F460075

General Info

Members Datasets Scaffolds Average Seq Length
531 270 531 197

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100586256|Ga0070673_1005862562
Length 223
Sequence MPGGRACLWRFVSKGGRVVHRRPTRLRAVFTGIVRERGRVAAAELNGDGLRLRVEAAETASTAAPGDSVSVSGVCLTVTAATNGSLAFDAVPETIARTNLGRLAAGSRVNLEPALRAGEPLGGHFVQGHVDGTARVGRLEPEGAGARLTLALPPDLLRYCVEKGSIALDGVSLTIAAVRNDGIEIALVPFTLEHTTLAAAAPGDELNVEVDLLAKYAERLGSG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 8.29
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10019066 3300005328 Bacteria 3812
2 Ga0070676_10045454 3300005328 Bacteria 2558
3 Ga0070683_100100792 3300005329 Bacteria 2719
4 Ga0070690_100418423 3300005330 Bacteria 987
5 Ga0068869_100158910 3300005334 Bacteria 1758
6 Ga0068869_100334538 3300005334 Bacteria 1231
7 Ga0070680_100374995 3300005336 Bacteria 1211
8 Ga0070682_100019712 3300005337 Bacteria 3960
9 Ga0068868_100183743 3300005338 Bacteria 1736
10 Ga0070689_100033752 3300005340 Bacteria 3901
11 Ga0070691_10064559 3300005341 Bacteria 1767
12 Ga0070692_10145923 3300005345 Bacteria 1344
13 Ga0070668_100010313 3300005347 Bacteria 6937
14 Ga0070668_100066826 3300005347 Bacteria 2791
15 Ga0070668_100886285 3300005347 Bacteria 797
16 Ga0070669_100309909 3300005353 Bacteria 1272
17 Ga0070669_100872469 3300005353 Bacteria 768
18 Ga0070671_100284434 3300005355 Bacteria 1407
19 Ga0070673_100586256 3300005364 Bacteria 1016
20 Ga0070688_100037354 3300005365 Bacteria 2959
21 Ga0070659_100046283 3300005366 Bacteria 3410
22 Ga0070659_100165216 3300005366 Bacteria 1811
23 Ga0070667_100021563 3300005367 Bacteria 5347
24 Ga0070709_10060226 3300005434 Bacteria 2412
25 Ga0070709_10505572 3300005434 Bacteria 918
26 Ga0070714_100178232 3300005435 Bacteria 1932
27 Ga0070714_101133736 3300005435 Bacteria 762
28 Ga0070713_100145793 3300005436 Bacteria 2101
29 Ga0070713_100594757 3300005436 Bacteria 1050
30 Ga0070710_10060598 3300005437 Bacteria 2153
31 Ga0070710_10275828 3300005437 Bacteria 1089
32 Ga0070701_10033585 3300005438 Bacteria 2565
33 Ga0070711_100013025 3300005439 Bacteria 5214
34 Ga0070711_100078999 3300005439 Bacteria 2339
35 Ga0070705_100070241 3300005440 Bacteria 2114
36 Ga0070705_100343380 3300005440 Bacteria 1086
37 Ga0070705_100663820 3300005440 Bacteria 815
38 Ga0070700_100024401 3300005441 Bacteria 3550
39 Ga0070700_100033699 3300005441 Bacteria 3087
40 Ga0070700_100344265 3300005441 Bacteria 1103
41 Ga0070700_100510000 3300005441 Bacteria 927
42 Ga0070694_100097349 3300005444 Bacteria 2075
43 Ga0070663_100085230 3300005455 Bacteria 2331
44 Ga0070663_100199214 3300005455 Bacteria 1562
45 Ga0070678_100089635 3300005456 Bacteria 2355
46 Ga0070678_100373584 3300005456 Bacteria 1232
47 Ga0070662_100042228 3300005457 Bacteria 3257
48 Ga0070662_100054168 3300005457 Bacteria 2907
49 Ga0070681_10008960 3300005458 Bacteria 9839
50 Ga0070681_10107738 3300005458 Bacteria 2727
51 Ga0070681_11178366 3300005458 Bacteria 688
52 Ga0068867_100021158 3300005459 Bacteria 4639
53 Ga0068867_100063296 3300005459 Bacteria 2749
54 Ga0068867_100731871 3300005459 Bacteria 876
55 Ga0070685_10022481 3300005466 Bacteria 3439
56 Ga0070707_100009845 3300005468 Bacteria 8895
57 Ga0070707_100227375 3300005468 Bacteria 1817
58 Ga0070707_100608272 3300005468 Bacteria 1055
59 Ga0070707_100846073 3300005468 Bacteria 879
60 Ga0070679_100014327 3300005530 Bacteria 7615
61 Ga0070679_100103606 3300005530 Bacteria 2832
62 Ga0070684_100138366 3300005535 Bacteria 2201
63 Ga0070684_100242289 3300005535 Bacteria 1648
64 Ga0070684_100353972 3300005535 Bacteria 1351
65 Ga0070697_100345844 3300005536 Bacteria 1284
66 Ga0068853_100352294 3300005539 Bacteria 1370
67 Ga0070686_100054245 3300005544 Bacteria 2563
68 Ga0070686_100152691 3300005544 Bacteria 1619
69 Ga0070686_100261512 3300005544 Bacteria 1269
70 Ga0070686_100660313 3300005544 Bacteria 830
71 Ga0070696_100014567 3300005546 Bacteria 5278
72 Ga0070696_100253060 3300005546 Bacteria 1333
73 Ga0070696_100500725 3300005546 Bacteria 966
74 Ga0070696_100503390 3300005546 Bacteria 964
75 Ga0070696_101007171 3300005546 Bacteria 696
76 Ga0070693_100009139 3300005547 Bacteria 4921
77 Ga0070693_100014894 3300005547 Bacteria 3997
78 Ga0070693_100124904 3300005547 Bacteria 1601
79 Ga0070665_100242497 3300005548 Bacteria 1803
80 Ga0068855_100001260 3300005563 Bacteria 31457
81 Ga0068855_100204044 3300005563 Bacteria 2224
82 Ga0068857_100055716 3300005577 Bacteria 3508
83 Ga0068857_100773969 3300005577 Bacteria 915
84 Ga0068854_100066829 3300005578 Bacteria 2617
85 Ga0068854_100212070 3300005578 Bacteria 1528
86 Ga0068856_100132704 3300005614 Bacteria 2495
87 Ga0068856_100195711 3300005614 Bacteria 2035
88 Ga0068856_100478029 3300005614 Bacteria 1267
89 Ga0070702_100268723 3300005615 Bacteria 1165
90 Ga0070702_100423609 3300005615 Bacteria 958
91 Ga0068859_100018888 3300005617 Bacteria 6926
92 Ga0068859_100023354 3300005617 Bacteria 6208
93 Ga0068859_100520248 3300005617 Bacteria 1285
94 Ga0068859_101418819 3300005617 Bacteria 766
95 Ga0068864_100074103 3300005618 Bacteria 2970
96 Ga0068864_100436599 3300005618 Bacteria 1250
97 Ga0068861_100024197 3300005719 Bacteria 4389
98 Ga0068870_10051912 3300005840 Bacteria 2172
99 Ga0068870_10334626 3300005840 Bacteria 966
100 Ga0068870_10648824 3300005840 Bacteria 723
101 Ga0068858_100393330 3300005842 Bacteria 1331
102 Ga0068858_100524023 3300005842 Bacteria 1146
103 Ga0068860_100058370 3300005843 Bacteria 3668
104 Ga0068860_100276867 3300005843 Bacteria 1639
105 Ga0068862_100003276 3300005844 Bacteria 14015
106 Ga0068862_100025605 3300005844 Bacteria 4953
107 Ga0068862_100061039 3300005844 Bacteria 3240
108 Ga0068862_101255778 3300005844 Bacteria 741
109 Ga0081455_10001965 3300005937 Bacteria 24619
110 Ga0081455_10003924 3300005937 Bacteria 16929
111 Ga0081455_10013877 3300005937 Bacteria 7923
112 Ga0081455_10216911 3300005937 Bacteria 1421
113 Ga0081538_10100684 3300005981 Bacteria 1456
114 Ga0081540_1008104 3300005983 Bacteria 7380
115 Ga0081540_1039340 3300005983 Bacteria 2480
116 Ga0081539_10001069 3300005985 Bacteria 50060
117 Ga0070717_10706947 3300006028 Bacteria 916
118 Ga0075432_10016654 3300006058 Bacteria 2509
119 Ga0070715_10049659 3300006163 Bacteria 1798
120 Ga0070716_100082940 3300006173 Bacteria 1918
121 Ga0075367_10198975 3300006178 Bacteria 1252
122 Ga0097621_100057877 3300006237 Bacteria 3171
123 Ga0068871_100110238 3300006358 Bacteria 2314
124 Ga0075428_100166573 3300006844 Bacteria 2390
125 Ga0075428_100337287 3300006844 Bacteria 1619
126 Ga0075428_100693124 3300006844 Bacteria 1085
127 Ga0075428_101082967 3300006844 Bacteria 847
128 Ga0075430_100123418 3300006846 Bacteria 2159
129 Ga0075430_100183928 3300006846 Bacteria 1738
130 Ga0075431_100336120 3300006847 Bacteria 1520
131 Ga0075431_100926775 3300006847 Bacteria 840
132 Ga0075433_10043090 3300006852 Bacteria 3917
133 Ga0075433_10155113 3300006852 Bacteria 2037
134 Ga0075433_10161298 3300006852 Bacteria 1996
135 Ga0075433_10545590 3300006852 Bacteria 1019
136 Ga0075433_11036774 3300006852 Unclassified 714
137 Ga0075434_100048551 3300006871 Bacteria 4211
138 Ga0075434_100284926 3300006871 Bacteria 1672
139 Ga0075434_100285697 3300006871 Bacteria 1669
140 Ga0075434_100567640 3300006871 Bacteria 1154
141 Ga0075429_100382368 3300006880 Bacteria 1233
142 Ga0075429_100552655 3300006880 Bacteria 1009
143 Ga0068865_100065808 3300006881 Bacteria 2555
144 Ga0075436_100014441 3300006914 Bacteria 5409
145 Ga0075436_100050839 3300006914 Bacteria 2860
146 Ga0075436_100086662 3300006914 Bacteria 2175
147 Ga0075436_100201466 3300006914 Bacteria 1410
148 Ga0097620_100018889 3300006931 Bacteria 6926
149 Ga0097620_100023354 3300006931 Bacteria 6208
150 Ga0097620_100520269 3300006931 Bacteria 1285
151 Ga0097620_101418921 3300006931 Bacteria 766
152 Ga0075435_100035003 3300007076 Bacteria 3983
153 Ga0075435_100039967 3300007076 Bacteria 3745
154 Ga0075435_100151517 3300007076 Bacteria 1950
155 Ga0075435_100174420 3300007076 Bacteria 1815
156 Ga0105240_10206325 3300009093 Bacteria 2300
157 Ga0105240_11045703 3300009093 Bacteria 871
158 Ga0111539_10002424 3300009094 Bacteria 24805
159 Ga0111539_10007984 3300009094 Bacteria 13499
160 Ga0111539_10137563 3300009094 Bacteria 2860
161 Ga0111539_10409193 3300009094 Bacteria 1580
162 Ga0111539_11186458 3300009094 Bacteria 887
163 Ga0105245_10022805 3300009098 Bacteria 5493
164 Ga0105245_10027098 3300009098 Bacteria 5049
165 Ga0105245_10029729 3300009098 Bacteria 4830
166 Ga0105245_11106302 3300009098 Bacteria 839
167 Ga0114129_10035952 3300009147 Bacteria 6995
168 Ga0114129_10186825 3300009147 Bacteria 2816
169 Ga0114129_10429388 3300009147 Bacteria 1736
170 Ga0114129_10457925 3300009147 Bacteria 1672
171 Ga0114129_10526852 3300009147 Bacteria 1540
172 Ga0114129_10605179 3300009147 Bacteria 1419
173 Ga0114129_10777693 3300009147 Bacteria 1223
174 Ga0114129_10856021 3300009147 Bacteria 1155
175 Ga0105243_10028503 3300009148 Bacteria 4287
176 Ga0105243_10672176 3300009148 Bacteria 1006
177 Ga0105241_10132906 3300009174 Bacteria 2017
178 Ga0105241_10224946 3300009174 Bacteria 1579
179 Ga0105242_10243503 3300009176 Bacteria 1618
180 Ga0105242_10626564 3300009176 Bacteria 1043
181 Ga0105248_10012726 3300009177 Bacteria 9281
182 Ga0105248_10359906 3300009177 Bacteria 1638
183 Ga0105248_10381790 3300009177 Bacteria 1586
184 Ga0105237_10735093 3300009545 Bacteria 993
185 Ga0105249_10003647 3300009553 Bacteria 13312
186 Ga0105249_10006506 3300009553 Bacteria 10163
187 Ga0105249_10020054 3300009553 Bacteria 5971
188 Ga0105249_10169658 3300009553 Bacteria 2115
189 Ga0105239_10131671 3300010375 Bacteria 2782
190 Ga0105239_10380686 3300010375 Bacteria 1595
191 Ga0105239_10459105 3300010375 Bacteria 1446
192 Ga0105246_10141767 3300011119 Bacteria 1808
193 Ga0157342_1000319 3300012507 Bacteria 2764
194 Ga0157373_10309510 3300013100 Bacteria 1122
195 Ga0157371_10139959 3300013102 Bacteria 1724
196 Ga0157371_10848126 3300013102 Bacteria 691
197 Ga0163162_10025425 3300013306 Bacteria 5850
198 Ga0163162_10059461 3300013306 Bacteria 3853
199 Ga0163162_10121106 3300013306 Bacteria 2721
200 Ga0157372_10176052 3300013307 Bacteria 2476
201 Ga0157372_10272150 3300013307 Bacteria 1968
202 Ga0157375_10019614 3300013308 Bacteria 6155
203 Ga0157375_10327878 3300013308 Bacteria 1696
204 Ga0157375_10649970 3300013308 Bacteria 1211
205 Ga0163163_10045091 3300014325 Bacteria 4327
206 Ga0157380_10109269 3300014326 Bacteria 2320
207 Ga0182008_10035777 3300014497 Bacteria 2485
208 Ga0182008_10126559 3300014497 Bacteria 1272
209 Ga0157379_10004610 3300014968 Bacteria 11825
210 Ga0157379_10154678 3300014968 Bacteria 2069
211 Ga0157379_10524135 3300014968 Bacteria 1100
212 Ga0157379_10640808 3300014968 Bacteria 994
213 Ga0157376_10583598 3300014969 Bacteria 1110
214 Ga0163161_10075755 3300017792 Bacteria 2469
215 Ga0163161_10404320 3300017792 Bacteria 1095
216 Ga0206353_10317817 3300020082 Bacteria 6436
217 Ga0213875_10118728 3300021388 Bacteria 1236
218 Ga0207692_10057409 3300025898 Bacteria 2001
219 Ga0207642_10064085 3300025899 Bacteria 1721
220 Ga0207688_10203591 3300025901 Bacteria 1187
221 Ga0207699_10668113 3300025906 Bacteria 760
222 Ga0207705_10624270 3300025909 Bacteria 838
223 Ga0207654_10035153 3300025911 Bacteria 2790
224 Ga0207654_10221659 3300025911 Bacteria 1255
225 Ga0207707_10102815 3300025912 Bacteria 2498
226 Ga0207671_10604321 3300025914 Bacteria 874
227 Ga0207693_10095847 3300025915 Bacteria 2326
228 Ga0207693_10095848 3300025915 Bacteria 2326
229 Ga0207663_10012017 3300025916 Bacteria 4668
230 Ga0207663_10021455 3300025916 Bacteria 3677
231 Ga0207649_10613944 3300025920 Bacteria 837
232 Ga0207652_10081619 3300025921 Bacteria 2828
233 Ga0207646_10004811 3300025922 Bacteria 14484
234 Ga0207646_10207641 3300025922 Bacteria 1769
235 Ga0207646_10494475 3300025922 Bacteria 1102
236 Ga0207681_10325744 3300025923 Bacteria 1223
237 Ga0207681_10503742 3300025923 Bacteria 992
238 Ga0207659_10438613 3300025926 Bacteria 1098
239 Ga0207687_10231483 3300025927 Bacteria 1460
240 Ga0207700_10317037 3300025928 Bacteria 1350
241 Ga0207664_10015920 3300025929 Bacteria 5477
242 Ga0207664_10055758 3300025929 Bacteria 3137
243 Ga0207644_11140460 3300025931 Bacteria 655
244 Ga0207690_10031358 3300025932 Bacteria 3400
245 Ga0207690_10463051 3300025932 Bacteria 1020
246 Ga0207706_10044247 3300025933 Bacteria 3946
247 Ga0207706_10188713 3300025933 Bacteria 1810
248 Ga0207686_10147494 3300025934 Bacteria 1634
249 Ga0207686_10230220 3300025934 Bacteria 1343
250 Ga0207686_10613658 3300025934 Unclassified 857
251 Ga0207709_10378441 3300025935 Bacteria 1077
252 Ga0207704_10053593 3300025938 Bacteria 2453
253 Ga0207704_10249931 3300025938 Bacteria 1330
254 Ga0207665_10002748 3300025939 Bacteria 11802
255 Ga0207711_10028699 3300025941 Bacteria 4685
256 Ga0207711_10901175 3300025941 Bacteria 822
257 Ga0207689_10168770 3300025942 Bacteria 1803
258 Ga0207689_10208955 3300025942 Bacteria 1612
259 Ga0207689_10656319 3300025942 Bacteria 884
260 Ga0207661_10035501 3300025944 Bacteria 3886
261 Ga0207661_10639338 3300025944 Bacteria 978
262 Ga0207679_10276100 3300025945 Bacteria 1439
263 Ga0207667_10008583 3300025949 Bacteria 12128
264 Ga0207667_10160143 3300025949 Bacteria 2315
265 Ga0207651_10263603 3300025960 Bacteria 1416
266 Ga0207712_10000892 3300025961 Bacteria 21673
267 Ga0207712_10007598 3300025961 Bacteria 6849
268 Ga0207712_10067379 3300025961 Bacteria 2562
269 Ga0207712_10602224 3300025961 Bacteria 951
270 Ga0207668_10043838 3300025972 Bacteria 3039
271 Ga0207668_10054742 3300025972 Bacteria 2770
272 Ga0207640_10133491 3300025981 Bacteria 1798
273 Ga0207658_10798656 3300025986 Bacteria 857
274 Ga0207677_10280619 3300026023 Bacteria 1367
275 Ga0207677_10286088 3300026023 Bacteria 1355
276 Ga0207703_10002995 3300026035 Bacteria 14322
277 Ga0207703_10088353 3300026035 Bacteria 2601
278 Ga0207639_10880384 3300026041 Bacteria 836
279 Ga0207678_10083655 3300026067 Bacteria 2730
280 Ga0207678_10824311 3300026067 Bacteria 819
281 Ga0207708_10021987 3300026075 Bacteria 4814
282 Ga0207708_10268161 3300026075 Bacteria 1380
283 Ga0207708_10305312 3300026075 Bacteria 1295
284 Ga0207702_10599091 3300026078 Bacteria 1081
285 Ga0207702_10673059 3300026078 Bacteria 1019
286 Ga0207641_11087135 3300026088 Bacteria 798
287 Ga0207648_10003957 3300026089 Bacteria 15400
288 Ga0207648_10090332 3300026089 Bacteria 2676
289 Ga0207648_10178185 3300026089 Bacteria 1880
290 Ga0207648_10766161 3300026089 Bacteria 897
291 Ga0207674_10878991 3300026116 Bacteria 864
292 Ga0207675_100008204 3300026118 Bacteria 9839
293 Ga0207675_101297314 3300026118 Bacteria 748
294 Ga0207683_10002677 3300026121 Bacteria 15561
295 Ga0207683_10035646 3300026121 Bacteria 4328
296 Ga0207683_10098541 3300026121 Bacteria 2608
297 Ga0207428_10004318 3300027907 Bacteria 13574
298 Ga0207428_10073021 3300027907 Bacteria 2693
299 Ga0207428_10106211 3300027907 Bacteria 2165
300 Ga0207428_10163361 3300027907 Bacteria 1690
301 Ga0268266_10957087 3300028379 Bacteria 828
302 Ga0268265_10001310 3300028380 Bacteria 21349
303 Ga0268265_10115616 3300028380 Bacteria 2199
304 Ga0265339_10150091 3300031249 Bacteria 1179
305 Ga0265316_10149762 3300031344 Bacteria 1748
306 Ga0307408_100055665 3300031548 Bacteria 2865
307 Ga0265313_10067392 3300031595 Bacteria 1656
308 Ga0265314_10001429 3300031711 Bacteria 26698
309 Ga0307405_10491830 3300031731 Bacteria 981
310 Ga0307413_10677795 3300031824 Bacteria 854
311 Ga0307410_10016068 3300031852 Bacteria 4453
312 Ga0307406_10197510 3300031901 Bacteria 1478
313 Ga0307412_10304542 3300031911 Bacteria 1261
314 Ga0307416_100005645 3300032002 Bacteria 7723
315 Ga0307416_100055060 3300032002 Bacteria 3201
316 Ga0307416_100061780 3300032002 Bacteria 3060
317 Ga0307416_100135030 3300032002 Bacteria 2230
318 Ga0307416_100207420 3300032002 Bacteria 1866
319 Ga0307414_10347358 3300032004 Bacteria 1272
320 Ga0307411_11350636 3300032005 Bacteria 651
321 Ga0373948_0016343 3300034817 Bacteria 1371
322 Ga0373948_0073206 3300034817 Bacteria 771
323 Ga0373929_0079718 3300035085 Bacteria 796
324 Ga0373951_0020703 3300035091 Bacteria 1508
325 Ga0373941_0035943 3300035115 Bacteria 1504
326 Ga0373945_0014551 3300035116 Bacteria 2638
327 Ga0373945_0014916 3300035116 Bacteria 2609
328 Ga0373943_0012951 3300035170 Bacteria 3761
329 Ga0373943_0497356 3300035170 Bacteria 712
330 Ga0373961_0032797 3300035241 Bacteria 1459
331 Ga0373924_0241616 3300035410 Bacteria 799
332 Ga0373931_0197585 3300035691 Bacteria 1200
333 Ga0373935_1076107 3300035692 Bacteria 598
334 Ga0373947_0007168 3300035725 Bacteria 6462
335 Ga0373947_0100491 3300035725 Bacteria 1817
336 Ga0373925_0040228 3300037068 Bacteria 3461
337 Ga0373925_0217170 3300037068 Bacteria 1525
338 Ga0373925_0389776 3300037068 Bacteria 1135
339 Ga0395899_0002561 3300037312 Bacteria 14703
340 Ga0395899_0004500 3300037312 Bacteria 10867
341 Ga0395899_0018779 3300037312 Bacteria 5253
342 Ga0395900_0002877 3300037418 Bacteria 18752
343 Ga0395900_0003158 3300037418 Bacteria 17863
344 Ga0395900_0113712 3300037418 Bacteria 2778
345 Ga0395900_0240892 3300037418 Bacteria 1814
346 Ga0395898_0003255 3300037466 Bacteria 18259
347 Ga0395898_0096140 3300037466 Bacteria 2845
348 Ga0395898_0114121 3300037466 Bacteria 2589
349 Ga0395905_0005310 3300037471 Bacteria 13169
350 Ga0395905_0020326 3300037471 Bacteria 6289
351 Ga0395905_0174961 3300037471 Bacteria 2015
352 Ga0395905_0282527 3300037471 Bacteria 1546
353 Ga0395901_0001412 3300038443 Bacteria 25084
354 Ga0395901_0009324 3300038443 Bacteria 9949
355 Ga0395901_0010134 3300038443 Bacteria 9550
356 Ga0395901_0037347 3300038443 Bacteria 5023
357 Ga0395901_0094915 3300038443 Bacteria 3125
358 Ga0395901_0116717 3300038443 Bacteria 2804
359 Ga0395901_0150797 3300038443 Bacteria 2443
360 Ga0395901_0848567 3300038443 Bacteria 899
361 Ga0451853_2463847 3300041512 Bacteria 674
362 Ga0439448_0003045 3300042005 Bacteria 4605
363 Ga0439450_040474 3300042008 Bacteria 1080
364 Ga0439455_0014270 3300042012 Bacteria 1812
365 Ga0439462_0034849 3300042015 Bacteria 1337
366 Ga0439463_041139 3300042016 Bacteria 1175
367 Ga0466961_0006873 3300044693 Bacteria 7237
368 Ga0466963_0006322 3300044694 Bacteria 7004
369 Ga0466963_0114063 3300044694 Bacteria 1856
370 Ga0466963_0775645 3300044694 Bacteria 676
371 Ga0466964_0332479 3300044706 Bacteria 775
372 Ga0466971_0000369 3300044719 Bacteria 17368
373 Ga0466971_0044407 3300044719 Bacteria 1995
374 Ga0466957_0064999 3300044842 Bacteria 2245
375 Ga0466960_0088100 3300044901 Bacteria 1577
376 Ga0466959_0013898 3300045049 Bacteria 5845
377 Ga0451576_0024842 3300045051 Bacteria 6465
378 Ga0451576_0216172 3300045051 Unclassified 2001
379 Ga0451576_0433908 3300045051 Bacteria 1379
380 Ga0451576_0778296 3300045051 Bacteria 1005
381 Ga0466958_0001889 3300045836 Bacteria 10239
382 Ga0466967_0009363 3300045976 Bacteria 7262
383 Ga0466967_0031932 3300045976 Bacteria 4440
384 Ga0466967_0501614 3300045976 Bacteria 1191
385 Ga0466967_1104042 3300045976 Bacteria 790
386 Ga0495603_0003147 3300046455 Bacteria 9812
387 Ga0495603_0324151 3300046455 Bacteria 884
388 Ga0495629_0009051 3300046459 Bacteria 7299
389 Ga0495641_0001643 3300046461 Bacteria 18752
390 Ga0495641_0069480 3300046461 Bacteria 1583
391 Ga0495641_0168555 3300046461 Bacteria 980
392 Ga0495582_0030909 3300046473 Bacteria 2942
393 Ga0495582_0092613 3300046473 Bacteria 1686
394 Ga0495582_0114488 3300046473 Bacteria 1516
395 Ga0495639_0089153 3300046475 Bacteria 1445
396 Ga0495594_0000683 3300046499 Bacteria 17470
397 Ga0495594_0126071 3300046499 Bacteria 1449
398 Ga0495596_0035248 3300046500 Bacteria 1985
399 Ga0495630_0366449 3300046517 Bacteria 1103
400 Ga0495630_0380312 3300046517 Bacteria 1081
401 Ga0495637_0073450 3300046520 Bacteria 1376
402 Ga0495666_0334824 3300046526 Unclassified 683
403 Ga0495642_0096690 3300046528 Bacteria 1254
404 Ga0495665_0059897 3300046531 Bacteria 2010
405 Ga0495667_0013253 3300046559 Bacteria 5582
406 Ga0495625_0142517 3300046660 Bacteria 1616
407 Ga0495659_0141785 3300046664 Bacteria 960
408 Ga0495661_0115464 3300046665 Bacteria 1491
409 Ga0495588_0009283 3300046674 Bacteria 4541
410 Ga0495647_0046268 3300046681 Bacteria 1675
411 Ga0495658_0066884 3300046683 Bacteria 2077
412 Ga0495658_0085784 3300046683 Bacteria 1856
413 Ga0495658_0300747 3300046683 Bacteria 1015
414 Ga0495613_0099110 3300046689 Bacteria 2105
415 Ga0495589_0197201 3300046794 Bacteria 951
416 Ga0495581_0082679 3300047315 Bacteria 1860
417 Ga0495636_0239899 3300047318 Bacteria 836
418 Ga0495676_0020480 3300047321 Bacteria 5800
419 Ga0495676_0058860 3300047321 Bacteria 3021
420 Ga0496100_0156744 3300048903 Bacteria 1629
421 Ga0496100_0228456 3300048903 Bacteria 1368
422 Ga0496100_0288054 3300048903 Bacteria 1226
423 Ga0496101_0244159 3300048904 Bacteria 1398
424 Ga0496102_0119348 3300048905 Bacteria 2462
425 Ga0496102_0149815 3300048905 Bacteria 2191
426 Ga0496102_0168260 3300048905 Bacteria 2063
427 Ga0496102_0263730 3300048905 Bacteria 1624
428 Ga0496102_0303611 3300048905 Bacteria 1504
429 Ga0496102_0367896 3300048905 Bacteria 1353
430 Ga0496103_0072538 3300048906 Bacteria 2156
431 Ga0496103_0163054 3300048906 Bacteria 1430
432 Ga0496104_0008507 3300048907 Bacteria 9123
433 Ga0496104_0017407 3300048907 Bacteria 6542
434 Ga0496104_0036340 3300048907 Bacteria 4604
435 Ga0496105_0000620 3300048908 Bacteria 23734
436 Ga0496105_0126554 3300048908 Bacteria 2106
437 Ga0496105_0131118 3300048908 Bacteria 2066
438 Ga0496106_0248265 3300048909 Bacteria 1422
439 Ga0496106_0294899 3300048909 Bacteria 1300
440 Ga0496107_0146521 3300048910 Bacteria 1746
441 Ga0496107_0583372 3300048910 Bacteria 827
442 Ga0496107_0789226 3300048910 Bacteria 696
443 Ga0496108_0005030 3300048911 Bacteria 10680
444 Ga0496108_0019629 3300048911 Bacteria 5552
445 Ga0496108_0309680 3300048911 Bacteria 1376
446 Ga0496109_0001653 3300048912 Bacteria 18628
447 Ga0496109_0037803 3300048912 Bacteria 4362
448 Ga0496109_0964786 3300048912 Bacteria 790
449 Ga0496110_0000303 3300048913 Bacteria 32473
450 Ga0496110_0044309 3300048913 Bacteria 3885
451 Ga0496110_0273123 3300048913 Bacteria 1539
452 Ga0496111_0001054 3300048914 Bacteria 15179
453 Ga0496111_0185722 3300048914 Bacteria 1545
454 Ga0496112_0000326 3300048915 Bacteria 30727
455 Ga0496112_0076294 3300048915 Bacteria 3315
456 Ga0496112_0119000 3300048915 Bacteria 2611
457 Ga0496113_0001014 3300048916 Bacteria 15095
458 Ga0496113_0032865 3300048916 Bacteria 3772
459 Ga0496114_0038129 3300048917 Bacteria 3976
460 Ga0496114_0101898 3300048917 Bacteria 2452
461 Ga0496115_0097094 3300048918 Bacteria 2413
462 Ga0496115_0544918 3300048918 Bacteria 928
463 Ga0496115_0783889 3300048918 Bacteria 743
464 Ga0501040_0035771 3300049576 Bacteria 3369
465 Ga0501041_0081013 3300049577 Bacteria 1999
466 Ga0501041_0405883 3300049577 Bacteria 863
467 Ga0501042_0025060 3300049578 Bacteria 4188
468 Ga0501046_0126029 3300049580 Bacteria 1945
469 Ga0501048_0101744 3300049582 Bacteria 2027
470 Ga0501067_0113444 3300049583 Bacteria 1507
471 Ga0501067_0434019 3300049583 Bacteria 733
472 Ga0501068_0784809 3300049584 Bacteria 624
473 Ga0501069_0159195 3300049585 Bacteria 1300
474 Ga0501070_0310854 3300049586 Bacteria 1283
475 Ga0501072_0231563 3300049588 Bacteria 1472
476 Ga0501072_0726849 3300049588 Bacteria 780
477 Ga0501072_0858525 3300049588 Unclassified 710
478 Ga0501074_0113762 3300049590 Bacteria 1936
479 Ga0501074_0153252 3300049590 Bacteria 1647
480 Ga0501075_0019669 3300049591 Bacteria 4901
481 Ga0501076_0566758 3300049592 Bacteria 937
482 Ga0501077_0039943 3300049593 Bacteria 2989
483 Ga0501079_0023801 3300049741 Bacteria 4699
484 Ga0501079_0126561 3300049741 Bacteria 1988
485 Ga0501079_0699179 3300049741 Bacteria 798
486 Ga0501080_0361750 3300049742 Bacteria 1309
487 Ga0501080_1087373 3300049742 Bacteria 691
488 Ga0501081_0019023 3300049743 Bacteria 4568
489 Ga0501083_0132538 3300049744 Bacteria 1634
490 Ga0501035_0666902 3300049822 Bacteria 842
491 Ga0501045_0097561 3300049824 Bacteria 2174
492 nmdc:mga06z11_379363_c1 3300050494 Bacteria 849
493 nmdc:mga05p37_189318_c1 3300050507 Bacteria 2499
494 nmdc:mga05p37_27153_c1 3300050507 Bacteria 3790
495 nmdc:mga05p37_330351_c1 3300050507 Bacteria 1801
496 nmdc:mga05p37_41815_c1 3300050507 Bacteria 5628
497 nmdc:mga05p37_942170_c1 3300050507 Bacteria 925
498 nmdc:mga09592_100018_c1 3300050508 Bacteria 2483
499 nmdc:mga09592_429118_c1 3300050508 Bacteria 1141
500 nmdc:mga0qj67_302899_c1 3300050509 Bacteria 1295
501 nmdc:mga06r32_1176684_c1 3300050510 Bacteria 714
502 nmdc:mga06r32_346208_c1 3300050510 Bacteria 1471
503 nmdc:mga06r32_976359_c1 3300050510 Bacteria 801
504 nmdc:mga08y16_138665_c1 3300050511 Bacteria 2529
505 nmdc:mga08y16_16959_c1 3300050511 Bacteria 7669
506 nmdc:mga08y16_282647_c1 3300050511 Bacteria 1711
507 nmdc:mga08y16_320303_c1 3300050511 Bacteria 1596
508 nmdc:mga08y16_50364_c1 3300050511 Bacteria 4359
509 nmdc:mga0n895_105756_c1 3300050512 Bacteria 2827
510 nmdc:mga0n895_135856_c1 3300050512 Bacteria 2486
511 nmdc:mga0n895_239415_c1 3300050512 Bacteria 1841
512 nmdc:mga0n895_260582_c1 3300050512 Bacteria 1759
513 nmdc:mga0rr50_105708_c1 3300050513 Bacteria 2220
514 nmdc:mga0rr50_125713_c1 3300050513 Bacteria 2047
515 nmdc:mga0rr50_229143_c1 3300050513 Bacteria 1537
516 nmdc:mga0rr50_30564_c1 3300050513 Bacteria 3815
517 nmdc:mga0rr50_47618_c1 3300050513 Bacteria 3164
518 nmdc:mga0rr50_81969_c1 3300050513 Bacteria 2491
519 nmdc:mga08x19_140661_c1 3300050514 Bacteria 1630
520 nmdc:mga08x19_39598_c1 3300050514 Bacteria 2996
521 nmdc:mga08x19_70473_c1 3300050514 Bacteria 2278
522 nmdc:mga0a205_127532_c1 3300050515 Bacteria 2444
523 nmdc:mga0a205_27021_c1 3300050515 Bacteria 5479
524 nmdc:mga0a205_313086_c1 3300050515 Bacteria 1442
525 nmdc:mga0a205_622161_c1 3300050515 Bacteria 932
526 nmdc:mga0a205_77935_c1 3300050515 Bacteria 3202
527 Ga0501084_0725900 3300054114 Bacteria 837
528 Ga0590075_012923 3300059424 Bacteria 2030
529 Ga0501082_0351749 3300060353 Bacteria 1285
530 Ga0466962_0001834 3300061719 Bacteria 10005
531 Ga0530510_0069691 3300061734 Bacteria 2552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0100491 Ga0373947_0100491_177_731 159
2 3300035116 Ga0373945_0014551 Ga0373945_0014551_1814_2368 160
3 3300037068 Ga0373925_0040228 Ga0373925_0040228_222_776 160
4 3300046455 Ga0495603_0324151 Ga0495603_0324151_47_601 160
5 3300046461 Ga0495641_0069480 Ga0495641_0069480_603_1157 160
6 3300005440 Ga0070705_100343380 Ga0070705_1003433802 172
7 3300005546 Ga0070696_101007171 Ga0070696_1010071711 172
8 3300021388 Ga0213875_10118728 Ga0213875_101187282 173
9 3300049588 Ga0501072_0726849 Ga0501072_0726849_155_760 173
10 3300049592 Ga0501076_0566758 Ga0501076_0566758_276_884 173
11 3300049742 Ga0501080_0361750 Ga0501080_0361750_403_933 175
12 3300049583 Ga0501067_0434019 Ga0501067_0434019_89_658 177
13 3300050515 nmdc:mga0a205_127532_c1 nmdc:mga0a205_127532_c1_112_657 178
14 3300005455 Ga0070663_100085230 Ga0070663_1000852302 179
15 3300009094 Ga0111539_10137563 Ga0111539_101375634 179
16 3300009147 Ga0114129_10035952 Ga0114129_1003595210 179
17 3300050511 nmdc:mga08y16_320303_c1 nmdc:mga08y16_320303_c1_961_1503 179
18 3300048904 Ga0496101_0244159 Ga0496101_0244159_480_1034 180
19 3300049586 Ga0501070_0310854 Ga0501070_0310854_402_1001 180
20 3300049590 Ga0501074_0113762 Ga0501074_0113762_802_1401 180
21 3300049744 Ga0501083_0132538 Ga0501083_0132538_818_1417 180
22 3300054114 Ga0501084_0725900 Ga0501084_0725900_158_757 180
23 3300020082 Ga0206353_10317817 Ga0206353_103178177 181
24 3300025901 Ga0207688_10203591 Ga0207688_102035912 181
25 3300005347 Ga0070668_100066826 Ga0070668_1000668262 182
26 3300005435 Ga0070714_100178232 Ga0070714_1001782321 182
27 3300005436 Ga0070713_100594757 Ga0070713_1005947571 182
28 3300005437 Ga0070710_10060598 Ga0070710_100605983 182
29 3300005455 Ga0070663_100199214 Ga0070663_1001992142 182
30 3300005457 Ga0070662_100054168 Ga0070662_1000541684 182
31 3300005546 Ga0070696_100014567 Ga0070696_1000145677 182
32 3300005547 Ga0070693_100014894 Ga0070693_1000148943 182
33 3300005563 Ga0068855_100204044 Ga0068855_1002040442 182
34 3300005719 Ga0068861_100024197 Ga0068861_1000241973 182
35 3300009553 Ga0105249_10020054 Ga0105249_100200546 182
36 3300010375 Ga0105239_10459105 Ga0105239_104591052 182
37 3300013306 Ga0163162_10059461 Ga0163162_100594616 182
38 3300025933 Ga0207706_10188713 Ga0207706_101887133 182
39 3300025949 Ga0207667_10160143 Ga0207667_101601432 182
40 3300025961 Ga0207712_10067379 Ga0207712_100673793 182
41 3300025972 Ga0207668_10043838 Ga0207668_100438384 182
42 3300026118 Ga0207675_100008204 Ga0207675_1000082044 182
43 3300037418 Ga0395900_0113712 Ga0395900_0113712_690_1241 182
44 3300037471 Ga0395905_0282527 Ga0395905_0282527_109_660 182
45 3300038443 Ga0395901_0094915 Ga0395901_0094915_614_1165 182
46 3300044693 Ga0466961_0006873 Ga0466961_0006873_3645_4199 183
47 3300044694 Ga0466963_0114063 Ga0466963_0114063_560_1114 183
48 3300044694 Ga0466963_0775645 Ga0466963_0775645_70_624 183
49 3300044706 Ga0466964_0332479 Ga0466964_0332479_206_760 183
50 3300044719 Ga0466971_0000369 Ga0466971_0000369_11914_12468 183
51 3300044842 Ga0466957_0064999 Ga0466957_0064999_152_706 183
52 3300045049 Ga0466959_0013898 Ga0466959_0013898_1540_2094 183
53 3300045836 Ga0466958_0001889 Ga0466958_0001889_3039_3593 183
54 3300045976 Ga0466967_0009363 Ga0466967_0009363_2292_2846 183
55 3300045976 Ga0466967_0031932 Ga0466967_0031932_928_1482 183
56 3300046517 Ga0495630_0380312 Ga0495630_0380312_486_1040 183
57 3300046526 Ga0495666_0334824 Ga0495666_0334824_92_646 183
58 3300046531 Ga0495665_0059897 Ga0495665_0059897_1205_1759 183
59 3300046683 Ga0495658_0066884 Ga0495658_0066884_49_603 183
60 3300061719 Ga0466962_0001834 Ga0466962_0001834_1970_2524 183
61 3300005435 Ga0070714_101133736 Ga0070714_1011337361 184
62 3300005436 Ga0070713_100145793 Ga0070713_1001457932 184
63 3300025929 Ga0207664_10015920 Ga0207664_100159206 184
64 3300031249 Ga0265339_10150091 Ga0265339_101500912 184
65 3300031344 Ga0265316_10149762 Ga0265316_101497622 184
66 3300031595 Ga0265313_10067392 Ga0265313_100673922 184
67 3300035170 Ga0373943_0497356 Ga0373943_0497356_43_621 184
68 3300035410 Ga0373924_0241616 Ga0373924_0241616_150_707 184
69 3300035692 Ga0373935_1076107 Ga0373935_1076107_24_581 184
70 3300044719 Ga0466971_0044407 Ga0466971_0044407_815_1372 184
71 3300045051 Ga0451576_0778296 Ga0451576_0778296_93_680 184
72 3300045976 Ga0466967_0501614 Ga0466967_0501614_572_1135 184
73 3300046459 Ga0495629_0009051 Ga0495629_0009051_2391_2969 184
74 3300046473 Ga0495582_0114488 Ga0495582_0114488_411_989 184
75 3300046499 Ga0495594_0126071 Ga0495594_0126071_218_796 184
76 3300046681 Ga0495647_0046268 Ga0495647_0046268_622_1200 184
77 3300046689 Ga0495613_0099110 Ga0495613_0099110_1396_1974 184
78 3300047315 Ga0495581_0082679 Ga0495581_0082679_243_821 184
79 3300050513 nmdc:mga0rr50_125713_c1 nmdc:mga0rr50_125713_c1_27_584 184
80 3300014968 Ga0157379_10640808 Ga0157379_106408082 185
81 3300050511 nmdc:mga08y16_282647_c1 nmdc:mga08y16_282647_c1_1107_1688 186
82 3300041512 Ga0451853_2463847 Ga0451853_2463847_93_659 187
83 3300014497 Ga0182008_10126559 Ga0182008_101265592 188
84 3300005937 Ga0081455_10013877 Ga0081455_100138772 190
85 3300006846 Ga0075430_100183928 Ga0075430_1001839282 190
86 3300006847 Ga0075431_100336120 Ga0075431_1003361202 190
87 3300006880 Ga0075429_100552655 Ga0075429_1005526552 190
88 3300046664 Ga0495659_0141785 Ga0495659_0141785_264_842 190
89 3300047321 Ga0495676_0058860 Ga0495676_0058860_2259_2837 190
90 3300050508 nmdc:mga09592_429118_c1 nmdc:mga09592_429118_c1_306_911 190
91 3300050510 nmdc:mga06r32_976359_c1 nmdc:mga06r32_976359_c1_87_695 190
92 3300005340 Ga0070689_100033752 Ga0070689_1000337525 191
93 3300005347 Ga0070668_100010313 Ga0070668_1000103136 191
94 3300005367 Ga0070667_100021563 Ga0070667_1000215635 191
95 3300005437 Ga0070710_10275828 Ga0070710_102758281 191
96 3300005439 Ga0070711_100013025 Ga0070711_1000130252 191
97 3300005468 Ga0070707_100009845 Ga0070707_1000098454 191
98 3300005548 Ga0070665_100242497 Ga0070665_1002424972 191
99 3300005618 Ga0068864_100436599 Ga0068864_1004365992 191
100 3300005842 Ga0068858_100524023 Ga0068858_1005240231 191
101 3300005843 Ga0068860_100058370 Ga0068860_1000583704 191
102 3300005844 Ga0068862_100003276 Ga0068862_10000327613 191
103 3300005937 Ga0081455_10001965 Ga0081455_1000196516 191
104 3300006178 Ga0075367_10198975 Ga0075367_101989752 191
105 3300006852 Ga0075433_10043090 Ga0075433_100430902 191
106 3300006852 Ga0075433_11036774 Ga0075433_110367742 191
107 3300006871 Ga0075434_100048551 Ga0075434_1000485513 191
108 3300006914 Ga0075436_100201466 Ga0075436_1002014662 191
109 3300007076 Ga0075435_100035003 Ga0075435_1000350032 191
110 3300009147 Ga0114129_10186825 Ga0114129_101868252 191
111 3300009147 Ga0114129_10605179 Ga0114129_106051792 191
112 3300009176 Ga0105242_10243503 Ga0105242_102435032 191
113 3300009553 Ga0105249_10003647 Ga0105249_1000364713 191
114 3300014968 Ga0157379_10154678 Ga0157379_101546782 191
115 3300025916 Ga0207663_10012017 Ga0207663_100120176 191
116 3300025922 Ga0207646_10004811 Ga0207646_1000481110 191
117 3300025934 Ga0207686_10147494 Ga0207686_101474942 191
118 3300025961 Ga0207712_10007598 Ga0207712_100075982 191
119 3300025972 Ga0207668_10054742 Ga0207668_100547423 191
120 3300026035 Ga0207703_10088353 Ga0207703_100883533 191
121 3300026088 Ga0207641_11087135 Ga0207641_110871352 191
122 3300028379 Ga0268266_10957087 Ga0268266_109570872 191
123 3300028380 Ga0268265_10001310 Ga0268265_1000131019 191
124 3300037466 Ga0395898_0114121 Ga0395898_0114121_235_843 191
125 3300038443 Ga0395901_0848567 Ga0395901_0848567_240_845 191
126 3300046660 Ga0495625_0142517 Ga0495625_0142517_426_1031 191
127 3300048905 Ga0496102_0367896 Ga0496102_0367896_609_1220 191
128 3300049577 Ga0501041_0405883 Ga0501041_0405883_95_709 191
129 3300049588 Ga0501072_0231563 Ga0501072_0231563_560_1174 191
130 3300049741 Ga0501079_0126561 Ga0501079_0126561_544_1158 191
131 3300049741 Ga0501079_0699179 Ga0501079_0699179_58_672 191
132 3300050494 nmdc:mga06z11_379363_c1 nmdc:mga06z11_379363_c1_45_656 191
133 3300050507 nmdc:mga05p37_189318_c1 nmdc:mga05p37_189318_c1_201_797 191
134 3300050512 nmdc:mga0n895_105756_c1 nmdc:mga0n895_105756_c1_511_1122 191
135 3300050513 nmdc:mga0rr50_47618_c1 nmdc:mga0rr50_47618_c1_1732_2343 191
136 3300050515 nmdc:mga0a205_27021_c1 nmdc:mga0a205_27021_c1_3273_3884 191
137 3300060353 Ga0501082_0351749 Ga0501082_0351749_459_1073 191
138 3300005328 Ga0070676_10045454 Ga0070676_100454543 192
139 3300005329 Ga0070683_100100792 Ga0070683_1001007922 192
140 3300005338 Ga0068868_100183743 Ga0068868_1001837431 192
141 3300005341 Ga0070691_10064559 Ga0070691_100645592 192
142 3300005345 Ga0070692_10145923 Ga0070692_101459231 192
143 3300005347 Ga0070668_100886285 Ga0070668_1008862852 192
144 3300005353 Ga0070669_100872469 Ga0070669_1008724691 192
145 3300005355 Ga0070671_100284434 Ga0070671_1002844342 192
146 3300005366 Ga0070659_100165216 Ga0070659_1001652162 192
147 3300005438 Ga0070701_10033585 Ga0070701_100335853 192
148 3300005440 Ga0070705_100070241 Ga0070705_1000702413 192
149 3300005441 Ga0070700_100024401 Ga0070700_1000244014 192
150 3300005441 Ga0070700_100344265 Ga0070700_1003442651 192
151 3300005444 Ga0070694_100097349 Ga0070694_1000973492 192
152 3300005456 Ga0070678_100089635 Ga0070678_1000896353 192
153 3300005456 Ga0070678_100373584 Ga0070678_1003735842 192
154 3300005457 Ga0070662_100042228 Ga0070662_1000422285 192
155 3300005458 Ga0070681_10107738 Ga0070681_101077382 192
156 3300005458 Ga0070681_11178366 Ga0070681_111783661 192
157 3300005459 Ga0068867_100021158 Ga0068867_1000211586 192
158 3300005459 Ga0068867_100731871 Ga0068867_1007318712 192
159 3300005530 Ga0070679_100014327 Ga0070679_1000143274 192
160 3300005535 Ga0070684_100138366 Ga0070684_1001383662 192
161 3300005535 Ga0070684_100242289 Ga0070684_1002422892 192
162 3300005539 Ga0068853_100352294 Ga0068853_1003522942 192
163 3300005544 Ga0070686_100054245 Ga0070686_1000542452 192
164 3300005544 Ga0070686_100261512 Ga0070686_1002615122 192
165 3300005544 Ga0070686_100660313 Ga0070686_1006603132 192
166 3300005546 Ga0070696_100503390 Ga0070696_1005033902 192
167 3300005547 Ga0070693_100009139 Ga0070693_1000091392 192
168 3300005547 Ga0070693_100124904 Ga0070693_1001249041 192
169 3300005578 Ga0068854_100066829 Ga0068854_1000668292 192
170 3300005578 Ga0068854_100212070 Ga0068854_1002120702 192
171 3300005614 Ga0068856_100132704 Ga0068856_1001327043 192
172 3300005614 Ga0068856_100478029 Ga0068856_1004780292 192
173 3300005615 Ga0070702_100268723 Ga0070702_1002687231 192
174 3300005615 Ga0070702_100423609 Ga0070702_1004236091 192
175 3300005617 Ga0068859_101418819 Ga0068859_1014188191 192
176 3300005840 Ga0068870_10648824 Ga0068870_106488242 192
177 3300005842 Ga0068858_100393330 Ga0068858_1003933302 192
178 3300005843 Ga0068860_100276867 Ga0068860_1002768672 192
179 3300005844 Ga0068862_101255778 Ga0068862_1012557781 192
180 3300005985 Ga0081539_10001069 Ga0081539_1000106925 192
181 3300006881 Ga0068865_100065808 Ga0068865_1000658082 192
182 3300006931 Ga0097620_101418921 Ga0097620_1014189211 192
183 3300009093 Ga0105240_11045703 Ga0105240_110457032 192
184 3300009094 Ga0111539_10007984 Ga0111539_1000798412 192
185 3300009098 Ga0105245_10022805 Ga0105245_100228053 192
186 3300009098 Ga0105245_10027098 Ga0105245_100270984 192
187 3300009147 Ga0114129_10777693 Ga0114129_107776932 192
188 3300009148 Ga0105243_10028503 Ga0105243_100285034 192
189 3300009174 Ga0105241_10224946 Ga0105241_102249462 192
190 3300009177 Ga0105248_10359906 Ga0105248_103599062 192
191 3300009177 Ga0105248_10381790 Ga0105248_103817902 192
192 3300009545 Ga0105237_10735093 Ga0105237_107350932 192
193 3300009553 Ga0105249_10169658 Ga0105249_101696583 192
194 3300010375 Ga0105239_10131671 Ga0105239_101316714 192
195 3300011119 Ga0105246_10141767 Ga0105246_101417672 192
196 3300013102 Ga0157371_10139959 Ga0157371_101399592 192
197 3300013307 Ga0157372_10176052 Ga0157372_101760522 192
198 3300013307 Ga0157372_10272150 Ga0157372_102721502 192
199 3300013308 Ga0157375_10019614 Ga0157375_100196148 192
200 3300013308 Ga0157375_10327878 Ga0157375_103278782 192
201 3300013308 Ga0157375_10649970 Ga0157375_106499702 192
202 3300014326 Ga0157380_10109269 Ga0157380_101092692 192
203 3300014497 Ga0182008_10035777 Ga0182008_100357772 192
204 3300014968 Ga0157379_10524135 Ga0157379_105241352 192
205 3300017792 Ga0163161_10404320 Ga0163161_104043202 192
206 3300025899 Ga0207642_10064085 Ga0207642_100640851 192
207 3300025911 Ga0207654_10221659 Ga0207654_102216592 192
208 3300025912 Ga0207707_10102815 Ga0207707_101028152 192
209 3300025914 Ga0207671_10604321 Ga0207671_106043212 192
210 3300025921 Ga0207652_10081619 Ga0207652_100816192 192
211 3300025923 Ga0207681_10503742 Ga0207681_105037421 192
212 3300025927 Ga0207687_10231483 Ga0207687_102314832 192
213 3300025931 Ga0207644_11140460 Ga0207644_111404601 192
214 3300025932 Ga0207690_10463051 Ga0207690_104630512 192
215 3300025933 Ga0207706_10044247 Ga0207706_100442473 192
216 3300025934 Ga0207686_10230220 Ga0207686_102302202 192
217 3300025938 Ga0207704_10053593 Ga0207704_100535933 192
218 3300025941 Ga0207711_10901175 Ga0207711_109011751 192
219 3300025942 Ga0207689_10656319 Ga0207689_106563191 192
220 3300025944 Ga0207661_10035501 Ga0207661_100355013 192
221 3300025961 Ga0207712_10602224 Ga0207712_106022241 192
222 3300025981 Ga0207640_10133491 Ga0207640_101334912 192
223 3300025986 Ga0207658_10798656 Ga0207658_107986562 192
224 3300026023 Ga0207677_10280619 Ga0207677_102806192 192
225 3300026023 Ga0207677_10286088 Ga0207677_102860881 192
226 3300026041 Ga0207639_10880384 Ga0207639_108803841 192
227 3300026067 Ga0207678_10824311 Ga0207678_108243111 192
228 3300026075 Ga0207708_10305312 Ga0207708_103053122 192
229 3300026078 Ga0207702_10599091 Ga0207702_105990912 192
230 3300026078 Ga0207702_10673059 Ga0207702_106730591 192
231 3300026089 Ga0207648_10003957 Ga0207648_1000395716 192
232 3300026089 Ga0207648_10766161 Ga0207648_107661611 192
233 3300026118 Ga0207675_101297314 Ga0207675_1012973141 192
234 3300026121 Ga0207683_10035646 Ga0207683_100356465 192
235 3300026121 Ga0207683_10098541 Ga0207683_100985413 192
236 3300027907 Ga0207428_10163361 Ga0207428_101633612 192
237 3300031901 Ga0307406_10197510 Ga0307406_101975102 192
238 3300035116 Ga0373945_0014916 Ga0373945_0014916_1152_1736 192
239 3300035170 Ga0373943_0012951 Ga0373943_0012951_1030_1614 192
240 3300035725 Ga0373947_0007168 Ga0373947_0007168_3235_3819 192
241 3300037068 Ga0373925_0217170 Ga0373925_0217170_898_1482 192
242 3300037068 Ga0373925_0389776 Ga0373925_0389776_141_725 192
243 3300037312 Ga0395899_0002561 Ga0395899_0002561_11455_12039 192
244 3300037418 Ga0395900_0240892 Ga0395900_0240892_808_1392 192
245 3300037471 Ga0395905_0020326 Ga0395905_0020326_2990_3574 192
246 3300038443 Ga0395901_0037347 Ga0395901_0037347_1768_2352 192
247 3300046455 Ga0495603_0003147 Ga0495603_0003147_8621_9205 192
248 3300046461 Ga0495641_0001643 Ga0495641_0001643_17343_17927 192
249 3300046473 Ga0495582_0030909 Ga0495582_0030909_737_1321 192
250 3300046475 Ga0495639_0089153 Ga0495639_0089153_80_664 192
251 3300046499 Ga0495594_0000683 Ga0495594_0000683_3706_4290 192
252 3300046500 Ga0495596_0035248 Ga0495596_0035248_1006_1590 192
253 3300046517 Ga0495630_0366449 Ga0495630_0366449_373_957 192
254 3300046559 Ga0495667_0013253 Ga0495667_0013253_3744_4331 192
255 3300046674 Ga0495588_0009283 Ga0495588_0009283_154_738 192
256 3300046683 Ga0495658_0085784 Ga0495658_0085784_961_1545 192
257 3300046683 Ga0495658_0300747 Ga0495658_0300747_197_814 192
258 3300046794 Ga0495589_0197201 Ga0495589_0197201_16_600 192
259 3300047321 Ga0495676_0020480 Ga0495676_0020480_3691_4275 192
260 3300048903 Ga0496100_0228456 Ga0496100_0228456_288_872 192
261 3300048903 Ga0496100_0288054 Ga0496100_0288054_101_685 192
262 3300048905 Ga0496102_0119348 Ga0496102_0119348_625_1209 192
263 3300048905 Ga0496102_0168260 Ga0496102_0168260_1223_1807 192
264 3300048905 Ga0496102_0263730 Ga0496102_0263730_484_1068 192
265 3300048905 Ga0496102_0303611 Ga0496102_0303611_63_647 192
266 3300048906 Ga0496103_0163054 Ga0496103_0163054_175_759 192
267 3300048907 Ga0496104_0008507 Ga0496104_0008507_8394_8978 192
268 3300048907 Ga0496104_0017407 Ga0496104_0017407_1539_2123 192
269 3300048908 Ga0496105_0000620 Ga0496105_0000620_4015_4599 192
270 3300048908 Ga0496105_0126554 Ga0496105_0126554_418_1002 192
271 3300048909 Ga0496106_0294899 Ga0496106_0294899_17_601 192
272 3300048910 Ga0496107_0146521 Ga0496107_0146521_65_649 192
273 3300048910 Ga0496107_0583372 Ga0496107_0583372_193_777 192
274 3300048910 Ga0496107_0789226 Ga0496107_0789226_71_655 192
275 3300048911 Ga0496108_0005030 Ga0496108_0005030_3459_4043 192
276 3300048911 Ga0496108_0019629 Ga0496108_0019629_4063_4647 192
277 3300048911 Ga0496108_0309680 Ga0496108_0309680_161_745 192
278 3300048912 Ga0496109_0001653 Ga0496109_0001653_5657_6241 192
279 3300048912 Ga0496109_0037803 Ga0496109_0037803_3315_3899 192
280 3300048913 Ga0496110_0000303 Ga0496110_0000303_28017_28601 192
281 3300048913 Ga0496110_0044309 Ga0496110_0044309_414_998 192
282 3300048914 Ga0496111_0001054 Ga0496111_0001054_9551_10135 192
283 3300048914 Ga0496111_0185722 Ga0496111_0185722_815_1399 192
284 3300048915 Ga0496112_0000326 Ga0496112_0000326_4563_5147 192
285 3300048915 Ga0496112_0119000 Ga0496112_0119000_870_1454 192
286 3300048916 Ga0496113_0001014 Ga0496113_0001014_6969_7553 192
287 3300048916 Ga0496113_0032865 Ga0496113_0032865_56_640 192
288 3300048917 Ga0496114_0038129 Ga0496114_0038129_3370_3954 192
289 3300048918 Ga0496115_0097094 Ga0496115_0097094_1168_1752 192
290 3300048918 Ga0496115_0544918 Ga0496115_0544918_330_914 192
291 3300049583 Ga0501067_0113444 Ga0501067_0113444_679_1263 192
292 3300049584 Ga0501068_0784809 Ga0501068_0784809_17_601 192
293 3300050510 nmdc:mga06r32_1176684_c1 nmdc:mga06r32_1176684_c1_81_671 192
294 3300050511 nmdc:mga08y16_50364_c1 nmdc:mga08y16_50364_c1_2734_3324 192
295 3300005337 Ga0070682_100019712 Ga0070682_1000197122 193
296 3300005364 Ga0070673_100586256 Ga0070673_1005862562 193
297 3300005365 Ga0070688_100037354 Ga0070688_1000373543 193
298 3300005434 Ga0070709_10060226 Ga0070709_100602263 193
299 3300005434 Ga0070709_10505572 Ga0070709_105055722 193
300 3300005439 Ga0070711_100078999 Ga0070711_1000789991 193
301 3300005440 Ga0070705_100663820 Ga0070705_1006638202 193
302 3300005459 Ga0068867_100063296 Ga0068867_1000632963 193
303 3300005466 Ga0070685_10022481 Ga0070685_100224812 193
304 3300005468 Ga0070707_100227375 Ga0070707_1002273752 193
305 3300005544 Ga0070686_100152691 Ga0070686_1001526912 193
306 3300005614 Ga0068856_100195711 Ga0068856_1001957112 193
307 3300005617 Ga0068859_100018888 Ga0068859_1000188884 193
308 3300005840 Ga0068870_10334626 Ga0068870_103346262 193
309 3300005844 Ga0068862_100061039 Ga0068862_1000610393 193
310 3300005937 Ga0081455_10003924 Ga0081455_1000392420 193
311 3300005937 Ga0081455_10216911 Ga0081455_102169112 193
312 3300005983 Ga0081540_1008104 Ga0081540_10081042 193
313 3300005983 Ga0081540_1039340 Ga0081540_10393402 193
314 3300006028 Ga0070717_10706947 Ga0070717_107069472 193
315 3300006058 Ga0075432_10016654 Ga0075432_100166543 193
316 3300006163 Ga0070715_10049659 Ga0070715_100496591 193
317 3300006173 Ga0070716_100082940 Ga0070716_1000829403 193
318 3300006237 Ga0097621_100057877 Ga0097621_1000578774 193
319 3300006358 Ga0068871_100110238 Ga0068871_1001102383 193
320 3300006844 Ga0075428_100166573 Ga0075428_1001665732 193
321 3300006844 Ga0075428_101082967 Ga0075428_1010829671 193
322 3300006852 Ga0075433_10155113 Ga0075433_101551133 193
323 3300006852 Ga0075433_10161298 Ga0075433_101612982 193
324 3300006852 Ga0075433_10545590 Ga0075433_105455902 193
325 3300006871 Ga0075434_100284926 Ga0075434_1002849262 193
326 3300006871 Ga0075434_100285697 Ga0075434_1002856972 193
327 3300006871 Ga0075434_100567640 Ga0075434_1005676402 193
328 3300006914 Ga0075436_100050839 Ga0075436_1000508393 193
329 3300006914 Ga0075436_100086662 Ga0075436_1000866623 193
330 3300006931 Ga0097620_100018889 Ga0097620_1000188892 193
331 3300007076 Ga0075435_100039967 Ga0075435_1000399673 193
332 3300007076 Ga0075435_100151517 Ga0075435_1001515172 193
333 3300007076 Ga0075435_100174420 Ga0075435_1001744202 193
334 3300009093 Ga0105240_10206325 Ga0105240_102063253 193
335 3300009094 Ga0111539_10002424 Ga0111539_100024245 193
336 3300009098 Ga0105245_10029729 Ga0105245_100297292 193
337 3300009147 Ga0114129_10526852 Ga0114129_105268522 193
338 3300009147 Ga0114129_10856021 Ga0114129_108560213 193
339 3300009174 Ga0105241_10132906 Ga0105241_101329062 193
340 3300009176 Ga0105242_10626564 Ga0105242_106265642 193
341 3300009177 Ga0105248_10012726 Ga0105248_100127266 193
342 3300010375 Ga0105239_10380686 Ga0105239_103806862 193
343 3300012507 Ga0157342_1000319 Ga0157342_10003193 193
344 3300013100 Ga0157373_10309510 Ga0157373_103095101 193
345 3300013306 Ga0163162_10121106 Ga0163162_101211064 193
346 3300014325 Ga0163163_10045091 Ga0163163_100450913 193
347 3300014968 Ga0157379_10004610 Ga0157379_100046103 193
348 3300017792 Ga0163161_10075755 Ga0163161_100757552 193
349 3300025898 Ga0207692_10057409 Ga0207692_100574091 193
350 3300025906 Ga0207699_10668113 Ga0207699_106681131 193
351 3300025909 Ga0207705_10624270 Ga0207705_106242701 193
352 3300025911 Ga0207654_10035153 Ga0207654_100351532 193
353 3300025915 Ga0207693_10095847 Ga0207693_100958473 193
354 3300025915 Ga0207693_10095848 Ga0207693_100958483 193
355 3300025916 Ga0207663_10021455 Ga0207663_100214554 193
356 3300025920 Ga0207649_10613944 Ga0207649_106139441 193
357 3300025922 Ga0207646_10207641 Ga0207646_102076412 193
358 3300025928 Ga0207700_10317037 Ga0207700_103170372 193
359 3300025929 Ga0207664_10055758 Ga0207664_100557584 193
360 3300025934 Ga0207686_10613658 Ga0207686_106136582 193
361 3300025935 Ga0207709_10378441 Ga0207709_103784411 193
362 3300025938 Ga0207704_10249931 Ga0207704_102499313 193
363 3300025939 Ga0207665_10002748 Ga0207665_100027487 193
364 3300025941 Ga0207711_10028699 Ga0207711_100286992 193
365 3300025960 Ga0207651_10263603 Ga0207651_102636032 193
366 3300026035 Ga0207703_10002995 Ga0207703_100029952 193
367 3300026067 Ga0207678_10083655 Ga0207678_100836552 193
368 3300026089 Ga0207648_10090332 Ga0207648_100903322 193
369 3300026089 Ga0207648_10178185 Ga0207648_101781853 193
370 3300026121 Ga0207683_10002677 Ga0207683_100026777 193
371 3300027907 Ga0207428_10004318 Ga0207428_100043189 193
372 3300027907 Ga0207428_10073021 Ga0207428_100730213 193
373 3300031911 Ga0307412_10304542 Ga0307412_103045422 193
374 3300034817 Ga0373948_0016343 Ga0373948_0016343_147_734 193
375 3300034817 Ga0373948_0073206 Ga0373948_0073206_118_705 193
376 3300035085 Ga0373929_0079718 Ga0373929_0079718_114_701 193
377 3300035091 Ga0373951_0020703 Ga0373951_0020703_473_1060 193
378 3300035115 Ga0373941_0035943 Ga0373941_0035943_224_811 193
379 3300035241 Ga0373961_0032797 Ga0373961_0032797_848_1435 193
380 3300035691 Ga0373931_0197585 Ga0373931_0197585_234_821 193
381 3300037312 Ga0395899_0004500 Ga0395899_0004500_2969_3562 193
382 3300037312 Ga0395899_0018779 Ga0395899_0018779_2969_3556 193
383 3300037418 Ga0395900_0002877 Ga0395900_0002877_14618_15205 193
384 3300037418 Ga0395900_0003158 Ga0395900_0003158_13187_13780 193
385 3300037466 Ga0395898_0003255 Ga0395898_0003255_13688_14281 193
386 3300037466 Ga0395898_0096140 Ga0395898_0096140_1956_2543 193
387 3300037471 Ga0395905_0005310 Ga0395905_0005310_11662_12255 193
388 3300037471 Ga0395905_0174961 Ga0395905_0174961_1303_1890 193
389 3300038443 Ga0395901_0001412 Ga0395901_0001412_15979_16566 193
390 3300038443 Ga0395901_0009324 Ga0395901_0009324_5273_5866 193
391 3300038443 Ga0395901_0116717 Ga0395901_0116717_299_892 193
392 3300038443 Ga0395901_0150797 Ga0395901_0150797_1208_1801 193
393 3300042005 Ga0439448_0003045 Ga0439448_0003045_3786_4373 193
394 3300042008 Ga0439450_040474 Ga0439450_040474_195_833 193
395 3300042012 Ga0439455_0014270 Ga0439455_0014270_659_1246 193
396 3300042016 Ga0439463_041139 Ga0439463_041139_424_1011 193
397 3300045051 Ga0451576_0024842 Ga0451576_0024842_4940_5527 193
398 3300045051 Ga0451576_0433908 Ga0451576_0433908_180_779 193
399 3300046461 Ga0495641_0168555 Ga0495641_0168555_223_843 193
400 3300046520 Ga0495637_0073450 Ga0495637_0073450_100_687 193
401 3300046528 Ga0495642_0096690 Ga0495642_0096690_588_1181 193
402 3300046665 Ga0495661_0115464 Ga0495661_0115464_843_1436 193
403 3300048905 Ga0496102_0149815 Ga0496102_0149815_657_1244 193
404 3300048906 Ga0496103_0072538 Ga0496103_0072538_99_686 193
405 3300048907 Ga0496104_0036340 Ga0496104_0036340_3816_4403 193
406 3300048908 Ga0496105_0131118 Ga0496105_0131118_91_678 193
407 3300048909 Ga0496106_0248265 Ga0496106_0248265_235_822 193
408 3300048912 Ga0496109_0964786 Ga0496109_0964786_148_735 193
409 3300048915 Ga0496112_0076294 Ga0496112_0076294_1548_2135 193
410 3300048917 Ga0496114_0101898 Ga0496114_0101898_1612_2199 193
411 3300048918 Ga0496115_0783889 Ga0496115_0783889_110_697 193
412 3300049742 Ga0501080_1087373 Ga0501080_1087373_11_622 193
413 3300050507 nmdc:mga05p37_41815_c1 nmdc:mga05p37_41815_c1_2296_2940 193
414 3300050507 nmdc:mga05p37_942170_c1 nmdc:mga05p37_942170_c1_62_649 193
415 3300050510 nmdc:mga06r32_346208_c1 nmdc:mga06r32_346208_c1_180_824 193
416 3300050511 nmdc:mga08y16_138665_c1 nmdc:mga08y16_138665_c1_1417_2061 193
417 3300050511 nmdc:mga08y16_16959_c1 nmdc:mga08y16_16959_c1_5286_5909 193
418 3300050512 nmdc:mga0n895_135856_c1 nmdc:mga0n895_135856_c1_1825_2469 193
419 3300050512 nmdc:mga0n895_239415_c1 nmdc:mga0n895_239415_c1_116_703 193
420 3300050513 nmdc:mga0rr50_105708_c1 nmdc:mga0rr50_105708_c1_1070_1657 193
421 3300050513 nmdc:mga0rr50_229143_c1 nmdc:mga0rr50_229143_c1_90_728 193
422 3300050513 nmdc:mga0rr50_30564_c1 nmdc:mga0rr50_30564_c1_1559_2182 193
423 3300050513 nmdc:mga0rr50_81969_c1 nmdc:mga0rr50_81969_c1_1289_1933 193
424 3300050514 nmdc:mga08x19_39598_c1 nmdc:mga08x19_39598_c1_1407_1994 193
425 3300050514 nmdc:mga08x19_70473_c1 nmdc:mga08x19_70473_c1_1290_1934 193
426 3300050515 nmdc:mga0a205_313086_c1 nmdc:mga0a205_313086_c1_118_756 193
427 3300050515 nmdc:mga0a205_622161_c1 nmdc:mga0a205_622161_c1_18_605 193
428 3300050515 nmdc:mga0a205_77935_c1 nmdc:mga0a205_77935_c1_1927_2571 193
429 3300005334 Ga0068869_100334538 Ga0068869_1003345382 194
430 3300005353 Ga0070669_100309909 Ga0070669_1003099092 194
431 3300005441 Ga0070700_100510000 Ga0070700_1005100002 194
432 3300005468 Ga0070707_100608272 Ga0070707_1006082721 194
433 3300005468 Ga0070707_100846073 Ga0070707_1008460731 194
434 3300005530 Ga0070679_100103606 Ga0070679_1001036062 194
435 3300005546 Ga0070696_100500725 Ga0070696_1005007251 194
436 3300005563 Ga0068855_100001260 Ga0068855_1000012605 194
437 3300005577 Ga0068857_100773969 Ga0068857_1007739692 194
438 3300005617 Ga0068859_100023354 Ga0068859_1000233543 194
439 3300005840 Ga0068870_10051912 Ga0068870_100519122 194
440 3300006844 Ga0075428_100337287 Ga0075428_1003372872 194
441 3300006844 Ga0075428_100693124 Ga0075428_1006931242 194
442 3300006846 Ga0075430_100123418 Ga0075430_1001234182 194
443 3300006847 Ga0075431_100926775 Ga0075431_1009267752 194
444 3300006880 Ga0075429_100382368 Ga0075429_1003823683 194
445 3300006931 Ga0097620_100023354 Ga0097620_1000233544 194
446 3300009094 Ga0111539_10409193 Ga0111539_104091933 194
447 3300009094 Ga0111539_11186458 Ga0111539_111864581 194
448 3300009098 Ga0105245_11106302 Ga0105245_111063022 194
449 3300009147 Ga0114129_10429388 Ga0114129_104293882 194
450 3300009147 Ga0114129_10457925 Ga0114129_104579252 194
451 3300025922 Ga0207646_10494475 Ga0207646_104944752 194
452 3300025942 Ga0207689_10168770 Ga0207689_101687702 194
453 3300025949 Ga0207667_10008583 Ga0207667_100085837 194
454 3300026075 Ga0207708_10268161 Ga0207708_102681612 194
455 3300026116 Ga0207674_10878991 Ga0207674_108789912 194
456 3300027907 Ga0207428_10106211 Ga0207428_101062113 194
457 3300031731 Ga0307405_10491830 Ga0307405_104918302 194
458 3300031824 Ga0307413_10677795 Ga0307413_106777952 194
459 3300032002 Ga0307416_100055060 Ga0307416_1000550604 194
460 3300038443 Ga0395901_0010134 Ga0395901_0010134_8830_9435 194
461 3300044694 Ga0466963_0006322 Ga0466963_0006322_795_1403 194
462 3300044901 Ga0466960_0088100 Ga0466960_0088100_891_1481 194
463 3300045976 Ga0466967_1104042 Ga0466967_1104042_146_754 194
464 3300046473 Ga0495582_0092613 Ga0495582_0092613_139_765 194
465 3300047318 Ga0495636_0239899 Ga0495636_0239899_91_696 194
466 3300048913 Ga0496110_0273123 Ga0496110_0273123_682_1278 194
467 3300049585 Ga0501069_0159195 Ga0501069_0159195_157_747 194
468 3300050507 nmdc:mga05p37_27153_c1 nmdc:mga05p37_27153_c1_2438_3034 194
469 3300050507 nmdc:mga05p37_330351_c1 nmdc:mga05p37_330351_c1_311_916 194
470 3300050508 nmdc:mga09592_100018_c1 nmdc:mga09592_100018_c1_1491_2096 194
471 3300050509 nmdc:mga0qj67_302899_c1 nmdc:mga0qj67_302899_c1_315_920 194
472 3300050512 nmdc:mga0n895_260582_c1 nmdc:mga0n895_260582_c1_833_1429 194
473 3300061734 Ga0530510_0069691 Ga0530510_0069691_145_747 194
474 3300005536 Ga0070697_100345844 Ga0070697_1003458441 195
475 3300005618 Ga0068864_100074103 Ga0068864_1000741033 195
476 3300025923 Ga0207681_10325744 Ga0207681_103257442 195
477 3300031852 Ga0307410_10016068 Ga0307410_100160682 195
478 3300032002 Ga0307416_100135030 Ga0307416_1001350303 195
479 3300032004 Ga0307414_10347358 Ga0307414_103473582 195
480 3300042015 Ga0439462_0034849 Ga0439462_0034849_615_1202 195
481 3300049576 Ga0501040_0035771 Ga0501040_0035771_2586_3173 195
482 3300049578 Ga0501042_0025060 Ga0501042_0025060_2590_3177 195
483 3300049580 Ga0501046_0126029 Ga0501046_0126029_571_1158 195
484 3300049582 Ga0501048_0101744 Ga0501048_0101744_157_744 195
485 3300049590 Ga0501074_0153252 Ga0501074_0153252_700_1287 195
486 3300049591 Ga0501075_0019669 Ga0501075_0019669_3780_4367 195
487 3300049593 Ga0501077_0039943 Ga0501077_0039943_2233_2820 195
488 3300049741 Ga0501079_0023801 Ga0501079_0023801_1743_2330 195
489 3300049743 Ga0501081_0019023 Ga0501081_0019023_1941_2528 195
490 3300049822 Ga0501035_0666902 Ga0501035_0666902_51_638 195
491 3300049824 Ga0501045_0097561 Ga0501045_0097561_1124_1711 195
492 3300005328 Ga0070676_10019066 Ga0070676_100190662 196
493 3300005330 Ga0070690_100418423 Ga0070690_1004184231 196
494 3300005334 Ga0068869_100158910 Ga0068869_1001589102 196
495 3300005336 Ga0070680_100374995 Ga0070680_1003749952 196
496 3300005366 Ga0070659_100046283 Ga0070659_1000462833 196
497 3300005441 Ga0070700_100033699 Ga0070700_1000336993 196
498 3300005458 Ga0070681_10008960 Ga0070681_100089607 196
499 3300005535 Ga0070684_100353972 Ga0070684_1003539721 196
500 3300005546 Ga0070696_100253060 Ga0070696_1002530602 196
501 3300005577 Ga0068857_100055716 Ga0068857_1000557164 196
502 3300005617 Ga0068859_100520248 Ga0068859_1005202482 196
503 3300005844 Ga0068862_100025605 Ga0068862_1000256052 196
504 3300005981 Ga0081538_10100684 Ga0081538_101006842 196
505 3300006914 Ga0075436_100014441 Ga0075436_1000144413 196
506 3300006931 Ga0097620_100520269 Ga0097620_1005202692 196
507 3300009148 Ga0105243_10672176 Ga0105243_106721762 196
508 3300009553 Ga0105249_10006506 Ga0105249_100065066 196
509 3300013102 Ga0157371_10848126 Ga0157371_108481261 196
510 3300013306 Ga0163162_10025425 Ga0163162_100254254 196
511 3300014969 Ga0157376_10583598 Ga0157376_105835982 196
512 3300025926 Ga0207659_10438613 Ga0207659_104386132 196
513 3300025932 Ga0207690_10031358 Ga0207690_100313583 196
514 3300025942 Ga0207689_10208955 Ga0207689_102089552 196
515 3300025944 Ga0207661_10639338 Ga0207661_106393382 196
516 3300025945 Ga0207679_10276100 Ga0207679_102761001 196
517 3300025961 Ga0207712_10000892 Ga0207712_100008925 196
518 3300026075 Ga0207708_10021987 Ga0207708_100219874 196
519 3300028380 Ga0268265_10115616 Ga0268265_101156162 196
520 3300031548 Ga0307408_100055665 Ga0307408_1000556654 196
521 3300031711 Ga0265314_10001429 Ga0265314_100014298 196
522 3300032002 Ga0307416_100005645 Ga0307416_1000056456 196
523 3300032002 Ga0307416_100061780 Ga0307416_1000617804 196
524 3300032002 Ga0307416_100207420 Ga0307416_1002074201 196
525 3300032005 Ga0307411_11350636 Ga0307411_113506361 196
526 3300045051 Ga0451576_0216172 Ga0451576_0216172_553_1158 196
527 3300048903 Ga0496100_0156744 Ga0496100_0156744_925_1563 196
528 3300049577 Ga0501041_0081013 Ga0501041_0081013_1347_1937 196
529 3300049588 Ga0501072_0858525 Ga0501072_0858525_41_637 196
530 3300050514 nmdc:mga08x19_140661_c1 nmdc:mga08x19_140661_c1_424_1017 196
531 3300059424 Ga0590075_012923 Ga0590075_012923_209_802 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

127

211

0.99

PF00677

Lum_binding

Lumazine binding domain

31

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.967 1 194
4gqn-assembly1.cif.gz_C crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9625 1 193
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9612 1 84
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9578 1 193
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9525 1 194
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9664 1 86 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9573 1 86 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.953 1 85 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9518 99 190 2.40.30.20
3a3bB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9507 1 85 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7W1KLA5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9953 1 195 GO:0004746
GO:0009231
AF-A0A7W0WLM6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9935 1 154 GO:0004746
GO:0009231
AF-A0A2V7RBB7-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9914 1 196 GO:0004746
GO:0009231
AF-A0A7W0JXI9-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9913 1 195 GO:0004746
GO:0009231
AF-A0A1Q7E8S8-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9878 27 196 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
94.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map