3300025923	Bacteria	25285
214	Ga0207681_10047150	3300025923	Bacteria	2901
215	Ga0207650_10010998	3300025925	Bacteria	6222
216	Ga0207650_10013279	3300025925	Bacteria	5699
217	Ga0207650_10016468	3300025925	Bacteria	5168
218	Ga0207650_10077415	3300025925	Bacteria	2514
219	Ga0207650_10238412	3300025925	Bacteria	1469
220	Ga0207659_10000248	3300025926	Bacteria	32815
221	Ga0207659_10010442	3300025926	Bacteria	5838
222	Ga0207659_10012237	3300025926	Bacteria	5448
223	Ga0207659_10024222	3300025926	Bacteria	4064
224	Ga0207659_10037544	3300025926	Bacteria	3364
225	Ga0207700_10000084	3300025928	Bacteria	58386
226	Ga0207664_10123998	3300025929	Bacteria	2166
227	Ga0207644_10001174	3300025931	Bacteria	16818
228	Ga0207644_10018482	3300025931	Bacteria	4717
229	Ga0207644_10055251	3300025931	Bacteria	2862
230	Ga0207644_10136138	3300025931	Bacteria	1886
231	Ga0207706_10003299	3300025933	Bacteria	15455
232	Ga0207706_10015877	3300025933	Bacteria	6807
233	Ga0207706_10021671	3300025933	Bacteria	5768
234	Ga0207706_10078462	3300025933	Bacteria	2904
235	Ga0207686_10036784	3300025934	Bacteria	2950
236	Ga0207670_10135275	3300025936	Bacteria	1811
237	Ga0207669_10006845	3300025937	Bacteria	5243
238	Ga0207669_10044490	3300025937	Bacteria	2609
239	Ga0207704_10000684	3300025938	Bacteria	15001
240	Ga0207704_10001465	3300025938	Bacteria	10550
241	Ga0207665_10103831	3300025939	Bacteria	1988
242	Ga0207691_10000022	3300025940	Bacteria	132936
243	Ga0207691_10001087	3300025940	Bacteria	27045
244	Ga0207691_10016891	3300025940	Bacteria	6924
245	Ga0207711_10003970	3300025941	Bacteria	12725
246	Ga0207711_10006608	3300025941	Bacteria	9769
247	Ga0207711_10014269	3300025941	Bacteria	6600
248	Ga0207711_10063599	3300025941	Bacteria	3186
249	Ga0207711_10235275	3300025941	Bacteria	1679
250	Ga0207689_10000038	3300025942	Bacteria	94282
251	Ga0207689_10001287	3300025942	Bacteria	24173
252	Ga0207679_10282728	3300025945	Bacteria	1423
253	Ga0207667_10074300	3300025949	Bacteria	3531
254	Ga0207651_10009349	3300025960	Bacteria	5359
255	Ga0207651_10145043	3300025960	Bacteria	1839
256	Ga0207712_10002887	3300025961	Bacteria	10982
257	Ga0207668_10001216	3300025972	Bacteria	15297
258	Ga0207668_10005408	3300025972	Bacteria	7521
259	Ga0207668_10013039	3300025972	Bacteria	5106
260	Ga0207668_10021289	3300025972	Bacteria	4134
261	Ga0207668_10022414	3300025972	Bacteria	4043
262	Ga0207668_10046150	3300025972	Bacteria	2976
263	Ga0207640_10125791	3300025981	Bacteria	1845
264	Ga0207658_10000311	3300025986	Bacteria	49445
265	Ga0207658_10000576	3300025986	Bacteria	33039
266	Ga0207658_10002076	3300025986	Bacteria	14913
267	Ga0207658_10023864	3300025986	Bacteria	4273
268	Ga0207658_10153629	3300025986	Bacteria	1878
269	Ga0207658_10223564	3300025986	Bacteria	1585
270	Ga0207677_10002948	3300026023	Bacteria	8989
271	Ga0207677_10148646	3300026023	Bacteria	1804
272	Ga0207703_10001247	3300026035	Bacteria	23852
273	Ga0207703_10004706	3300026035	Bacteria	11139
274	Ga0207703_10010184	3300026035	Bacteria	7368
275	Ga0207703_10029217	3300026035	Bacteria	4348
276	Ga0207678_10108845	3300026067	Bacteria	2364
277	Ga0207678_10150007	3300026067	Bacteria	1990
278	Ga0207708_10013718	3300026075	Bacteria	6054
279	Ga0207702_10182696	3300026078	Bacteria	1932
280	Ga0207641_10001378	3300026088	Bacteria	23986
281	Ga0207641_10019358	3300026088	Bacteria	5586
282	Ga0207641_10049080	3300026088	Bacteria	3565
283	Ga0207641_10049487	3300026088	Bacteria	3551
284	Ga0207641_10151236	3300026088	Bacteria	2102
285	Ga0207641_10152420	3300026088	Bacteria	2094
286	Ga0207641_10378232	3300026088	Bacteria	1355
287	Ga0207641_10487895	3300026088	Bacteria	1195
288	Ga0207648_10001109	3300026089	Bacteria	30196
289	Ga0207648_10005992	3300026089	Bacteria	12147
290	Ga0207648_10023380	3300026089	Bacteria	5537
291	Ga0207676_10002543	3300026095	Bacteria	13020
292	Ga0207676_10008449	3300026095	Bacteria	7321
293	Ga0207676_10012864	3300026095	Bacteria	6008
294	Ga0207676_10016858	3300026095	Bacteria	5289
295	Ga0207676_10042365	3300026095	Bacteria	3501
296	Ga0207676_10054069	3300026095	Bacteria	3145
297	Ga0207676_10121439	3300026095	Bacteria	2204
298	Ga0207674_10016868	3300026116	Bacteria	7980
299	Ga0207675_100000463	3300026118	Bacteria	39539
300	Ga0207675_100014096	3300026118	Bacteria	7453
301	Ga0207675_100054522	3300026118	Bacteria	3730
302	Ga0207683_10000108	3300026121	Bacteria	66917
303	Ga0207683_10159239	3300026121	Bacteria	2040
304	Ga0207698_10101332	3300026142	Bacteria	2388
305	Ga0268266_10021508	3300028379	Bacteria	5495
306	Ga0268266_10074453	3300028379	Bacteria	2948
307	Ga0268265_10092576	3300028380	Bacteria	2420
308	Ga0268265_10141271	3300028380	Bacteria	2016
309	Ga0268265_10294824	3300028380	Bacteria	1457
310	Ga0268265_10483946	3300028380	Bacteria	1163
311	Ga0268264_10002130	3300028381	Bacteria	17661
312	Ga0268264_10005075	3300028381	Bacteria	11153
313	Ga0268264_10005666	3300028381	Bacteria	10587
314	Ga0268264_10019672	3300028381	Bacteria	5515
315	Ga0268264_10606331	3300028381	Bacteria	1079
316	Ga0307515_10020398	3300028794	Bacteria	11827
317	Ga0307515_10088474	3300028794	Bacteria	3914
318	Ga0307515_10106382	3300028794	Bacteria	3329
319	Ga0307512_10034214	3300030522	Bacteria	4351
320	Ga0307512_10085209	3300030522	Bacteria	2241
321	Ga0265332_10000003	3300031238	Bacteria	482849
322	Ga0265329_10008513	3300031242	Bacteria	3884
323	Ga0265327_10008530	3300031251	Bacteria	7612
324	Ga0265316_10015356	3300031344	Bacteria	6699
325	Ga0307509_10011769	3300031507	Bacteria	10546
326	Ga0307509_10205244	3300031507	Bacteria	1802
327	Ga0307408_100000165	3300031548	Bacteria	73853
328	Ga0307508_10000028	3300031616	Bacteria	168639
329	Ga0307514_10035387	3300031649	Bacteria	3975
330	Ga0265314_10041309	3300031711	Bacteria	3302
331	Ga0307516_10219015	3300031730	Bacteria	1614
332	Ga0307518_10023668	3300031838	Bacteria	4427
333	Ga0307507_10247193	3300033179	Bacteria	1158
334	Ga0307510_10009944	3300033180	Bacteria	11306
335	Ga0307510_10018239	3300033180	Bacteria	8262
336	Ga0307510_10038889	3300033180	Bacteria	5251
337	Ga0315911_1000001	3300033442	Bacteria	1088602
338	Ga0373939_0000013	3300035114	Bacteria	66615
339	Ga0373962_0005935	3300035242	Bacteria	2948
340	Ga0373924_0004529	3300035410	Bacteria	4859
341	Ga0373931_0000279	3300035691	Bacteria	21420
342	Ga0373935_0034953	3300035692	Bacteria	3135
343	Ga0373937_0013470	3300036401	Bacteria	7203
344	Ga0373925_0019373	3300037068	Bacteria	4948
345	Ga0395898_0165234	3300037466	Bacteria	2117
346	Ga0395905_0025148	3300037471	Bacteria	5616
347	Ga0436365_1577438	3300039437	Bacteria	2661
348	Ga0451853_3187830	3300041512	Bacteria	1302
349	Ga0466969_0029897	3300044656	Bacteria	2779
350	Ga0466969_0079201	3300044656	Bacteria	1570
351	Ga0466977_0000597	3300044666	Bacteria	12375
352	Ga0453683_0033451	3300044673	Bacteria	3242
353	Ga0466961_0010277	3300044693	Bacteria	5964
354	Ga0466964_0063147	3300044706	Bacteria	1546
355	Ga0453684_0001745	3300044712	Bacteria	58185
356	Ga0453684_0020448	3300044712	Bacteria	9980
357	Ga0453684_0036852	3300044712	Bacteria	6730
358	Ga0466971_0005608	3300044719	Bacteria	5457
359	Ga0466957_0053381	3300044842	Bacteria	2464
360	Ga0466959_0008965	3300045049	Bacteria	7098
361	Ga0451576_0045999	3300045051	Bacteria	4596
362	Ga0495580_0152082	3300046472	Bacteria	1603
363	Ga0495580_0169269	3300046472	Bacteria	1511
364	Ga0495662_0126046	3300046476	Bacteria	1258
365	Ga0495610_0060035	3300046512	Bacteria	1812
366	Ga0495616_0033971	3300046513	Bacteria	2652
367	Ga0495618_0111960	3300046514	Bacteria	1748
368	Ga0495620_0019429	3300046515	Bacteria	3342
369	Ga0495631_0038613	3300046518	Bacteria	2122
370	Ga0495637_0041538	3300046520	Bacteria	1972
371	Ga0495643_0076647	3300046522	Bacteria	1748
372	Ga0495648_0041965	3300046524	Bacteria	2883
373	Ga0495648_0053243	3300046524	Bacteria	2453
374	Ga0495666_0031177	3300046526	Bacteria	2613
375	Ga0495661_0015311	3300046665	Bacteria	5120
376	Ga0495670_0015632	3300046691	Bacteria	3729
377	Ga0495686_0048896	3300047472	Bacteria	2664
378	Ga0495626_0063676	3300048091	Bacteria	1672
379	Ga0496102_0022704	3300048905	Bacteria	5561
380	Ga0496102_0093842	3300048905	Bacteria	2780
381	Ga0496103_0070630	3300048906	Bacteria	2185
382	Ga0496104_0038043	3300048907	Bacteria	4500
383	Ga0496104_0410776	3300048907	Bacteria	1266
384	Ga0496106_0058109	3300048909	Bacteria	2927
385	Ga0496106_0161108	3300048909	Bacteria	1774
386	Ga0496108_0006568	3300048911	Bacteria	9438
387	Ga0496108_0022444	3300048911	Bacteria	5188
388	Ga0496108_0149569	3300048911	Bacteria	2015
389	Ga0496109_0108146	3300048912	Bacteria	2584
390	Ga0496109_0125289	3300048912	Bacteria	2395
391	Ga0496110_0021413	3300048913	Bacteria	5474
392	Ga0496110_0553360	3300048913	Bacteria	1045
393	Ga0496111_0077750	3300048914	Bacteria	2419
394	Ga0496112_0010074	3300048915	Bacteria	8559
395	Ga0496112_0010749	3300048915	Bacteria	8324
396	Ga0496113_0298804	3300048916	Bacteria	1289
397	Ga0496116_0002899	3300048919	Bacteria	17527
398	Ga0496117_0172325	3300048920	Bacteria	1254
399	Ga0496118_0055995	3300048921	Bacteria	2968
400	Ga0496118_0119729	3300048921	Bacteria	1720
401	Ga0496120_0019035	3300048923	Bacteria	4406
402	Ga0496121_0018922	3300048924	Bacteria	6911
403	Ga0496121_0066049	3300048924	Bacteria	2939
404	Ga0496122_0004313	3300048925	Bacteria	17814
405	Ga0496123_0017810	3300048926	Bacteria	5689
406	Ga0496125_0000193	3300048928	Bacteria	130315
407	Ga0496125_0003947	3300048928	Bacteria	17499
408	Ga0496125_0005527	3300048928	Bacteria	13996
409	Ga0496125_0022402	3300048928	Bacteria	5867
410	Ga0496126_0021765	3300048929	Bacteria	6254
411	Ga0501300_002645	3300049523	Bacteria	2685
412	Ga0501031_0002032	3300049568	Bacteria	12739
413	Ga0501032_0005601	3300049569	Bacteria	9305
414	Ga0501033_0000025	3300049570	Bacteria	173634
415	Ga0501034_0000656	3300049571	Bacteria	53197
416	Ga0501034_0039963	3300049571	Bacteria	4751
417	Ga0501036_0004395	3300049572	Bacteria	11377
418	Ga0501037_0000034	3300049573	Bacteria	126321
419	Ga0501038_0000286	3300049574	Bacteria	43041
420	Ga0501039_0000911	3300049575	Bacteria	21570
421	Ga0501043_0001282	3300049579	Bacteria	22062
422	Ga0501046_0001334	3300049580	Bacteria	23903
423	Ga0501047_0000061	3300049581	Bacteria	137341
424	Ga0501047_0033539	3300049581	Bacteria	4956
425	Ga0501048_0000009	3300049582	Bacteria	84404
426	Ga0501068_0000288	3300049584	Bacteria	25058
427	Ga0501069_0000266	3300049585	Bacteria	23651
428	Ga0501070_0005997	3300049586	Bacteria	10346
429	Ga0501070_0066030	3300049586	Bacteria	2996
430	Ga0501070_0161935	3300049586	Bacteria	1844
431	Ga0501071_0073682	3300049587	Bacteria	2491
432	Ga0501072_0001729	3300049588	Bacteria	16275
433	Ga0501073_0010490	3300049589	Bacteria	6792
434	Ga0501074_0000048	3300049590	Bacteria	56982
435	Ga0501074_0089717	3300049590	Bacteria	2202
436	Ga0501235_002194	3300049669	Bacteria	4197
437	Ga0501221_001419	3300049704	Bacteria	3958
438	Ga0501080_0000342	3300049742	Bacteria	35816
439	Ga0501083_0000765	3300049744	Bacteria	21045
440	Ga0501265_003742	3300049762	Bacteria	1729
441	Ga0501267_000345	3300049764	Bacteria	3462
442	Ga0501035_0000300	3300049822	Bacteria	58171
443	Ga0501035_0022344	3300049822	Bacteria	5809
444	Ga0501035_0328567	3300049822	Bacteria	1283
445	Ga0501044_0000028	3300049823	Bacteria	179203
446	Ga0501044_0043023	3300049823	Bacteria	4694
447	nmdc:mga03683_62265_c1	3300050489	Bacteria	1580
448	nmdc:mga0k408_214155_c1	3300050493	Bacteria	1150
449	nmdc:mga0k408_93027_c1	3300050493	Bacteria	1773
450	nmdc:mga04h51_49199_c1	3300050495	Bacteria	1407
451	nmdc:mga07m45_2472_c2	3300050496	Bacteria	6413
452	nmdc:mga07m45_28078_c1	3300050496	Bacteria	3105
453	nmdc:mga07m45_44869_c1	3300050496	Bacteria	2481
454	nmdc:mga0n895_200728_c1	3300050512	Bacteria	2025
455	nmdc:mga0sz30_1972_c2	3300050516	Bacteria	4240
456	Ga0500643_012910	3300053087	Bacteria	2975
457	Ga0500646_0029021	3300053090	Bacteria	1513
458	Ga0500651_0004509	3300053093	Bacteria	7806
459	Ga0500566_0001033	3300053094	Bacteria	16086
460	Ga0500650_0014246	3300053098	Bacteria	3359
461	Ga0500556_0000004	3300053104	Bacteria	666287
462	Ga0500569_000340	3300053109	Bacteria	7500
463	Ga0500594_0003700	3300053118	Bacteria	3371
464	Ga0500595_000914	3300053119	Bacteria	16816
465	Ga0500595_007110	3300053119	Bacteria	4679
466	Ga0500607_024962	3300053121	Bacteria	3332
467	Ga0500607_042438	3300053121	Bacteria	2456
468	Ga0500608_000425	3300053122	Bacteria	16046
469	Ga0500642_0000010	3300053130	Bacteria	272552
470	Ga0500652_000447	3300053131	Bacteria	14605
471	Ga0500559_0000116	3300053136	Bacteria	63080
472	Ga0500559_0001110	3300053136	Bacteria	16223
473	Ga0500568_0002526	3300053139	Bacteria	10695
474	Ga0500577_0000093	3300053142	Bacteria	21381
475	Ga0500577_0019480	3300053142	Bacteria	2202
476	Ga0500590_011326	3300053148	Bacteria	4515
477	Ga0500590_014369	3300053148	Bacteria	4080
478	Ga0500604_0005105	3300053151	Bacteria	3470
479	Ga0500616_0000014	3300053153	Bacteria	637918
480	Ga0500616_0000283	3300053153	Bacteria	74456
481	Ga0500619_000014	3300053154	Bacteria	55951
482	Ga0500622_0005791	3300053156	Bacteria	7328
483	Ga0500622_0089317	3300053156	Bacteria	1531
484	Ga0500636_0002335	3300053177	Bacteria	10528
485	Ga0500636_0014700	3300053177	Bacteria	4605
486	Ga0500636_0143154	3300053177	Bacteria	1321
487	Ga0500645_004582	3300053730	Bacteria	5267
488	Ga0500596_009408	3300053735	Bacteria	1525
489	Ga0501084_0001128	3300054114	Bacteria	20843
490	Ga0501082_0012441	3300060353	Bacteria	7313
491	Ga0466962_0038859	3300061719	Bacteria	2279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031616	Ga0307508_10000028	Ga0307508_10000028133	316
2	3300028794	Ga0307515_10020398	Ga0307515_1002039812	318
3	3300031507	Ga0307509_10011769	Ga0307509_100117698	318
4	3300049581	Ga0501047_0033539	Ga0501047_0033539_1562_2593	318
5	3300049586	Ga0501070_0066030	Ga0501070_0066030_518_1549	318
6	3300049822	Ga0501035_0022344	Ga0501035_0022344_1978_3009	318
7	3300049823	Ga0501044_0043023	Ga0501044_0043023_480_1511	318
8	3300048928	Ga0496125_0000193	Ga0496125_0000193_123307_124329	320
9	3300009101	Ga0105247_10215566	Ga0105247_102155662	322
10	3300025986	Ga0207658_10153629	Ga0207658_101536292	323
11	3300048921	Ga0496118_0119729	Ga0496118_0119729_443_1459	324
12	3300048924	Ga0496121_0018922	Ga0496121_0018922_1473_2489	326
13	3300053093	Ga0500651_0004509	Ga0500651_0004509_4557_5573	326
14	3300035692	Ga0373935_0034953	Ga0373935_0034953_1238_2260	327
15	3300046472	Ga0495580_0152082	Ga0495580_0152082_77_1099	327
16	3300046476	Ga0495662_0126046	Ga0495662_0126046_94_1116	327
17	3300053730	Ga0500645_004582	Ga0500645_004582_4015_5034	328
18	iso_pu_bacteria	2513237096	2513656819	330
19	iso_pu_bacteria	2513237101	2513692313	330
20	iso_pu_bacteria	2513237137	2513858007	330
21	iso_pu_bacteria	2513237145	2513918004	330
22	iso_pu_bacteria	2517572143	2517892951	330
23	iso_pu_bacteria	2524023228	2524536954	330
24	iso_pu_bacteria	2602042107	2603859258	330
25	iso_pu_bacteria	2667528175	2671117578	330
26	iso_pu_bacteria	2791355197	2793073061	330
27	iso_pu_bacteria	2857524615	2857529330	330
28	iso_pu_bacteria	2874604998	2874608780	330
29	iso_pu_bacteria	2876808645	2876812173	330
30	iso_pu_bacteria	2879110137	2879111475	330
31	iso_pu_bacteria	2885374607	2885375129	330
32	iso_pu_bacteria	2893066018	2893071451	330
33	iso_pu_bacteria	2903748898	2903757739	330
34	iso_pu_bacteria	2904690495	2904696371	330
35	iso_pu_bacteria	2904699407	2904703112	330
36	iso_pu_bacteria	2906635258	2906639422	330
37	iso_pu_bacteria	2906660503	2906661541	330
38	iso_pu_bacteria	2908739725	2908743345	330
39	iso_pu_bacteria	2908756301	2908760844	330
40	iso_pu_bacteria	2919073203	2919076837	330
41	iso_pu_bacteria	2922425934	2922429553	330
42	iso_pu_bacteria	2935630451	2935633582	330
43	iso_pu_bacteria	2941507105	2941510473	330
44	iso_pu_bacteria	2941515067	2941517789	330
45	iso_pu_bacteria	2941523033	2941525806	330
46	iso_pu_bacteria	3005474847	3005479713	330
47	iso_pu_bacteria	8006933436	8006941393	330
48	iso_pu_bacteria	8006973647	8006981101	330
49	iso_pu_bacteria	8006994254	8007000566	330
50	iso_pu_bacteria	8019555841	8019557313	330
51	iso_pu_bacteria	8019565922	8019567989	330
52	iso_pu_bacteria	8056689827	8056693696	330
53	3300005366	Ga0070659_100234098	Ga0070659_1002340982	332
54	3300005563	Ga0068855_100195077	Ga0068855_1001950772	332
55	3300013104	Ga0157370_10011716	Ga0157370_100117168	332
56	3300013307	Ga0157372_10263309	Ga0157372_102633093	332
57	3300025904	Ga0207647_10033638	Ga0207647_100336383	332
58	3300025912	Ga0207707_10090507	Ga0207707_100905072	332
59	3300025949	Ga0207667_10074300	Ga0207667_100743003	332
60	3300037466	Ga0395898_0165234	Ga0395898_0165234_1027_2046	332
61	3300045051	Ga0451576_0045999	Ga0451576_0045999_1578_2594	332
62	3300049568	Ga0501031_0002032	Ga0501031_0002032_3315_4331	332
63	3300049569	Ga0501032_0005601	Ga0501032_0005601_4896_5912	332
64	3300049570	Ga0501033_0000025	Ga0501033_0000025_52604_53620	332
65	3300049571	Ga0501034_0000656	Ga0501034_0000656_36845_37861	332
66	3300049571	Ga0501034_0039963	Ga0501034_0039963_2709_3725	332
67	3300049572	Ga0501036_0004395	Ga0501036_0004395_2508_3524	332
68	3300049573	Ga0501037_0000034	Ga0501037_0000034_80399_81415	332
69	3300049574	Ga0501038_0000286	Ga0501038_0000286_26743_27759	332
70	3300049575	Ga0501039_0000911	Ga0501039_0000911_3341_4357	332
71	3300049579	Ga0501043_0001282	Ga0501043_0001282_4968_5984	332
72	3300049580	Ga0501046_0001334	Ga0501046_0001334_3047_4063	332
73	3300049581	Ga0501047_0000061	Ga0501047_0000061_26839_27855	332
74	3300049582	Ga0501048_0000009	Ga0501048_0000009_35261_36277	332
75	3300049584	Ga0501068_0000288	Ga0501068_0000288_15249_16265	332
76	3300049585	Ga0501069_0000266	Ga0501069_0000266_5726_6742	332
77	3300049586	Ga0501070_0005997	Ga0501070_0005997_7882_8898	332
78	3300049586	Ga0501070_0161935	Ga0501070_0161935_257_1273	332
79	3300049587	Ga0501071_0073682	Ga0501071_0073682_170_1186	332
80	3300049588	Ga0501072_0001729	Ga0501072_0001729_3623_4639	332
81	3300049589	Ga0501073_0010490	Ga0501073_0010490_2730_3746	332
82	3300049590	Ga0501074_0000048	Ga0501074_0000048_9344_10360	332
83	3300049590	Ga0501074_0089717	Ga0501074_0089717_1175_2191	332
84	3300049742	Ga0501080_0000342	Ga0501080_0000342_1422_2438	332
85	3300049744	Ga0501083_0000765	Ga0501083_0000765_13614_14630	332
86	3300049822	Ga0501035_0000300	Ga0501035_0000300_36116_37132	332
87	3300049822	Ga0501035_0328567	Ga0501035_0328567_156_1172	332
88	3300049823	Ga0501044_0000028	Ga0501044_0000028_55080_56096	332
89	3300053119	Ga0500595_000914	Ga0500595_000914_7502_8518	332
90	3300053119	Ga0500595_007110	Ga0500595_007110_718_1734	332
91	3300053153	Ga0500616_0000283	Ga0500616_0000283_7910_8923	332
92	3300053177	Ga0500636_0014700	Ga0500636_0014700_2586_3602	332
93	3300054114	Ga0501084_0001128	Ga0501084_0001128_6002_7018	332
94	3300060353	Ga0501082_0012441	Ga0501082_0012441_2531_3547	332
95	iso_pu_bacteria	2738541337	2739057307	332
96	3300048929	Ga0496126_0021765	Ga0496126_0021765_904_2019	333
97	3300006042	Ga0075368_10026844	Ga0075368_100268443	334
98	3300006051	Ga0075364_10028243	Ga0075364_100282431	334
99	3300006186	Ga0075369_10007888	Ga0075369_100078887	334
100	3300011119	Ga0105246_10055551	Ga0105246_100555513	334
101	3300014325	Ga0163163_10053091	Ga0163163_100530914	334
102	3300025261	Ga0209233_1001784	Ga0209233_10017842	334
103	3300025914	Ga0207671_10080320	Ga0207671_100803202	334
104	3300025929	Ga0207664_10123998	Ga0207664_101239983	334
105	3300026067	Ga0207678_10150007	Ga0207678_101500071	334
106	3300028794	Ga0307515_10088474	Ga0307515_100884743	334
107	3300033442	Ga0315911_1000001	Ga0315911_1000001923	334
108	3300046512	Ga0495610_0060035	Ga0495610_0060035_455_1477	334
109	3300046513	Ga0495616_0033971	Ga0495616_0033971_1070_2092	334
110	3300046515	Ga0495620_0019429	Ga0495620_0019429_1143_2165	334
111	3300046518	Ga0495631_0038613	Ga0495631_0038613_572_1594	334
112	3300046520	Ga0495637_0041538	Ga0495637_0041538_868_1890	334
113	3300046522	Ga0495643_0076647	Ga0495643_0076647_118_1140	334
114	3300046524	Ga0495648_0041965	Ga0495648_0041965_898_1920	334
115	3300046665	Ga0495661_0015311	Ga0495661_0015311_4034_5056	334
116	3300046691	Ga0495670_0015632	Ga0495670_0015632_696_1718	334
117	3300047472	Ga0495686_0048896	Ga0495686_0048896_502_1524	334
118	3300048091	Ga0495626_0063676	Ga0495626_0063676_266_1288	334
119	3300048905	Ga0496102_0022704	Ga0496102_0022704_3425_4447	334
120	3300048907	Ga0496104_0038043	Ga0496104_0038043_1827_2849	334
121	3300048909	Ga0496106_0161108	Ga0496106_0161108_91_1113	334
122	3300048911	Ga0496108_0022444	Ga0496108_0022444_1094_2116	334
123	3300048912	Ga0496109_0108146	Ga0496109_0108146_1505_2527	334
124	3300048913	Ga0496110_0021413	Ga0496110_0021413_3999_5021	334
125	3300048913	Ga0496110_0553360	Ga0496110_0553360_13_1035	334
126	3300048915	Ga0496112_0010749	Ga0496112_0010749_3302_4324	334
127	3300048916	Ga0496113_0298804	Ga0496113_0298804_10_1032	334
128	3300048919	Ga0496116_0002899	Ga0496116_0002899_2713_3735	334
129	3300048920	Ga0496117_0172325	Ga0496117_0172325_203_1225	334
130	3300048921	Ga0496118_0055995	Ga0496118_0055995_400_1422	334
131	3300048923	Ga0496120_0019035	Ga0496120_0019035_2656_3678	334
132	3300048924	Ga0496121_0066049	Ga0496121_0066049_1192_2214	334
133	3300048925	Ga0496122_0004313	Ga0496122_0004313_14195_15217	334
134	3300048926	Ga0496123_0017810	Ga0496123_0017810_3234_4256	334
135	3300048928	Ga0496125_0003947	Ga0496125_0003947_7892_8914	334
136	3300048928	Ga0496125_0005527	Ga0496125_0005527_5737_6759	334
137	3300048928	Ga0496125_0022402	Ga0496125_0022402_547_1569	334
138	3300050496	nmdc:mga07m45_44869_c1	nmdc:mga07m45_44869_c1_1244_2266	334
139	3300050516	nmdc:mga0sz30_1972_c2	nmdc:mga0sz30_1972_c2_196_1218	334
140	3300053087	Ga0500643_012910	Ga0500643_012910_255_1277	334
141	3300053090	Ga0500646_0029021	Ga0500646_0029021_107_1129	334
142	3300053094	Ga0500566_0001033	Ga0500566_0001033_14478_15500	334
143	3300053098	Ga0500650_0014246	Ga0500650_0014246_2014_3036	334
144	3300053104	Ga0500556_0000004	Ga0500556_0000004_155850_156872	334
145	3300053109	Ga0500569_000340	Ga0500569_000340_1640_2662	334
146	3300053118	Ga0500594_0003700	Ga0500594_0003700_602_1624	334
147	3300053121	Ga0500607_042438	Ga0500607_042438_148_1170	334
148	3300053122	Ga0500608_000425	Ga0500608_000425_6788_7810	334
149	3300053130	Ga0500642_0000010	Ga0500642_0000010_246791_247813	334
150	3300053136	Ga0500559_0001110	Ga0500559_0001110_3720_4742	334
151	3300053139	Ga0500568_0002526	Ga0500568_0002526_437_1459	334
152	3300053142	Ga0500577_0000093	Ga0500577_0000093_19995_21017	334
153	3300053142	Ga0500577_0019480	Ga0500577_0019480_170_1192	334
154	3300053148	Ga0500590_011326	Ga0500590_011326_194_1216	334
155	3300053153	Ga0500616_0000014	Ga0500616_0000014_177240_178262	334
156	3300053177	Ga0500636_0002335	Ga0500636_0002335_7020_8042	334
157	3300053735	Ga0500596_009408	Ga0500596_009408_421_1443	334
158	3300005337	Ga0070682_100173271	Ga0070682_1001732711	335
159	3300005355	Ga0070671_100201172	Ga0070671_1002011721	335
160	3300005367	Ga0070667_100152733	Ga0070667_1001527332	335
161	3300005456	Ga0070678_100106186	Ga0070678_1001061863	335
162	3300005471	Ga0070698_100035120	Ga0070698_1000351205	335
163	3300005471	Ga0070698_100142445	Ga0070698_1001424452	335
164	3300005536	Ga0070697_100130706	Ga0070697_1001307063	335
165	3300005617	Ga0068859_100030492	Ga0068859_1000304924	335
166	3300005618	Ga0068864_100090410	Ga0068864_1000904103	335
167	3300005841	Ga0068863_100083445	Ga0068863_1000834452	335
168	3300005937	Ga0081455_10002140	Ga0081455_100021405	335
169	3300006237	Ga0097621_100052173	Ga0097621_1000521733	335
170	3300006358	Ga0068871_100027298	Ga0068871_1000272981	335
171	3300006931	Ga0097620_100030493	Ga0097620_1000304933	335
172	3300007076	Ga0075435_100181297	Ga0075435_1001812972	335
173	3300009177	Ga0105248_10127429	Ga0105248_101274292	335
174	3300011119	Ga0105246_10130386	Ga0105246_101303861	335
175	3300013308	Ga0157375_10329130	Ga0157375_103291302	335
176	3300014968	Ga0157379_10167890	Ga0157379_101678902	335
177	3300014968	Ga0157379_10199409	Ga0157379_101994092	335
178	3300014969	Ga0157376_10053579	Ga0157376_100535793	335
179	3300025941	Ga0207711_10063599	Ga0207711_100635993	335
180	3300025972	Ga0207668_10046150	Ga0207668_100461502	335
181	3300026088	Ga0207641_10049487	Ga0207641_100494873	335
182	3300026095	Ga0207676_10121439	Ga0207676_101214393	335
183	3300037068	Ga0373925_0019373	Ga0373925_0019373_3839_4858	335
184	3300046472	Ga0495580_0169269	Ga0495580_0169269_81_1100	335
185	3300048911	Ga0496108_0149569	Ga0496108_0149569_502_1521	335
186	3300053131	Ga0500652_000447	Ga0500652_000447_338_1561	335
187	iso_pu_bacteria	2643221639	2644220895	335
188	iso_pu_bacteria	2643221646	2644259739	335
189	iso_pu_bacteria	2831864461	2831867709	335
190	3300005328	Ga0070676_10170036	Ga0070676_101700362	336
191	3300005331	Ga0070670_100062540	Ga0070670_1000625402	336
192	3300005335	Ga0070666_10053443	Ga0070666_100534433	336
193	3300005347	Ga0070668_100001419	Ga0070668_10000141917	336
194	3300005347	Ga0070668_100011819	Ga0070668_1000118193	336
195	3300005347	Ga0070668_100138908	Ga0070668_1001389082	336
196	3300005353	Ga0070669_100012659	Ga0070669_1000126594	336
197	3300005354	Ga0070675_100004394	Ga0070675_1000043947	336
198	3300005355	Ga0070671_100021850	Ga0070671_1000218506	336
199	3300005355	Ga0070671_100079925	Ga0070671_1000799251	336
200	3300005364	Ga0070673_100050204	Ga0070673_1000502043	336
201	3300005367	Ga0070667_100024425	Ga0070667_1000244255	336
202	3300005438	Ga0070701_10159835	Ga0070701_101598352	336
203	3300005457	Ga0070662_100004969	Ga0070662_1000049699	336
204	3300005457	Ga0070662_100208843	Ga0070662_1002088432	336
205	3300005459	Ga0068867_100009399	Ga0068867_1000093993	336
206	3300005543	Ga0070672_100000281	Ga0070672_1000002813	336
207	3300005548	Ga0070665_100006947	Ga0070665_1000069478	336
208	3300005564	Ga0070664_100015691	Ga0070664_1000156914	336
209	3300005614	Ga0068856_100005751	Ga0068856_1000057516	336
210	3300005719	Ga0068861_100039812	Ga0068861_1000398121	336
211	3300005841	Ga0068863_100004530	Ga0068863_1000045305	336
212	3300005841	Ga0068863_100175131	Ga0068863_1001751312	336
213	3300005842	Ga0068858_100034770	Ga0068858_1000347703	336
214	3300005844	Ga0068862_100104544	Ga0068862_1001045442	336
215	3300005985	Ga0081539_10028192	Ga0081539_100281923	336
216	3300006237	Ga0097621_100233326	Ga0097621_1002333262	336
217	3300009098	Ga0105245_10150406	Ga0105245_101504063	336
218	3300009101	Ga0105247_10080266	Ga0105247_100802662	336
219	3300009147	Ga0114129_10262111	Ga0114129_102621112	336
220	3300009177	Ga0105248_10083951	Ga0105248_100839511	336
221	3300009177	Ga0105248_10356301	Ga0105248_103563012	336
222	3300013296	Ga0157374_10139703	Ga0157374_101397033	336
223	3300013297	Ga0157378_10109342	Ga0157378_101093422	336
224	3300013306	Ga0163162_10176626	Ga0163162_101766262	336
225	3300013307	Ga0157372_10016172	Ga0157372_100161722	336
226	3300013308	Ga0157375_10001449	Ga0157375_100014497	336
227	3300013308	Ga0157375_10208677	Ga0157375_102086771	336
228	3300014325	Ga0163163_10011339	Ga0163163_100113392	336
229	3300014325	Ga0163163_10218294	Ga0163163_102182941	336
230	3300014968	Ga0157379_10016095	Ga0157379_100160952	336
231	3300025315	Ga0207697_10035612	Ga0207697_100356122	336
232	3300025903	Ga0207680_10042570	Ga0207680_100425703	336
233	3300025907	Ga0207645_10121704	Ga0207645_101217042	336
234	3300025925	Ga0207650_10016468	Ga0207650_100164683	336
235	3300025926	Ga0207659_10037544	Ga0207659_100375443	336
236	3300025931	Ga0207644_10055251	Ga0207644_100552513	336
237	3300025933	Ga0207706_10021671	Ga0207706_100216715	336
238	3300025933	Ga0207706_10078462	Ga0207706_100784623	336
239	3300025937	Ga0207669_10044490	Ga0207669_100444902	336
240	3300025940	Ga0207691_10001087	Ga0207691_100010877	336
241	3300025940	Ga0207691_10016891	Ga0207691_100168914	336
242	3300025941	Ga0207711_10235275	Ga0207711_102352752	336
243	3300025960	Ga0207651_10145043	Ga0207651_101450431	336
244	3300025972	Ga0207668_10013039	Ga0207668_100130393	336
245	3300025972	Ga0207668_10022414	Ga0207668_100224142	336
246	3300025986	Ga0207658_10223564	Ga0207658_102235642	336
247	3300026023	Ga0207677_10148646	Ga0207677_101486461	336
248	3300026035	Ga0207703_10029217	Ga0207703_100292172	336
249	3300026078	Ga0207702_10182696	Ga0207702_101826961	336
250	3300026088	Ga0207641_10049080	Ga0207641_100490802	336
251	3300026088	Ga0207641_10151236	Ga0207641_101512363	336
252	3300026089	Ga0207648_10023380	Ga0207648_100233803	336
253	3300026095	Ga0207676_10016858	Ga0207676_100168584	336
254	3300026095	Ga0207676_10054069	Ga0207676_100540693	336
255	3300026118	Ga0207675_100054522	Ga0207675_1000545221	336
256	3300026121	Ga0207683_10159239	Ga0207683_101592391	336
257	3300028379	Ga0268266_10021508	Ga0268266_100215081	336
258	3300028380	Ga0268265_10092576	Ga0268265_100925763	336
259	3300031242	Ga0265329_10008513	Ga0265329_100085133	336
260	3300031251	Ga0265327_10008530	Ga0265327_100085302	336
261	3300031344	Ga0265316_10015356	Ga0265316_100153564	336
262	3300031548	Ga0307408_100000165	Ga0307408_10000016559	336
263	3300031711	Ga0265314_10041309	Ga0265314_100413093	336
264	3300035410	Ga0373924_0004529	Ga0373924_0004529_2393_3418	336
265	3300037471	Ga0395905_0025148	Ga0395905_0025148_3064_4080	336
266	3300041512	Ga0451853_3187830	Ga0451853_3187830_184_1194	336
267	3300048914	Ga0496111_0077750	Ga0496111_0077750_1186_2205	336
268	3300048915	Ga0496112_0010074	Ga0496112_0010074_1260_2279	336
269	3300050493	nmdc:mga0k408_214155_c1	nmdc:mga0k408_214155_c1_66_1076	336
270	3300050496	nmdc:mga07m45_2472_c2	nmdc:mga07m45_2472_c2_863_1873	336
271	3300053151	Ga0500604_0005105	Ga0500604_0005105_249_1268	336
272	3300005330	Ga0070690_100010159	Ga0070690_1000101595	337
273	3300005331	Ga0070670_100001667	Ga0070670_10000166713	337
274	3300005331	Ga0070670_100006386	Ga0070670_1000063862	337
275	3300005334	Ga0068869_100001261	Ga0068869_10000126111	337
276	3300005335	Ga0070666_10001777	Ga0070666_100017773	337
277	3300005337	Ga0070682_100003460	Ga0070682_1000034602	337
278	3300005338	Ga0068868_100042698	Ga0068868_1000426983	337
279	3300005339	Ga0070660_100387873	Ga0070660_1003878731	337
280	3300005340	Ga0070689_100218871	Ga0070689_1002188711	337
281	3300005343	Ga0070687_100048429	Ga0070687_1000484292	337
282	3300005343	Ga0070687_100114248	Ga0070687_1001142481	337
283	3300005353	Ga0070669_100000933	Ga0070669_1000009337	337
284	3300005353	Ga0070669_100017442	Ga0070669_1000174423	337
285	3300005354	Ga0070675_100013881	Ga0070675_1000138814	337
286	3300005354	Ga0070675_100015685	Ga0070675_1000156857	337
287	3300005354	Ga0070675_100016115	Ga0070675_1000161156	337
288	3300005354	Ga0070675_100054260	Ga0070675_1000542602	337
289	3300005354	Ga0070675_100131021	Ga0070675_1001310213	337
290	3300005355	Ga0070671_100036886	Ga0070671_1000368863	337
291	3300005356	Ga0070674_100041423	Ga0070674_1000414232	337
292	3300005364	Ga0070673_100003145	Ga0070673_1000031454	337
293	3300005365	Ga0070688_100221134	Ga0070688_1002211341	337
294	3300005367	Ga0070667_100001050	Ga0070667_10000105014	337
295	3300005367	Ga0070667_100003202	Ga0070667_1000032028	337
296	3300005367	Ga0070667_100005256	Ga0070667_1000052569	337
297	3300005436	Ga0070713_100000031	Ga0070713_10000003145	337
298	3300005439	Ga0070711_100203209	Ga0070711_1002032091	337
299	3300005440	Ga0070705_100076808	Ga0070705_1000768081	337
300	3300005441	Ga0070700_100025579	Ga0070700_1000255791	337
301	3300005456	Ga0070678_100114288	Ga0070678_1001142883	337
302	3300005457	Ga0070662_100148688	Ga0070662_1001486881	337
303	3300005459	Ga0068867_100001411	Ga0068867_1000014117	337
304	3300005543	Ga0070672_100000181	Ga0070672_1000001813	337
305	3300005543	Ga0070672_100002059	Ga0070672_1000020593	337
306	3300005543	Ga0070672_100013829	Ga0070672_1000138293	337
307	3300005547	Ga0070693_100194585	Ga0070693_1001945852	337
308	3300005548	Ga0070665_100165228	Ga0070665_1001652282	337
309	3300005548	Ga0070665_100396675	Ga0070665_1003966752	337
310	3300005564	Ga0070664_100137658	Ga0070664_1001376582	337
311	3300005577	Ga0068857_100016310	Ga0068857_1000163102	337
312	3300005578	Ga0068854_100016200	Ga0068854_1000162003	337
313	3300005617	Ga0068859_100014232	Ga0068859_1000142323	337
314	3300005618	Ga0068864_100003547	Ga0068864_1000035473	337
315	3300005618	Ga0068864_100015697	Ga0068864_1000156973	337
316	3300005618	Ga0068864_100017959	Ga0068864_1000179593	337
317	3300005618	Ga0068864_100136429	Ga0068864_1001364293	337
318	3300005719	Ga0068861_100062124	Ga0068861_1000621241	337
319	3300005841	Ga0068863_100037535	Ga0068863_1000375352	337
320	3300005842	Ga0068858_100001135	Ga0068858_1000011357	337
321	3300005842	Ga0068858_100028821	Ga0068858_1000288211	337
322	3300005843	Ga0068860_100007280	Ga0068860_10000728010	337
323	3300005843	Ga0068860_100007749	Ga0068860_1000077495	337
324	3300005843	Ga0068860_100031786	Ga0068860_1000317862	337
325	3300005843	Ga0068860_100059308	Ga0068860_1000593082	337
326	3300005844	Ga0068862_100001268	Ga0068862_1000012686	337
327	3300005844	Ga0068862_100174014	Ga0068862_1001740142	337
328	3300006237	Ga0097621_100005856	Ga0097621_1000058566	337
329	3300006237	Ga0097621_100009085	Ga0097621_1000090855	337
330	3300006358	Ga0068871_100019898	Ga0068871_1000198983	337
331	3300006358	Ga0068871_100138309	Ga0068871_1001383092	337
332	3300006881	Ga0068865_100001941	Ga0068865_1000019417	337
333	3300006881	Ga0068865_100257595	Ga0068865_1002575952	337
334	3300006931	Ga0097620_100014230	Ga0097620_1000142303	337
335	3300009093	Ga0105240_10549868	Ga0105240_105498682	337
336	3300009147	Ga0114129_10187261	Ga0114129_101872614	337
337	3300009553	Ga0105249_10261191	Ga0105249_102611911	337
338	3300013306	Ga0163162_10066554	Ga0163162_100665543	337
339	3300013308	Ga0157375_10011997	Ga0157375_100119973	337
340	3300013308	Ga0157375_10023995	Ga0157375_100239956	337
341	3300013308	Ga0157375_10126885	Ga0157375_101268853	337
342	3300014325	Ga0163163_10008849	Ga0163163_100088496	337
343	3300014968	Ga0157379_10000563	Ga0157379_100005638	337
344	3300014969	Ga0157376_10008323	Ga0157376_100083236	337
345	3300025901	Ga0207688_10026690	Ga0207688_100266903	337
346	3300025907	Ga0207645_10004894	Ga0207645_100048942	337
347	3300025907	Ga0207645_10011328	Ga0207645_100113286	337
348	3300025918	Ga0207662_10007197	Ga0207662_100071975	337
349	3300025918	Ga0207662_10056982	Ga0207662_100569822	337
350	3300025923	Ga0207681_10000565	Ga0207681_1000056516	337
351	3300025923	Ga0207681_10047150	Ga0207681_100471503	337
352	3300025925	Ga0207650_10010998	Ga0207650_100109986	337
353	3300025925	Ga0207650_10238412	Ga0207650_102384122	337
354	3300025926	Ga0207659_10010442	Ga0207659_100104425	337
355	3300025926	Ga0207659_10012237	Ga0207659_100122372	337
356	3300025926	Ga0207659_10024222	Ga0207659_100242222	337
357	3300025928	Ga0207700_10000084	Ga0207700_1000008415	337
358	3300025931	Ga0207644_10001174	Ga0207644_100011748	337
359	3300025933	Ga0207706_10003299	Ga0207706_100032995	337
360	3300025934	Ga0207686_10036784	Ga0207686_100367842	337
361	3300025938	Ga0207704_10001465	Ga0207704_100014655	337
362	3300025939	Ga0207665_10103831	Ga0207665_101038312	337
363	3300025941	Ga0207711_10003970	Ga0207711_100039702	337
364	3300025941	Ga0207711_10006608	Ga0207711_100066088	337
365	3300025942	Ga0207689_10000038	Ga0207689_1000003863	337
366	3300025945	Ga0207679_10282728	Ga0207679_102827282	337
367	3300025961	Ga0207712_10002887	Ga0207712_100028874	337
368	3300025972	Ga0207668_10001216	Ga0207668_100012166	337
369	3300025981	Ga0207640_10125791	Ga0207640_101257912	337
370	3300025986	Ga0207658_10000576	Ga0207658_100005768	337
371	3300025986	Ga0207658_10002076	Ga0207658_100020763	337
372	3300025986	Ga0207658_10023864	Ga0207658_100238642	337
373	3300026035	Ga0207703_10001247	Ga0207703_1000124714	337
374	3300026035	Ga0207703_10004706	Ga0207703_100047062	337
375	3300026075	Ga0207708_10013718	Ga0207708_100137181	337
376	3300026088	Ga0207641_10019358	Ga0207641_100193583	337
377	3300026088	Ga0207641_10152420	Ga0207641_101524202	337
378	3300026088	Ga0207641_10378232	Ga0207641_103782322	337
379	3300026088	Ga0207641_10487895	Ga0207641_104878951	337
380	3300026089	Ga0207648_10005992	Ga0207648_100059925	337
381	3300026095	Ga0207676_10002543	Ga0207676_100025436	337
382	3300026095	Ga0207676_10008449	Ga0207676_100084494	337
383	3300026095	Ga0207676_10012864	Ga0207676_100128644	337
384	3300026116	Ga0207674_10016868	Ga0207674_100168683	337
385	3300026118	Ga0207675_100000463	Ga0207675_10000046339	337
386	3300026142	Ga0207698_10101332	Ga0207698_101013322	337
387	3300028380	Ga0268265_10141271	Ga0268265_101412712	337
388	3300028380	Ga0268265_10294824	Ga0268265_102948241	337
389	3300028381	Ga0268264_10005075	Ga0268264_100050756	337
390	3300028381	Ga0268264_10005666	Ga0268264_1000566610	337
391	3300028381	Ga0268264_10019672	Ga0268264_100196724	337
392	3300028381	Ga0268264_10606331	Ga0268264_106063311	337
393	3300036401	Ga0373937_0013470	Ga0373937_0013470_2467_3489	337
394	3300039437	Ga0436365_1577438	Ga0436365_1577438_1595_2617	337
395	3300044673	Ga0453683_0033451	Ga0453683_0033451_1902_2927	337
396	3300044712	Ga0453684_0001745	Ga0453684_0001745_41483_42508	337
397	3300046514	Ga0495618_0111960	Ga0495618_0111960_369_1391	337
398	3300048905	Ga0496102_0093842	Ga0496102_0093842_1536_2564	337
399	3300048906	Ga0496103_0070630	Ga0496103_0070630_419_1447	337
400	3300048907	Ga0496104_0410776	Ga0496104_0410776_214_1242	337
401	3300048909	Ga0496106_0058109	Ga0496106_0058109_1639_2658	337
402	3300048911	Ga0496108_0006568	Ga0496108_0006568_7768_8796	337
403	3300048912	Ga0496109_0125289	Ga0496109_0125289_396_1424	337
404	3300053148	Ga0500590_014369	Ga0500590_014369_2142_3161	337
405	3300053154	Ga0500619_000014	Ga0500619_000014_54826_55845	337
406	3300053156	Ga0500622_0089317	Ga0500622_0089317_364_1383	337
407	3300005293	Ga0065715_10092397	Ga0065715_100923973	338
408	3300005328	Ga0070676_10000460	Ga0070676_1000046017	338
409	3300005331	Ga0070670_100024282	Ga0070670_1000242824	338
410	3300005333	Ga0070677_10005858	Ga0070677_100058583	338
411	3300005334	Ga0068869_100003214	Ga0068869_1000032148	338
412	3300005335	Ga0070666_10000439	Ga0070666_1000043922	338
413	3300005338	Ga0068868_100004899	Ga0068868_1000048994	338
414	3300005340	Ga0070689_100035890	Ga0070689_1000358902	338
415	3300005347	Ga0070668_100000714	Ga0070668_10000071421	338
416	3300005353	Ga0070669_100000685	Ga0070669_10000068524	338
417	3300005354	Ga0070675_100000769	Ga0070675_1000007695	338
418	3300005355	Ga0070671_100039288	Ga0070671_1000392883	338
419	3300005356	Ga0070674_100001488	Ga0070674_1000014883	338
420	3300005364	Ga0070673_100001967	Ga0070673_10000196713	338
421	3300005367	Ga0070667_100001175	Ga0070667_10000117522	338
422	3300005456	Ga0070678_100000294	Ga0070678_10000029421	338
423	3300005457	Ga0070662_100049731	Ga0070662_1000497312	338
424	3300005459	Ga0068867_100000643	Ga0068867_10000064323	338
425	3300005539	Ga0068853_100285509	Ga0068853_1002855092	338
426	3300005543	Ga0070672_100000479	Ga0070672_10000047921	338
427	3300005548	Ga0070665_100004149	Ga0070665_10000414913	338
428	3300005577	Ga0068857_100012070	Ga0068857_1000120704	338
429	3300005578	Ga0068854_100035613	Ga0068854_1000356134	338
430	3300005617	Ga0068859_100016181	Ga0068859_1000161813	338
431	3300005618	Ga0068864_100001326	Ga0068864_10000132618	338
432	3300005719	Ga0068861_100009480	Ga0068861_1000094803	338
433	3300005841	Ga0068863_100001375	Ga0068863_10000137523	338
434	3300005842	Ga0068858_100001028	Ga0068858_10000102822	338
435	3300005843	Ga0068860_100015302	Ga0068860_1000153023	338
436	3300006237	Ga0097621_100001008	Ga0097621_1000010083	338
437	3300006353	Ga0075370_10070068	Ga0075370_100700682	338
438	3300006358	Ga0068871_100009136	Ga0068871_1000091367	338
439	3300006871	Ga0075434_100164280	Ga0075434_1001642801	338
440	3300006881	Ga0068865_100005487	Ga0068865_1000054874	338
441	3300006931	Ga0097620_100016180	Ga0097620_1000161803	338
442	3300009093	Ga0105240_10040262	Ga0105240_100402623	338
443	3300009098	Ga0105245_10090582	Ga0105245_100905823	338
444	3300009545	Ga0105237_10070679	Ga0105237_100706792	338
445	3300010375	Ga0105239_10067764	Ga0105239_100677642	338
446	3300013296	Ga0157374_10007008	Ga0157374_100070086	338
447	3300013297	Ga0157378_10027542	Ga0157378_100275424	338
448	3300013306	Ga0163162_10013790	Ga0163162_100137907	338
449	3300013308	Ga0157375_10006807	Ga0157375_100068078	338
450	3300014325	Ga0163163_10192433	Ga0163163_101924332	338
451	3300014326	Ga0157380_10164792	Ga0157380_101647923	338
452	3300014968	Ga0157379_10025702	Ga0157379_100257023	338
453	3300014969	Ga0157376_10002638	Ga0157376_100026385	338
454	3300017792	Ga0163161_10006917	Ga0163161_100069173	338
455	3300025315	Ga0207697_10008562	Ga0207697_100085623	338
456	3300025903	Ga0207680_10000461	Ga0207680_1000046118	338
457	3300025907	Ga0207645_10000534	Ga0207645_1000053417	338
458	3300025913	Ga0207695_10057426	Ga0207695_100574263	338
459	3300025923	Ga0207681_10000530	Ga0207681_100005309	338
460	3300025925	Ga0207650_10013279	Ga0207650_100132796	338
461	3300025925	Ga0207650_10077415	Ga0207650_100774152	338
462	3300025926	Ga0207659_10000248	Ga0207659_1000024819	338
463	3300025931	Ga0207644_10018482	Ga0207644_100184823	338
464	3300025931	Ga0207644_10136138	Ga0207644_101361382	338
465	3300025933	Ga0207706_10015877	Ga0207706_100158774	338
466	3300025936	Ga0207670_10135275	Ga0207670_101352752	338
467	3300025937	Ga0207669_10006845	Ga0207669_100068453	338
468	3300025938	Ga0207704_10000684	Ga0207704_1000068414	338
469	3300025940	Ga0207691_10000022	Ga0207691_1000002278	338
470	3300025941	Ga0207711_10014269	Ga0207711_100142695	338
471	3300025942	Ga0207689_10001287	Ga0207689_100012872	338
472	3300025960	Ga0207651_10009349	Ga0207651_100093493	338
473	3300025972	Ga0207668_10005408	Ga0207668_100054086	338
474	3300025972	Ga0207668_10021289	Ga0207668_100212894	338
475	3300025986	Ga0207658_10000311	Ga0207658_1000031121	338
476	3300026023	Ga0207677_10002948	Ga0207677_100029484	338
477	3300026035	Ga0207703_10010184	Ga0207703_100101846	338
478	3300026067	Ga0207678_10108845	Ga0207678_101088452	338
479	3300026088	Ga0207641_10001378	Ga0207641_1000137823	338
480	3300026089	Ga0207648_10001109	Ga0207648_100011097	338
481	3300026095	Ga0207676_10042365	Ga0207676_100423652	338
482	3300026118	Ga0207675_100014096	Ga0207675_1000140963	338
483	3300026121	Ga0207683_10000108	Ga0207683_1000010837	338
484	3300028379	Ga0268266_10074453	Ga0268266_100744532	338
485	3300028380	Ga0268265_10483946	Ga0268265_104839462	338
486	3300028381	Ga0268264_10002130	Ga0268264_1000213018	338
487	3300030522	Ga0307512_10034214	Ga0307512_100342143	338
488	3300030522	Ga0307512_10085209	Ga0307512_100852092	338
489	3300031238	Ga0265332_10000003	Ga0265332_10000003241	338
490	3300031507	Ga0307509_10205244	Ga0307509_102052441	338
491	3300031649	Ga0307514_10035387	Ga0307514_100353872	338
492	3300031730	Ga0307516_10219015	Ga0307516_102190152	338
493	3300031838	Ga0307518_10023668	Ga0307518_100236682	338
494	3300033179	Ga0307507_10247193	Ga0307507_102471931	338
495	3300033180	Ga0307510_10009944	Ga0307510_1000994411	338
496	3300033180	Ga0307510_10018239	Ga0307510_100182394	338
497	3300033180	Ga0307510_10038889	Ga0307510_100388896	338
498	3300035114	Ga0373939_0000013	Ga0373939_0000013_22438_23454	338
499	3300035242	Ga0373962_0005935	Ga0373962_0005935_1577_2593	338
500	3300035691	Ga0373931_0000279	Ga0373931_0000279_94_1110	338
501	3300044656	Ga0466969_0079201	Ga0466969_0079201_41_1063	338
502	3300044693	Ga0466961_0010277	Ga0466961_0010277_418_1440	338
503	3300044706	Ga0466964_0063147	Ga0466964_0063147_20_1042	338
504	3300044712	Ga0453684_0020448	Ga0453684_0020448_2154_3176	338
505	3300044712	Ga0453684_0036852	Ga0453684_0036852_2397_3419	338
506	3300044719	Ga0466971_0005608	Ga0466971_0005608_2790_3812	338
507	3300044842	Ga0466957_0053381	Ga0466957_0053381_360_1382	338
508	3300045049	Ga0466959_0008965	Ga0466959_0008965_4322_5344	338
509	3300046524	Ga0495648_0053243	Ga0495648_0053243_245_1270	338
510	3300046526	Ga0495666_0031177	Ga0495666_0031177_474_1499	338
511	3300050489	nmdc:mga03683_62265_c1	nmdc:mga03683_62265_c1_474_1496	338
512	3300050493	nmdc:mga0k408_93027_c1	nmdc:mga0k408_93027_c1_487_1509	338
513	3300050495	nmdc:mga04h51_49199_c1	nmdc:mga04h51_49199_c1_153_1175	338
514	3300050496	nmdc:mga07m45_28078_c1	nmdc:mga07m45_28078_c1_306_1328	338
515	3300050512	nmdc:mga0n895_200728_c1	nmdc:mga0n895_200728_c1_768_1799	338
516	3300053121	Ga0500607_024962	Ga0500607_024962_1979_3001	338
517	3300053136	Ga0500559_0000116	Ga0500559_0000116_61892_62914	338
518	3300053156	Ga0500622_0005791	Ga0500622_0005791_1907_2929	338
519	3300053177	Ga0500636_0143154	Ga0500636_0143154_144_1166	338
520	3300061719	Ga0466962_0038859	Ga0466962_0038859_586_1608	338
521	3300003771	Ga0055526_1000698	Ga0055526_100069812	339
522	3300025295	Ga0209564_1000021	Ga0209564_1000021122	339
523	3300028794	Ga0307515_10106382	Ga0307515_101063822	339
524	3300044656	Ga0466969_0029897	Ga0466969_0029897_618_1664	339
525	3300044666	Ga0466977_0000597	Ga0466977_0000597_5382_6428	339
526	3300049523	Ga0501300_002645	Ga0501300_002645_988_2007	339
527	3300049669	Ga0501235_002194	Ga0501235_002194_2622_3641	339
528	3300049704	Ga0501221_001419	Ga0501221_001419_1145_2164	339
529	3300049762	Ga0501265_003742	Ga0501265_003742_557_1576	339
530	3300049764	Ga0501267_000345	Ga0501267_000345_26_1045	339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

111

392

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4mev-assembly1.cif.gz_A	crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422	0.9434	29	339
4mev-assembly1.cif.gz_A	crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422	0.9405	29	339
4p47-assembly1.cif.gz_A	crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket	0.8985	30	337
4p1l-assembly2.cif.gz_B	crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound d-glucuronate, spg i213	0.8801	30	339
4p1l-assembly2.cif.gz_B	crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound d-glucuronate, spg i213	0.8774	30	339

ID	Description	Score	Start	End	Superfamily
4mevA00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.9434	29	339	3.40.190.170
4mevA00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.9405	29	339	3.40.190.170
4p47A00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8984	30	337	3.40.190.170
4pfiA00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8776	30	336	3.40.190.170
4nhbB00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8763	29	338	3.40.190.170

ID	Description	Score	Start	End	GO Terms
AF-A0A7S7SU36-F1-model_v4	TRAP transporter substrate-binding protein DctP	0.9399	23	338	GO:0015740 GO:0055085
AF-A0A7S7SU36-F1-model_v4	TRAP transporter substrate-binding protein DctP	0.9204	23	338	GO:0015740 GO:0055085
AF-A0A536ZNJ9-F1-model_v4	ABC transporter substrate-binding protein	0.9076	22	195	GO:0015740 GO:0055085
AF-A0A850MZ18-F1-model_v4	deleted	0.9074	11	339
AF-A0A061QI02-F1-model_v4	Sialic acid-binding periplasmic protein SiaP	0.9052	21	335	GO:0016020 GO:0055085

Feature Viewer

pLDDT	pTM	Quality
90.21	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460033

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

111

392

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map