F460084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 349 | 490 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100570731|Ga0070706_1005707313 |
| Length | 112 |
| Sequence | MTPGELFTDGPDHILNVGRRTLTLVVQNTADRPIQVGSHYHFAETNAALGFDREAAHGMRLNIASGTAVRFEPGQQRTVELVDYAGERKVFGFRGLVQGGLDEFGQSQKGTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 9 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 10 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 11 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 12 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 13 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 14 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 15 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 16 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 17 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 18 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 19 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 20 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 21 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 22 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 23 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 24 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 25 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 26 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 27 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 28 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 29 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 30 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 31 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 32 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 33 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 34 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 35 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 36 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 37 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 38 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 39 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 40 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 41 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 42 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 45 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 97 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 109 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 177 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 178 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 179 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 180 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 181 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 182 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 183 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 189 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 236 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 237 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 238 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 239 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 240 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 241 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 242 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 243 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 244 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 245 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 246 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 247 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 248 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 249 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 250 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 251 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 254 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 257 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 323 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 342 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.28 |
| Metatranscriptomes | 0 |
| Isolates | 7.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.43 |
| Nodule | 0.56 |
| Rhizoplane | 3.77 |
| Rhizosphere | 68.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10074167 | 3300001979 | Bacteria | 904 |
| 2 | JGI25151J46595_10004477 | 3300003187 | Bacteria | 7389 |
| 3 | JGI26145J50221_1031028 | 3300003371 | Bacteria | 546 |
| 4 | Ga0055526_1010511 | 3300003771 | Bacteria | 4293 |
| 5 | Ga0065704_10354616 | 3300005289 | Bacteria | 805 |
| 6 | Ga0065715_10141381 | 3300005293 | Bacteria | 1849 |
| 7 | Ga0070658_10660815 | 3300005327 | Bacteria | 907 |
| 8 | Ga0070676_10009241 | 3300005328 | Bacteria | 5327 |
| 9 | Ga0070676_10094674 | 3300005328 | Bacteria | 1835 |
| 10 | Ga0070676_11527376 | 3300005328 | Bacteria | 515 |
| 11 | Ga0070670_100008956 | 3300005331 | Bacteria | 8549 |
| 12 | Ga0070670_100478685 | 3300005331 | Bacteria | 1105 |
| 13 | Ga0070677_10001953 | 3300005333 | Bacteria | 6538 |
| 14 | Ga0068869_100060232 | 3300005334 | Bacteria | 2782 |
| 15 | Ga0070682_100124410 | 3300005337 | Bacteria | 1736 |
| 16 | Ga0068868_100046006 | 3300005338 | Bacteria | 3416 |
| 17 | Ga0068868_100048575 | 3300005338 | Bacteria | 3329 |
| 18 | Ga0068868_101116220 | 3300005338 | Bacteria | 726 |
| 19 | Ga0068868_101139752 | 3300005338 | Bacteria | 719 |
| 20 | Ga0070661_100004954 | 3300005344 | Bacteria | 9170 |
| 21 | Ga0070668_100292584 | 3300005347 | Bacteria | 1363 |
| 22 | Ga0070669_101418915 | 3300005353 | Bacteria | 603 |
| 23 | Ga0070675_100001865 | 3300005354 | Bacteria | 15533 |
| 24 | Ga0070671_100006074 | 3300005355 | Bacteria | 9625 |
| 25 | Ga0070671_100497419 | 3300005355 | Bacteria | 1049 |
| 26 | Ga0070674_100033811 | 3300005356 | Bacteria | 3407 |
| 27 | Ga0070674_100229005 | 3300005356 | Bacteria | 1449 |
| 28 | Ga0070673_100015136 | 3300005364 | Bacteria | 5404 |
| 29 | Ga0070673_100143932 | 3300005364 | Bacteria | 2014 |
| 30 | Ga0070673_100400203 | 3300005364 | Bacteria | 1228 |
| 31 | Ga0070659_100093809 | 3300005366 | Bacteria | 2409 |
| 32 | Ga0070667_100012870 | 3300005367 | Bacteria | 6914 |
| 33 | Ga0070667_100090149 | 3300005367 | Bacteria | 2635 |
| 34 | Ga0070667_101248653 | 3300005367 | Bacteria | 696 |
| 35 | Ga0070700_100581552 | 3300005441 | Bacteria | 874 |
| 36 | Ga0070708_101933205 | 3300005445 | Bacteria | 547 |
| 37 | Ga0070663_101421954 | 3300005455 | Bacteria | 615 |
| 38 | Ga0070678_100288479 | 3300005456 | Bacteria | 1390 |
| 39 | Ga0070662_101575460 | 3300005457 | Bacteria | 567 |
| 40 | Ga0068867_100008603 | 3300005459 | Bacteria | 7206 |
| 41 | Ga0068867_100062191 | 3300005459 | Bacteria | 2773 |
| 42 | Ga0068867_100369013 | 3300005459 | Bacteria | 1203 |
| 43 | Ga0070685_10486620 | 3300005466 | Bacteria | 871 |
| 44 | Ga0070706_100570731 | 3300005467 | Bacteria | 1052 |
| 45 | Ga0070698_100883678 | 3300005471 | Bacteria | 839 |
| 46 | Ga0068853_100003649 | 3300005539 | Bacteria | 11806 |
| 47 | Ga0070672_100001038 | 3300005543 | Bacteria | 16915 |
| 48 | Ga0070672_100216659 | 3300005543 | Bacteria | 1605 |
| 49 | Ga0070686_100737827 | 3300005544 | Bacteria | 789 |
| 50 | Ga0070665_100012122 | 3300005548 | Bacteria | 8698 |
| 51 | Ga0070665_100826227 | 3300005548 | Bacteria | 940 |
| 52 | Ga0068855_100181559 | 3300005563 | Bacteria | 2379 |
| 53 | Ga0068855_101053977 | 3300005563 | Bacteria | 852 |
| 54 | Ga0070664_100015182 | 3300005564 | Bacteria | 6293 |
| 55 | Ga0070664_100203886 | 3300005564 | Bacteria | 1766 |
| 56 | Ga0070664_100787116 | 3300005564 | Bacteria | 889 |
| 57 | Ga0068852_100287525 | 3300005616 | Bacteria | 1587 |
| 58 | Ga0068859_101341288 | 3300005617 | Bacteria | 789 |
| 59 | Ga0068864_100844992 | 3300005618 | Bacteria | 902 |
| 60 | Ga0068851_10080525 | 3300005834 | Bacteria | 1700 |
| 61 | Ga0068851_10782916 | 3300005834 | Bacteria | 592 |
| 62 | Ga0068870_10132495 | 3300005840 | Bacteria | 1450 |
| 63 | Ga0068863_101061597 | 3300005841 | Bacteria | 814 |
| 64 | Ga0068862_100502876 | 3300005844 | Bacteria | 1151 |
| 65 | Ga0068862_100864850 | 3300005844 | Bacteria | 887 |
| 66 | Ga0075365_11340471 | 3300006038 | Bacteria | 503 |
| 67 | Ga0075363_100090383 | 3300006048 | Bacteria | 1684 |
| 68 | Ga0075363_100161342 | 3300006048 | Bacteria | 1269 |
| 69 | Ga0075362_10009200 | 3300006177 | Bacteria | 3809 |
| 70 | Ga0075362_10088362 | 3300006177 | Bacteria | 1436 |
| 71 | Ga0075362_10215864 | 3300006177 | Bacteria | 936 |
| 72 | Ga0075362_10588995 | 3300006177 | Bacteria | 574 |
| 73 | Ga0075367_10087276 | 3300006178 | Bacteria | 1894 |
| 74 | Ga0075367_10443348 | 3300006178 | Bacteria | 823 |
| 75 | Ga0075369_10077775 | 3300006186 | Bacteria | 1468 |
| 76 | Ga0075369_10341583 | 3300006186 | Bacteria | 702 |
| 77 | Ga0075366_10012808 | 3300006195 | Bacteria | 4766 |
| 78 | Ga0075366_10839411 | 3300006195 | Bacteria | 572 |
| 79 | Ga0097621_100903473 | 3300006237 | Bacteria | 823 |
| 80 | Ga0075370_10001060 | 3300006353 | Bacteria | 11451 |
| 81 | Ga0075370_10004565 | 3300006353 | Bacteria | 6745 |
| 82 | Ga0075370_10275104 | 3300006353 | Bacteria | 1000 |
| 83 | Ga0068865_100314516 | 3300006881 | Bacteria | 1257 |
| 84 | Ga0068865_100939688 | 3300006881 | Bacteria | 754 |
| 85 | Ga0068865_101825411 | 3300006881 | Bacteria | 550 |
| 86 | Ga0097620_101341312 | 3300006931 | Bacteria | 789 |
| 87 | Ga0079104_1086544 | 3300006946 | Bacteria | 639 |
| 88 | Ga0099826_10178794 | 3300006948 | Bacteria | 1183 |
| 89 | Ga0105244_10193198 | 3300009036 | Bacteria | 962 |
| 90 | Ga0105244_10401037 | 3300009036 | Bacteria | 631 |
| 91 | Ga0105240_10002389 | 3300009093 | Bacteria | 30277 |
| 92 | Ga0105240_10469443 | 3300009093 | Bacteria | 1404 |
| 93 | Ga0105240_10999067 | 3300009093 | Bacteria | 895 |
| 94 | Ga0105245_12746268 | 3300009098 | Bacteria | 545 |
| 95 | Ga0105243_10054731 | 3300009148 | Bacteria | 3168 |
| 96 | Ga0105243_10196098 | 3300009148 | Bacteria | 1768 |
| 97 | Ga0105243_11174070 | 3300009148 | Bacteria | 779 |
| 98 | Ga0105242_10318560 | 3300009176 | Bacteria | 1425 |
| 99 | Ga0105237_10010114 | 3300009545 | Bacteria | 10055 |
| 100 | Ga0105237_12537574 | 3300009545 | Bacteria | 523 |
| 101 | Ga0105238_10153210 | 3300009551 | Bacteria | 2280 |
| 102 | Ga0105238_10433231 | 3300009551 | Bacteria | 1311 |
| 103 | Ga0105238_11167957 | 3300009551 | Bacteria | 794 |
| 104 | Ga0105249_11686855 | 3300009553 | Bacteria | 706 |
| 105 | Ga0105239_10000942 | 3300010375 | Bacteria | 41042 |
| 106 | Ga0105239_10891399 | 3300010375 | Bacteria | 1021 |
| 107 | Ga0105246_10458212 | 3300011119 | Bacteria | 1073 |
| 108 | Ga0157347_1016319 | 3300012502 | Bacteria | 835 |
| 109 | Ga0157326_1003093 | 3300012513 | Bacteria | 1762 |
| 110 | Ga0157370_10004419 | 3300013104 | Bacteria | 16110 |
| 111 | Ga0157369_10015097 | 3300013105 | Bacteria | 8716 |
| 112 | Ga0157374_12533313 | 3300013296 | Bacteria | 540 |
| 113 | Ga0163162_10170944 | 3300013306 | Bacteria | 2298 |
| 114 | Ga0157375_10951052 | 3300013308 | Bacteria | 1001 |
| 115 | Ga0157380_10739070 | 3300014326 | Bacteria | 994 |
| 116 | Ga0182008_10208454 | 3300014497 | Bacteria | 996 |
| 117 | Ga0157377_10846163 | 3300014745 | Bacteria | 679 |
| 118 | Ga0157379_10446943 | 3300014968 | Bacteria | 1193 |
| 119 | Ga0157376_10123370 | 3300014969 | Bacteria | 2300 |
| 120 | Ga0157376_12160705 | 3300014969 | Bacteria | 595 |
| 121 | Ga0157376_12882393 | 3300014969 | Bacteria | 520 |
| 122 | Ga0182006_1070612 | 3300015261 | Bacteria | 1296 |
| 123 | Ga0163161_10000099 | 3300017792 | Bacteria | 83318 |
| 124 | Ga0163161_10037425 | 3300017792 | Bacteria | 3478 |
| 125 | Ga0163161_10724669 | 3300017792 | Bacteria | 830 |
| 126 | Ga0163161_11158677 | 3300017792 | Bacteria | 667 |
| 127 | Ga0209759_1056890 | 3300025256 | Bacteria | 569 |
| 128 | Ga0209129_1004728 | 3300025258 | Bacteria | 5166 |
| 129 | Ga0209025_1000174 | 3300025294 | Bacteria | 158915 |
| 130 | Ga0209564_1001971 | 3300025295 | Bacteria | 18070 |
| 131 | Ga0209050_1014278 | 3300025298 | Bacteria | 3437 |
| 132 | Ga0209256_1031123 | 3300025299 | Bacteria | 1464 |
| 133 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 134 | Ga0209257_1039876 | 3300025304 | Bacteria | 1407 |
| 135 | Ga0207697_10312911 | 3300025315 | Bacteria | 697 |
| 136 | Ga0207656_10145222 | 3300025321 | Bacteria | 1120 |
| 137 | Ga0207682_10050759 | 3300025893 | Bacteria | 1716 |
| 138 | Ga0207688_10047559 | 3300025901 | Bacteria | 2395 |
| 139 | Ga0207645_10050327 | 3300025907 | Bacteria | 2660 |
| 140 | Ga0207645_10088923 | 3300025907 | Bacteria | 1986 |
| 141 | Ga0207643_10083217 | 3300025908 | Bacteria | 1856 |
| 142 | Ga0207705_10699189 | 3300025909 | Bacteria | 788 |
| 143 | Ga0207695_10008803 | 3300025913 | Bacteria | 12574 |
| 144 | Ga0207695_10386796 | 3300025913 | Bacteria | 1284 |
| 145 | Ga0207671_10011507 | 3300025914 | Bacteria | 7190 |
| 146 | Ga0207671_10186790 | 3300025914 | Bacteria | 1615 |
| 147 | Ga0207671_10527656 | 3300025914 | Bacteria | 941 |
| 148 | Ga0207649_10000421 | 3300025920 | Bacteria | 31168 |
| 149 | Ga0207649_10686346 | 3300025920 | Bacteria | 793 |
| 150 | Ga0207681_11006598 | 3300025923 | Bacteria | 699 |
| 151 | Ga0207694_10015587 | 3300025924 | Bacteria | 5732 |
| 152 | Ga0207650_10000947 | 3300025925 | Bacteria | 21819 |
| 153 | Ga0207650_10082923 | 3300025925 | Bacteria | 2435 |
| 154 | Ga0207650_10136256 | 3300025925 | Bacteria | 1926 |
| 155 | Ga0207650_10923140 | 3300025925 | Bacteria | 741 |
| 156 | Ga0207659_10005197 | 3300025926 | Bacteria | 7883 |
| 157 | Ga0207659_10077358 | 3300025926 | Bacteria | 2449 |
| 158 | Ga0207687_10492960 | 3300025927 | Bacteria | 1022 |
| 159 | Ga0207644_10003548 | 3300025931 | Bacteria | 10097 |
| 160 | Ga0207644_10635592 | 3300025931 | Bacteria | 888 |
| 161 | Ga0207690_10041143 | 3300025932 | Bacteria | 3027 |
| 162 | Ga0207706_11387904 | 3300025933 | Bacteria | 577 |
| 163 | Ga0207686_10409678 | 3300025934 | Bacteria | 1035 |
| 164 | Ga0207709_10016596 | 3300025935 | Bacteria | 4095 |
| 165 | Ga0207709_10028184 | 3300025935 | Bacteria | 3245 |
| 166 | Ga0207709_10814636 | 3300025935 | Bacteria | 754 |
| 167 | Ga0207669_10062096 | 3300025937 | Bacteria | 2299 |
| 168 | Ga0207669_10847937 | 3300025937 | Bacteria | 760 |
| 169 | Ga0207704_10118044 | 3300025938 | Bacteria | 1808 |
| 170 | Ga0207691_10001498 | 3300025940 | Bacteria | 23269 |
| 171 | Ga0207691_10063148 | 3300025940 | Bacteria | 3360 |
| 172 | Ga0207711_10751178 | 3300025941 | Bacteria | 909 |
| 173 | Ga0207689_10191493 | 3300025942 | Bacteria | 1687 |
| 174 | Ga0207679_10000047 | 3300025945 | Bacteria | 119891 |
| 175 | Ga0207679_10633581 | 3300025945 | Bacteria | 966 |
| 176 | Ga0207679_10927237 | 3300025945 | Bacteria | 797 |
| 177 | Ga0207679_11818358 | 3300025945 | Bacteria | 556 |
| 178 | Ga0207667_10142752 | 3300025949 | Bacteria | 2465 |
| 179 | Ga0207667_10210465 | 3300025949 | Bacteria | 1993 |
| 180 | Ga0207651_10004851 | 3300025960 | Bacteria | 6850 |
| 181 | Ga0207651_10007792 | 3300025960 | Bacteria | 5727 |
| 182 | Ga0207651_10209622 | 3300025960 | Bacteria | 1567 |
| 183 | Ga0207712_11240938 | 3300025961 | Bacteria | 665 |
| 184 | Ga0207668_10283085 | 3300025972 | Bacteria | 1361 |
| 185 | Ga0207658_10007097 | 3300025986 | Bacteria | 7628 |
| 186 | Ga0207677_10827195 | 3300026023 | Bacteria | 830 |
| 187 | Ga0207677_10974017 | 3300026023 | Bacteria | 768 |
| 188 | Ga0207639_10485389 | 3300026041 | Bacteria | 1127 |
| 189 | Ga0207639_11353097 | 3300026041 | Bacteria | 668 |
| 190 | Ga0207678_10358236 | 3300026067 | Bacteria | 1259 |
| 191 | Ga0207708_11042026 | 3300026075 | Bacteria | 712 |
| 192 | Ga0207641_10832156 | 3300026088 | Bacteria | 914 |
| 193 | Ga0207648_10032775 | 3300026089 | Bacteria | 4585 |
| 194 | Ga0207648_10285934 | 3300026089 | Bacteria | 1475 |
| 195 | Ga0207648_10420669 | 3300026089 | Bacteria | 1213 |
| 196 | Ga0207676_10008533 | 3300026095 | Bacteria | 7285 |
| 197 | Ga0207674_10432576 | 3300026116 | Bacteria | 1272 |
| 198 | Ga0207674_10595160 | 3300026116 | Bacteria | 1068 |
| 199 | Ga0207683_10177699 | 3300026121 | Bacteria | 1930 |
| 200 | Ga0207683_10186239 | 3300026121 | Bacteria | 1883 |
| 201 | Ga0207683_10902858 | 3300026121 | Bacteria | 820 |
| 202 | Ga0207698_11443285 | 3300026142 | Bacteria | 703 |
| 203 | Ga0209974_10019883 | 3300027876 | Bacteria | 2226 |
| 204 | Ga0207428_10297293 | 3300027907 | Bacteria | 1195 |
| 205 | Ga0268266_10211569 | 3300028379 | Bacteria | 1778 |
| 206 | Ga0268265_10431225 | 3300028380 | Bacteria | 1226 |
| 207 | Ga0307515_10002229 | 3300028794 | Bacteria | 42507 |
| 208 | Ga0307515_10008688 | 3300028794 | Bacteria | 19755 |
| 209 | Ga0307515_10020644 | 3300028794 | Bacteria | 11734 |
| 210 | Ga0307515_10120794 | 3300028794 | Bacteria | 2969 |
| 211 | Ga0307515_10127325 | 3300028794 | Bacteria | 2833 |
| 212 | Ga0307515_10135898 | 3300028794 | Bacteria | 2674 |
| 213 | Ga0307515_10503747 | 3300028794 | Bacteria | 821 |
| 214 | Ga0307512_10085589 | 3300030522 | Bacteria | 2233 |
| 215 | Ga0307512_10129717 | 3300030522 | Bacteria | 1586 |
| 216 | Ga0316177_1098042 | 3300030731 | Bacteria | 630 |
| 217 | Ga0316176_1133948 | 3300030732 | Bacteria | 734 |
| 218 | Ga0314311_1041998 | 3300030733 | Bacteria | 1239 |
| 219 | Ga0316179_1010299 | 3300030734 | Bacteria | 1625 |
| 220 | Ga0316183_1084100 | 3300030742 | Bacteria | 1227 |
| 221 | Ga0316183_1096743 | 3300030742 | Bacteria | 1362 |
| 222 | Ga0316182_1205325 | 3300030745 | Bacteria | 925 |
| 223 | Ga0316182_1249672 | 3300030745 | Bacteria | 1203 |
| 224 | Ga0265316_10962097 | 3300031344 | Bacteria | 595 |
| 225 | Ga0307513_10023805 | 3300031456 | Bacteria | 7145 |
| 226 | Ga0307513_10152160 | 3300031456 | Bacteria | 2220 |
| 227 | Ga0307513_10218223 | 3300031456 | Bacteria | 1731 |
| 228 | Ga0307513_10243711 | 3300031456 | Bacteria | 1600 |
| 229 | Ga0307513_10252571 | 3300031456 | Bacteria | 1559 |
| 230 | Ga0307513_10377914 | 3300031456 | Bacteria | 1157 |
| 231 | Ga0307513_10603569 | 3300031456 | Bacteria | 807 |
| 232 | Ga0307509_10422457 | 3300031507 | Bacteria | 1033 |
| 233 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 234 | Ga0307408_100001177 | 3300031548 | Bacteria | 19819 |
| 235 | Ga0307408_100023848 | 3300031548 | Bacteria | 4171 |
| 236 | Ga0307408_100338634 | 3300031548 | Bacteria | 1272 |
| 237 | Ga0307408_100340904 | 3300031548 | Bacteria | 1268 |
| 238 | Ga0307408_100759503 | 3300031548 | Bacteria | 876 |
| 239 | Ga0307508_10001872 | 3300031616 | Bacteria | 23175 |
| 240 | Ga0307508_10004732 | 3300031616 | Bacteria | 13171 |
| 241 | Ga0307514_10001349 | 3300031649 | Bacteria | 31116 |
| 242 | Ga0307514_10130820 | 3300031649 | Bacteria | 1728 |
| 243 | Ga0316576_10184326 | 3300031727 | Bacteria | 1574 |
| 244 | Ga0307516_10000058 | 3300031730 | Bacteria | 121424 |
| 245 | Ga0307516_10001572 | 3300031730 | Bacteria | 31438 |
| 246 | Ga0307516_10017367 | 3300031730 | Bacteria | 7504 |
| 247 | Ga0307405_10028971 | 3300031731 | Bacteria | 3231 |
| 248 | Ga0307405_10189369 | 3300031731 | Bacteria | 1484 |
| 249 | Ga0307405_10322522 | 3300031731 | Bacteria | 1180 |
| 250 | Ga0307405_11265443 | 3300031731 | Bacteria | 640 |
| 251 | Ga0307413_10065467 | 3300031824 | Bacteria | 2263 |
| 252 | Ga0307413_10910796 | 3300031824 | Bacteria | 747 |
| 253 | Ga0307413_10982184 | 3300031824 | Bacteria | 723 |
| 254 | Ga0307410_10004711 | 3300031852 | Bacteria | 7098 |
| 255 | Ga0307406_10000741 | 3300031901 | Bacteria | 18289 |
| 256 | Ga0307406_10009421 | 3300031901 | Bacteria | 5475 |
| 257 | Ga0307406_10648602 | 3300031901 | Bacteria | 876 |
| 258 | Ga0307407_10168511 | 3300031903 | Bacteria | 1440 |
| 259 | Ga0307407_10918065 | 3300031903 | Bacteria | 673 |
| 260 | Ga0307412_10002427 | 3300031911 | Bacteria | 10362 |
| 261 | Ga0307412_10148660 | 3300031911 | Bacteria | 1725 |
| 262 | Ga0307412_10338384 | 3300031911 | Bacteria | 1203 |
| 263 | Ga0307412_10351962 | 3300031911 | Bacteria | 1183 |
| 264 | Ga0307412_10615823 | 3300031911 | Bacteria | 921 |
| 265 | Ga0307412_10766091 | 3300031911 | Bacteria | 834 |
| 266 | Ga0307412_10797861 | 3300031911 | Bacteria | 819 |
| 267 | Ga0307412_10832685 | 3300031911 | Bacteria | 803 |
| 268 | Ga0307412_11643718 | 3300031911 | Bacteria | 587 |
| 269 | Ga0307412_12040027 | 3300031911 | Bacteria | 531 |
| 270 | Ga0307412_12313373 | 3300031911 | Bacteria | 502 |
| 271 | Ga0307409_100030230 | 3300031995 | Bacteria | 3889 |
| 272 | Ga0307409_100564026 | 3300031995 | Bacteria | 1120 |
| 273 | Ga0307416_100015543 | 3300032002 | Bacteria | 5261 |
| 274 | Ga0307416_100055308 | 3300032002 | Bacteria | 3195 |
| 275 | Ga0307416_100476389 | 3300032002 | Bacteria | 1307 |
| 276 | Ga0307416_102951397 | 3300032002 | Bacteria | 569 |
| 277 | Ga0307416_103829067 | 3300032002 | Bacteria | 504 |
| 278 | Ga0307414_10245353 | 3300032004 | Bacteria | 1485 |
| 279 | Ga0307414_10452722 | 3300032004 | Bacteria | 1126 |
| 280 | Ga0307414_11852798 | 3300032004 | Bacteria | 563 |
| 281 | Ga0307411_10001517 | 3300032005 | Bacteria | 9564 |
| 282 | Ga0307411_10207656 | 3300032005 | Bacteria | 1509 |
| 283 | Ga0307411_10229829 | 3300032005 | Bacteria | 1445 |
| 284 | Ga0307411_10303472 | 3300032005 | Bacteria | 1281 |
| 285 | Ga0307411_10552571 | 3300032005 | Bacteria | 982 |
| 286 | Ga0307411_11977192 | 3300032005 | Bacteria | 544 |
| 287 | Ga0307415_100182612 | 3300032126 | Bacteria | 1647 |
| 288 | Ga0307415_100857765 | 3300032126 | Bacteria | 834 |
| 289 | Ga0307415_101536442 | 3300032126 | Bacteria | 638 |
| 290 | Ga0307507_10075671 | 3300033179 | Bacteria | 3009 |
| 291 | Ga0307507_10160163 | 3300033179 | Bacteria | 1665 |
| 292 | Ga0307510_10006135 | 3300033180 | Bacteria | 14324 |
| 293 | Ga0307510_10232538 | 3300033180 | Bacteria | 1344 |
| 294 | Ga0373948_0001520 | 3300034817 | Bacteria | 3241 |
| 295 | Ga0373959_0080550 | 3300034820 | Bacteria | 749 |
| 296 | Ga0373934_0440794 | 3300035086 | Bacteria | 546 |
| 297 | Ga0373944_0182125 | 3300035089 | Bacteria | 754 |
| 298 | Ga0373951_0009036 | 3300035091 | Bacteria | 2247 |
| 299 | Ga0373951_0069480 | 3300035091 | Bacteria | 895 |
| 300 | Ga0373923_0165716 | 3300035111 | Bacteria | 1010 |
| 301 | Ga0373923_0365307 | 3300035111 | Bacteria | 691 |
| 302 | Ga0373932_0025075 | 3300035112 | Bacteria | 1611 |
| 303 | Ga0373936_0070094 | 3300035113 | Bacteria | 1444 |
| 304 | Ga0373939_0000036 | 3300035114 | Bacteria | 48825 |
| 305 | Ga0373945_0094123 | 3300035116 | Bacteria | 1164 |
| 306 | Ga0373954_0242100 | 3300035118 | Bacteria | 888 |
| 307 | Ga0373954_0563481 | 3300035118 | Bacteria | 565 |
| 308 | Ga0373956_0306666 | 3300035119 | Bacteria | 756 |
| 309 | Ga0373960_0021758 | 3300035121 | Bacteria | 1709 |
| 310 | Ga0373943_0042479 | 3300035170 | Bacteria | 2204 |
| 311 | Ga0373943_0301170 | 3300035170 | Bacteria | 910 |
| 312 | Ga0373955_0016521 | 3300035172 | Bacteria | 3635 |
| 313 | Ga0373955_0041212 | 3300035172 | Bacteria | 2474 |
| 314 | Ga0373961_0236665 | 3300035241 | Bacteria | 656 |
| 315 | Ga0373924_0073943 | 3300035410 | Bacteria | 1441 |
| 316 | Ga0373931_0005162 | 3300035691 | Bacteria | 6019 |
| 317 | Ga0373931_0019544 | 3300035691 | Bacteria | 3383 |
| 318 | Ga0373931_0197628 | 3300035691 | Bacteria | 1200 |
| 319 | Ga0373935_0281752 | 3300035692 | Bacteria | 1170 |
| 320 | Ga0373933_0661131 | 3300035724 | Bacteria | 687 |
| 321 | Ga0373947_0042936 | 3300035725 | Bacteria | 2699 |
| 322 | Ga0373937_0394749 | 3300036401 | Bacteria | 1312 |
| 323 | Ga0395905_0000600 | 3300037471 | Bacteria | 48145 |
| 324 | Ga0395905_0046576 | 3300037471 | Bacteria | 4066 |
| 325 | Ga0439436_0028989 | 3300041404 | Bacteria | 1613 |
| 326 | Ga0439465_0032873 | 3300041413 | Bacteria | 1657 |
| 327 | Ga0451789_0151812 | 3300041443 | Bacteria | 1331 |
| 328 | Ga0451789_0544890 | 3300041443 | Bacteria | 567 |
| 329 | Ga0451797_0677519 | 3300041453 | Bacteria | 689 |
| 330 | Ga0451797_1429463 | 3300041453 | Bacteria | 841 |
| 331 | Ga0451800_0842469 | 3300041459 | Bacteria | 738 |
| 332 | Ga0451800_1026996 | 3300041459 | Bacteria | 541 |
| 333 | Ga0451800_1401263 | 3300041459 | Bacteria | 554 |
| 334 | Ga0451802_2141157 | 3300041460 | Bacteria | 611 |
| 335 | Ga0451804_1092860 | 3300041463 | Bacteria | 505 |
| 336 | Ga0451807_0521282 | 3300041486 | Bacteria | 765 |
| 337 | Ga0451835_0332945 | 3300041492 | Bacteria | 578 |
| 338 | Ga0451839_1391327 | 3300041496 | Bacteria | 835 |
| 339 | Ga0451841_0202857 | 3300041498 | Bacteria | 519 |
| 340 | Ga0451845_0502849 | 3300041501 | Bacteria | 1626 |
| 341 | Ga0451847_0777924 | 3300041503 | Bacteria | 948 |
| 342 | Ga0451849_0735763 | 3300041505 | Bacteria | 569 |
| 343 | Ga0451851_0055416 | 3300041507 | Bacteria | 1079 |
| 344 | Ga0439433_0037076 | 3300041999 | Bacteria | 1128 |
| 345 | Ga0439442_003576 | 3300042002 | Bacteria | 3075 |
| 346 | Ga0439452_089718 | 3300042010 | Bacteria | 665 |
| 347 | Ga0450919_016249 | 3300042121 | Bacteria | 840 |
| 348 | Ga0450923_124371 | 3300042125 | Bacteria | 610 |
| 349 | Ga0450898_024480 | 3300042134 | Bacteria | 1079 |
| 350 | Ga0450899_008107 | 3300042135 | Bacteria | 1149 |
| 351 | Ga0450889_021351 | 3300042144 | Bacteria | 721 |
| 352 | Ga0450906_006856 | 3300042145 | Bacteria | 2278 |
| 353 | Ga0450910_003954 | 3300042147 | Bacteria | 1991 |
| 354 | Ga0439446_0238372 | 3300042156 | Bacteria | 624 |
| 355 | Ga0450908_004610 | 3300042184 | Bacteria | 2654 |
| 356 | Ga0450909_017454 | 3300042185 | Bacteria | 1063 |
| 357 | Ga0439434_0025270 | 3300042435 | Bacteria | 1792 |
| 358 | Ga0450918_006736 | 3300042531 | Bacteria | 2044 |
| 359 | Ga0450893_0014508 | 3300042532 | Bacteria | 1322 |
| 360 | Ga0451577_0022469 | 3300042876 | Bacteria | 5759 |
| 361 | Ga0453684_2386388 | 3300044712 | Bacteria | 524 |
| 362 | Ga0466957_0969017 | 3300044842 | Bacteria | 610 |
| 363 | Ga0451576_0098993 | 3300045051 | Bacteria | 3033 |
| 364 | Ga0495627_019484 | 3300046453 | Bacteria | 2274 |
| 365 | Ga0495592_0629263 | 3300046454 | Bacteria | 652 |
| 366 | Ga0495629_0049614 | 3300046459 | Bacteria | 2941 |
| 367 | Ga0495638_0070970 | 3300046460 | Bacteria | 2131 |
| 368 | Ga0495650_0005014 | 3300046471 | Bacteria | 8800 |
| 369 | Ga0495580_0060253 | 3300046472 | Bacteria | 2667 |
| 370 | Ga0495582_0046755 | 3300046473 | Bacteria | 2384 |
| 371 | Ga0495639_0420916 | 3300046475 | Bacteria | 676 |
| 372 | Ga0495662_0180964 | 3300046476 | Bacteria | 1039 |
| 373 | Ga0495606_0373261 | 3300046507 | Bacteria | 750 |
| 374 | Ga0495610_0036371 | 3300046512 | Bacteria | 2517 |
| 375 | Ga0495610_0039514 | 3300046512 | Bacteria | 2385 |
| 376 | Ga0495616_0038655 | 3300046513 | Bacteria | 2449 |
| 377 | Ga0495620_0033235 | 3300046515 | Bacteria | 2343 |
| 378 | Ga0495628_0995660 | 3300046516 | Bacteria | 577 |
| 379 | Ga0495630_1380714 | 3300046517 | Bacteria | 530 |
| 380 | Ga0495631_0000073 | 3300046518 | Bacteria | 64358 |
| 381 | Ga0495632_0066357 | 3300046519 | Bacteria | 1741 |
| 382 | Ga0495637_0098860 | 3300046520 | Bacteria | 1142 |
| 383 | Ga0495643_0014989 | 3300046522 | Bacteria | 4595 |
| 384 | Ga0495648_0407196 | 3300046524 | Bacteria | 606 |
| 385 | Ga0495652_0645632 | 3300046529 | Bacteria | 717 |
| 386 | Ga0495654_0001245 | 3300046530 | Bacteria | 17990 |
| 387 | Ga0495654_0107228 | 3300046530 | Bacteria | 1278 |
| 388 | Ga0495654_0208204 | 3300046530 | Bacteria | 833 |
| 389 | Ga0495665_0631889 | 3300046531 | Bacteria | 534 |
| 390 | Ga0495640_0781875 | 3300046533 | Bacteria | 570 |
| 391 | Ga0495597_0000024 | 3300046542 | Bacteria | 143948 |
| 392 | Ga0495645_0425310 | 3300046543 | Bacteria | 842 |
| 393 | Ga0495633_0466649 | 3300046558 | Bacteria | 570 |
| 394 | Ga0495667_0198405 | 3300046559 | Bacteria | 1285 |
| 395 | Ga0495668_0081141 | 3300046616 | Bacteria | 1780 |
| 396 | Ga0495625_0001217 | 3300046660 | Bacteria | 32653 |
| 397 | Ga0495625_0086085 | 3300046660 | Bacteria | 2180 |
| 398 | Ga0495625_0407396 | 3300046660 | Bacteria | 848 |
| 399 | Ga0495659_0136502 | 3300046664 | Bacteria | 976 |
| 400 | Ga0495661_0338713 | 3300046665 | Bacteria | 743 |
| 401 | Ga0495588_0012491 | 3300046674 | Bacteria | 4016 |
| 402 | Ga0495588_0457348 | 3300046674 | Bacteria | 669 |
| 403 | Ga0495657_0890757 | 3300046675 | Bacteria | 506 |
| 404 | Ga0495647_0226645 | 3300046681 | Bacteria | 826 |
| 405 | Ga0495658_0235096 | 3300046683 | Bacteria | 1150 |
| 406 | Ga0495670_0346377 | 3300046691 | Bacteria | 799 |
| 407 | Ga0495671_0089351 | 3300046692 | Bacteria | 1508 |
| 408 | Ga0495671_0401977 | 3300046692 | Bacteria | 656 |
| 409 | Ga0495600_0482197 | 3300046809 | Bacteria | 764 |
| 410 | Ga0495660_0322188 | 3300046810 | Bacteria | 694 |
| 411 | Ga0495676_0091783 | 3300047321 | Bacteria | 2268 |
| 412 | Ga0495677_0135520 | 3300047445 | Bacteria | 944 |
| 413 | Ga0495684_0193819 | 3300047471 | Bacteria | 1501 |
| 414 | Ga0495684_0274416 | 3300047471 | Bacteria | 1219 |
| 415 | Ga0495686_0213907 | 3300047472 | Bacteria | 1100 |
| 416 | Ga0496101_0055821 | 3300048904 | Bacteria | 2854 |
| 417 | Ga0496101_1181839 | 3300048904 | Bacteria | 600 |
| 418 | Ga0496106_0033566 | 3300048909 | Bacteria | 3829 |
| 419 | Ga0496113_0139336 | 3300048916 | Bacteria | 1908 |
| 420 | Ga0496113_0406049 | 3300048916 | Bacteria | 1094 |
| 421 | Ga0496114_0693241 | 3300048917 | Bacteria | 894 |
| 422 | Ga0496115_0749314 | 3300048918 | Bacteria | 764 |
| 423 | Ga0496116_0260160 | 3300048919 | Bacteria | 856 |
| 424 | Ga0496117_0055146 | 3300048920 | Bacteria | 2779 |
| 425 | Ga0496117_0069400 | 3300048920 | Bacteria | 2373 |
| 426 | Ga0496117_0598014 | 3300048920 | Bacteria | 516 |
| 427 | Ga0496118_0233444 | 3300048921 | Bacteria | 1059 |
| 428 | Ga0496120_0459678 | 3300048923 | Bacteria | 553 |
| 429 | Ga0496121_0094048 | 3300048924 | Bacteria | 2332 |
| 430 | Ga0496121_0114365 | 3300048924 | Bacteria | 2051 |
| 431 | Ga0496122_0103836 | 3300048925 | Bacteria | 1890 |
| 432 | Ga0496122_0239281 | 3300048925 | Bacteria | 1025 |
| 433 | Ga0496122_0510133 | 3300048925 | Bacteria | 582 |
| 434 | Ga0496123_0104026 | 3300048926 | Bacteria | 1643 |
| 435 | Ga0496123_0147661 | 3300048926 | Bacteria | 1274 |
| 436 | Ga0496123_0384217 | 3300048926 | Bacteria | 643 |
| 437 | Ga0496124_0261471 | 3300048927 | Bacteria | 1273 |
| 438 | Ga0496125_0215883 | 3300048928 | Bacteria | 1241 |
| 439 | Ga0496125_0397224 | 3300048928 | Bacteria | 807 |
| 440 | Ga0501227_032723 | 3300049665 | Bacteria | 1256 |
| 441 | Ga0501249_080672 | 3300049679 | Bacteria | 765 |
| 442 | Ga0501259_044051 | 3300049688 | Bacteria | 887 |
| 443 | Ga0501259_111756 | 3300049688 | Bacteria | 640 |
| 444 | Ga0501225_0009191 | 3300049705 | Bacteria | 2822 |
| 445 | Ga0501262_002190 | 3300049759 | Bacteria | 2209 |
| 446 | Ga0501262_021346 | 3300049759 | Bacteria | 889 |
| 447 | nmdc:mga03683_62534_c1 | 3300050489 | Bacteria | 1577 |
| 448 | nmdc:mga03n38_325535_c1 | 3300050490 | Bacteria | 831 |
| 449 | nmdc:mga03n38_374779_c1 | 3300050490 | Bacteria | 779 |
| 450 | nmdc:mga03n38_390956_c1 | 3300050490 | Bacteria | 764 |
| 451 | nmdc:mga0yw44_1121696_c1 | 3300050492 | Bacteria | 531 |
| 452 | nmdc:mga0k408_115836_c1 | 3300050493 | Bacteria | 1586 |
| 453 | nmdc:mga0k408_132846_c1 | 3300050493 | Bacteria | 1478 |
| 454 | nmdc:mga0k408_666338_c1 | 3300050493 | Bacteria | 611 |
| 455 | nmdc:mga0k408_703166_c1 | 3300050493 | Bacteria | 592 |
| 456 | nmdc:mga0k408_742429_c1 | 3300050493 | Bacteria | 574 |
| 457 | nmdc:mga06z11_115416_c1 | 3300050494 | Bacteria | 1492 |
| 458 | nmdc:mga06z11_331667_c1 | 3300050494 | Bacteria | 909 |
| 459 | nmdc:mga06z11_476152_c1 | 3300050494 | Bacteria | 755 |
| 460 | nmdc:mga07m45_378022_c1 | 3300050496 | Bacteria | 823 |
| 461 | nmdc:mga07m45_39111_c1 | 3300050496 | Bacteria | 2650 |
| 462 | nmdc:mga07m45_407284_c1 | 3300050496 | Bacteria | 789 |
| 463 | nmdc:mga07m45_47453_c1 | 3300050496 | Bacteria | 2415 |
| 464 | nmdc:mga07m45_526592_c1 | 3300050496 | Bacteria | 684 |
| 465 | nmdc:mga0sz30_100898_c1 | 3300050516 | Bacteria | 1261 |
| 466 | Ga0495601_0094278 | 3300053077 | Bacteria | 1929 |
| 467 | Ga0500610_0000329 | 3300053079 | Bacteria | 14347 |
| 468 | Ga0500610_0047951 | 3300053079 | Bacteria | 2220 |
| 469 | Ga0495595_0086303 | 3300053084 | Bacteria | 1501 |
| 470 | Ga0495619_0492827 | 3300053085 | Bacteria | 843 |
| 471 | Ga0495619_0627224 | 3300053085 | Bacteria | 734 |
| 472 | Ga0500578_0254732 | 3300053086 | Bacteria | 1056 |
| 473 | Ga0500644_0031465 | 3300053088 | Bacteria | 1687 |
| 474 | Ga0500651_0634216 | 3300053093 | Bacteria | 577 |
| 475 | Ga0500641_0131306 | 3300053096 | Bacteria | 1081 |
| 476 | Ga0500562_011371 | 3300053108 | Bacteria | 2260 |
| 477 | Ga0500562_137955 | 3300053108 | Bacteria | 665 |
| 478 | Ga0500593_010835 | 3300053117 | Bacteria | 3835 |
| 479 | Ga0500593_030693 | 3300053117 | Bacteria | 2401 |
| 480 | Ga0500594_0004824 | 3300053118 | Bacteria | 2980 |
| 481 | Ga0500607_020625 | 3300053121 | Bacteria | 3720 |
| 482 | Ga0500607_049832 | 3300053121 | Bacteria | 2234 |
| 483 | Ga0500658_0001544 | 3300053134 | Bacteria | 9206 |
| 484 | Ga0500658_0048977 | 3300053134 | Bacteria | 1720 |
| 485 | Ga0500568_0023470 | 3300053139 | Bacteria | 2623 |
| 486 | Ga0500616_0155352 | 3300053153 | Bacteria | 1054 |
| 487 | Ga0500616_0289505 | 3300053153 | Bacteria | 684 |
| 488 | Ga0500627_0023457 | 3300053158 | Bacteria | 2515 |
| 489 | Ga0500634_0046050 | 3300053161 | Bacteria | 2358 |
| 490 | Ga0500645_016026 | 3300053730 | Bacteria | 2366 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028794 | Ga0307515_10020644 | Ga0307515_100206448 | 91 |
| 2 | 3300037471 | Ga0395905_0046576 | Ga0395905_0046576_2345_2650 | 91 |
| 3 | 3300041459 | Ga0451800_1026996 | Ga0451800_1026996_177_521 | 91 |
| 4 | 3300005293 | Ga0065715_10141381 | Ga0065715_101413813 | 92 |
| 5 | 3300005328 | Ga0070676_10094674 | Ga0070676_100946743 | 92 |
| 6 | 3300005331 | Ga0070670_100008956 | Ga0070670_1000089561 | 92 |
| 7 | 3300005333 | Ga0070677_10001953 | Ga0070677_100019538 | 92 |
| 8 | 3300005338 | Ga0068868_100046006 | Ga0068868_1000460062 | 92 |
| 9 | 3300005347 | Ga0070668_100292584 | Ga0070668_1002925842 | 92 |
| 10 | 3300005354 | Ga0070675_100001865 | Ga0070675_10000186515 | 92 |
| 11 | 3300005355 | Ga0070671_100006074 | Ga0070671_10000607410 | 92 |
| 12 | 3300005356 | Ga0070674_100229005 | Ga0070674_1002290052 | 92 |
| 13 | 3300005364 | Ga0070673_100015136 | Ga0070673_1000151366 | 92 |
| 14 | 3300005367 | Ga0070667_100090149 | Ga0070667_1000901493 | 92 |
| 15 | 3300005441 | Ga0070700_100581552 | Ga0070700_1005815522 | 92 |
| 16 | 3300005455 | Ga0070663_101421954 | Ga0070663_1014219541 | 92 |
| 17 | 3300005456 | Ga0070678_100288479 | Ga0070678_1002884792 | 92 |
| 18 | 3300005459 | Ga0068867_100008603 | Ga0068867_1000086033 | 92 |
| 19 | 3300005466 | Ga0070685_10486620 | Ga0070685_104866203 | 92 |
| 20 | 3300005543 | Ga0070672_100001038 | Ga0070672_1000010383 | 92 |
| 21 | 3300005544 | Ga0070686_100737827 | Ga0070686_1007378272 | 92 |
| 22 | 3300005564 | Ga0070664_100787116 | Ga0070664_1007871162 | 92 |
| 23 | 3300005618 | Ga0068864_100844992 | Ga0068864_1008449922 | 92 |
| 24 | 3300005834 | Ga0068851_10080525 | Ga0068851_100805252 | 92 |
| 25 | 3300005840 | Ga0068870_10132495 | Ga0068870_101324952 | 92 |
| 26 | 3300005841 | Ga0068863_101061597 | Ga0068863_1010615972 | 92 |
| 27 | 3300006195 | Ga0075366_10839411 | Ga0075366_108394112 | 92 |
| 28 | 3300006237 | Ga0097621_100903473 | Ga0097621_1009034732 | 92 |
| 29 | 3300006881 | Ga0068865_101825411 | Ga0068865_1018254111 | 92 |
| 30 | 3300013306 | Ga0163162_10170944 | Ga0163162_101709443 | 92 |
| 31 | 3300014326 | Ga0157380_10739070 | Ga0157380_107390703 | 92 |
| 32 | 3300014969 | Ga0157376_10123370 | Ga0157376_101233702 | 92 |
| 33 | 3300017792 | Ga0163161_10037425 | Ga0163161_100374253 | 92 |
| 34 | 3300025321 | Ga0207656_10145222 | Ga0207656_101452222 | 92 |
| 35 | 3300025893 | Ga0207682_10050759 | Ga0207682_100507592 | 92 |
| 36 | 3300025901 | Ga0207688_10047559 | Ga0207688_100475592 | 92 |
| 37 | 3300025907 | Ga0207645_10088923 | Ga0207645_100889233 | 92 |
| 38 | 3300025908 | Ga0207643_10083217 | Ga0207643_100832173 | 92 |
| 39 | 3300025925 | Ga0207650_10000947 | Ga0207650_100009474 | 92 |
| 40 | 3300025926 | Ga0207659_10005197 | Ga0207659_100051976 | 92 |
| 41 | 3300025931 | Ga0207644_10003548 | Ga0207644_1000354810 | 92 |
| 42 | 3300025937 | Ga0207669_10062096 | Ga0207669_100620962 | 92 |
| 43 | 3300025940 | Ga0207691_10001498 | Ga0207691_1000149818 | 92 |
| 44 | 3300025945 | Ga0207679_10633581 | Ga0207679_106335812 | 92 |
| 45 | 3300025960 | Ga0207651_10007792 | Ga0207651_100077923 | 92 |
| 46 | 3300026075 | Ga0207708_11042026 | Ga0207708_110420261 | 92 |
| 47 | 3300026088 | Ga0207641_10832156 | Ga0207641_108321562 | 92 |
| 48 | 3300026089 | Ga0207648_10032775 | Ga0207648_100327752 | 92 |
| 49 | 3300026095 | Ga0207676_10008533 | Ga0207676_100085338 | 92 |
| 50 | 3300026121 | Ga0207683_10186239 | Ga0207683_101862393 | 92 |
| 51 | 3300050493 | nmdc:mga0k408_666338_c1 | nmdc:mga0k408_666338_c1_172_477 | 92 |
| 52 | 3300050496 | nmdc:mga07m45_407284_c1 | nmdc:mga07m45_407284_c1_373_678 | 92 |
| 53 | 3300009093 | Ga0105240_10002389 | Ga0105240_100023894 | 95 |
| 54 | 3300009545 | Ga0105237_10010114 | Ga0105237_100101144 | 95 |
| 55 | 3300009551 | Ga0105238_10433231 | Ga0105238_104332312 | 95 |
| 56 | 3300010375 | Ga0105239_10000942 | Ga0105239_100009424 | 95 |
| 57 | iso_pu_bacteria | 2585428062 | 2587759984 | 97 |
| 58 | iso_pu_bacteria | 2599185214 | 2599623439 | 97 |
| 59 | iso_pu_bacteria | 2599185226 | 2599675343 | 97 |
| 60 | iso_pu_bacteria | 2599185227 | 2599681044 | 97 |
| 61 | iso_pu_bacteria | 2599185229 | 2599693059 | 97 |
| 62 | iso_pu_bacteria | 2643221585 | 2643933556 | 97 |
| 63 | iso_pu_bacteria | 2643221628 | 2644161808 | 97 |
| 64 | iso_pu_bacteria | 2643221639 | 2644222045 | 97 |
| 65 | iso_pu_bacteria | 2643221646 | 2644257174 | 97 |
| 66 | iso_pu_bacteria | 2643221656 | 2644314805 | 97 |
| 67 | iso_pu_bacteria | 2643221672 | 2644399316 | 97 |
| 68 | iso_pu_bacteria | 2738541277 | 2738718158 | 97 |
| 69 | iso_pu_bacteria | 2738541307 | 2738880457 | 97 |
| 70 | iso_pu_bacteria | 2738541337 | 2739055269 | 97 |
| 71 | iso_pu_bacteria | 2738543013 | 2739247999 | 97 |
| 72 | iso_pu_bacteria | 2738543019 | 2739281345 | 97 |
| 73 | iso_pu_bacteria | 2818991446 | 2819600615 | 97 |
| 74 | iso_pu_bacteria | 2831265667 | 2831267659 | 97 |
| 75 | iso_pu_bacteria | 2838054893 | 2838061136 | 97 |
| 76 | iso_pu_bacteria | 2842677519 | 2842679789 | 97 |
| 77 | iso_pu_bacteria | 2842747753 | 2842749588 | 97 |
| 78 | iso_pu_bacteria | 2885192300 | 2885193129 | 97 |
| 79 | iso_pu_bacteria | 2885198086 | 2885198871 | 97 |
| 80 | iso_pu_bacteria | 2885211737 | 2885211749 | 97 |
| 81 | iso_pu_bacteria | 2899924645 | 2899928238 | 97 |
| 82 | iso_pu_bacteria | 2904449895 | 2904452478 | 97 |
| 83 | iso_pu_bacteria | 2904456579 | 2904460923 | 97 |
| 84 | iso_pu_bacteria | 2904541872 | 2904545173 | 97 |
| 85 | iso_pu_bacteria | 2919462493 | 2919463887 | 97 |
| 86 | iso_pu_bacteria | 2928037797 | 2928041189 | 97 |
| 87 | iso_pu_bacteria | 2928044640 | 2928048031 | 97 |
| 88 | iso_pu_bacteria | 2928051484 | 2928055872 | 97 |
| 89 | iso_pu_bacteria | 2928064002 | 2928066647 | 97 |
| 90 | iso_pu_bacteria | 2928070936 | 2928077200 | 97 |
| 91 | iso_pu_bacteria | 2928084124 | 2928087501 | 97 |
| 92 | iso_pu_bacteria | 2929520902 | 2929522906 | 97 |
| 93 | iso_pu_bacteria | 2945909444 | 2945910047 | 97 |
| 94 | iso_pu_bacteria | 2945945610 | 2945946026 | 97 |
| 95 | iso_pu_bacteria | 2945972063 | 2945975622 | 97 |
| 96 | iso_pu_bacteria | 2945984333 | 2945987937 | 97 |
| 97 | iso_pu_bacteria | 2954767861 | 2954768934 | 97 |
| 98 | 3300001979 | JGI24740J21852_10074167 | JGI24740J21852_100741672 | 101 |
| 99 | 3300003187 | JGI25151J46595_10004477 | JGI25151J46595_100044775 | 101 |
| 100 | 3300003371 | JGI26145J50221_1031028 | JGI26145J50221_10310281 | 101 |
| 101 | 3300003771 | Ga0055526_1010511 | Ga0055526_10105112 | 101 |
| 102 | 3300005289 | Ga0065704_10354616 | Ga0065704_103546161 | 101 |
| 103 | 3300005327 | Ga0070658_10660815 | Ga0070658_106608153 | 101 |
| 104 | 3300005328 | Ga0070676_10009241 | Ga0070676_100092414 | 101 |
| 105 | 3300005328 | Ga0070676_11527376 | Ga0070676_115273762 | 101 |
| 106 | 3300005331 | Ga0070670_100478685 | Ga0070670_1004786853 | 101 |
| 107 | 3300005334 | Ga0068869_100060232 | Ga0068869_1000602323 | 101 |
| 108 | 3300005337 | Ga0070682_100124410 | Ga0070682_1001244103 | 101 |
| 109 | 3300005338 | Ga0068868_100048575 | Ga0068868_1000485753 | 101 |
| 110 | 3300005338 | Ga0068868_101116220 | Ga0068868_1011162203 | 101 |
| 111 | 3300005338 | Ga0068868_101139752 | Ga0068868_1011397523 | 101 |
| 112 | 3300005344 | Ga0070661_100004954 | Ga0070661_1000049545 | 101 |
| 113 | 3300005353 | Ga0070669_101418915 | Ga0070669_1014189151 | 101 |
| 114 | 3300005355 | Ga0070671_100497419 | Ga0070671_1004974191 | 101 |
| 115 | 3300005356 | Ga0070674_100033811 | Ga0070674_1000338113 | 101 |
| 116 | 3300005364 | Ga0070673_100143932 | Ga0070673_1001439323 | 101 |
| 117 | 3300005364 | Ga0070673_100400203 | Ga0070673_1004002032 | 101 |
| 118 | 3300005366 | Ga0070659_100093809 | Ga0070659_1000938092 | 101 |
| 119 | 3300005367 | Ga0070667_100012870 | Ga0070667_1000128707 | 101 |
| 120 | 3300005367 | Ga0070667_101248653 | Ga0070667_1012486531 | 101 |
| 121 | 3300005445 | Ga0070708_101933205 | Ga0070708_1019332051 | 101 |
| 122 | 3300005457 | Ga0070662_101575460 | Ga0070662_1015754602 | 101 |
| 123 | 3300005459 | Ga0068867_100062191 | Ga0068867_1000621912 | 101 |
| 124 | 3300005459 | Ga0068867_100369013 | Ga0068867_1003690132 | 101 |
| 125 | 3300005467 | Ga0070706_100570731 | Ga0070706_1005707313 | 101 |
| 126 | 3300005471 | Ga0070698_100883678 | Ga0070698_1008836782 | 101 |
| 127 | 3300005539 | Ga0068853_100003649 | Ga0068853_1000036498 | 101 |
| 128 | 3300005543 | Ga0070672_100216659 | Ga0070672_1002166593 | 101 |
| 129 | 3300005548 | Ga0070665_100012122 | Ga0070665_1000121222 | 101 |
| 130 | 3300005548 | Ga0070665_100826227 | Ga0070665_1008262272 | 101 |
| 131 | 3300005563 | Ga0068855_100181559 | Ga0068855_1001815592 | 101 |
| 132 | 3300005563 | Ga0068855_101053977 | Ga0068855_1010539771 | 101 |
| 133 | 3300005564 | Ga0070664_100015182 | Ga0070664_1000151824 | 101 |
| 134 | 3300005564 | Ga0070664_100203886 | Ga0070664_1002038862 | 101 |
| 135 | 3300005616 | Ga0068852_100287525 | Ga0068852_1002875252 | 101 |
| 136 | 3300005617 | Ga0068859_101341288 | Ga0068859_1013412882 | 101 |
| 137 | 3300005834 | Ga0068851_10782916 | Ga0068851_107829161 | 101 |
| 138 | 3300005844 | Ga0068862_100502876 | Ga0068862_1005028762 | 101 |
| 139 | 3300005844 | Ga0068862_100864850 | Ga0068862_1008648502 | 101 |
| 140 | 3300006038 | Ga0075365_11340471 | Ga0075365_113404712 | 101 |
| 141 | 3300006048 | Ga0075363_100090383 | Ga0075363_1000903834 | 101 |
| 142 | 3300006048 | Ga0075363_100161342 | Ga0075363_1001613422 | 101 |
| 143 | 3300006177 | Ga0075362_10009200 | Ga0075362_100092003 | 101 |
| 144 | 3300006177 | Ga0075362_10088362 | Ga0075362_100883622 | 101 |
| 145 | 3300006177 | Ga0075362_10215864 | Ga0075362_102158642 | 101 |
| 146 | 3300006177 | Ga0075362_10588995 | Ga0075362_105889952 | 101 |
| 147 | 3300006178 | Ga0075367_10087276 | Ga0075367_100872762 | 101 |
| 148 | 3300006178 | Ga0075367_10443348 | Ga0075367_104433482 | 101 |
| 149 | 3300006186 | Ga0075369_10077775 | Ga0075369_100777751 | 101 |
| 150 | 3300006186 | Ga0075369_10341583 | Ga0075369_103415832 | 101 |
| 151 | 3300006195 | Ga0075366_10012808 | Ga0075366_100128084 | 101 |
| 152 | 3300006353 | Ga0075370_10001060 | Ga0075370_100010605 | 101 |
| 153 | 3300006353 | Ga0075370_10004565 | Ga0075370_100045658 | 101 |
| 154 | 3300006353 | Ga0075370_10275104 | Ga0075370_102751042 | 101 |
| 155 | 3300006881 | Ga0068865_100314516 | Ga0068865_1003145162 | 101 |
| 156 | 3300006881 | Ga0068865_100939688 | Ga0068865_1009396881 | 101 |
| 157 | 3300006931 | Ga0097620_101341312 | Ga0097620_1013413122 | 101 |
| 158 | 3300006946 | Ga0079104_1086544 | Ga0079104_10865442 | 101 |
| 159 | 3300006948 | Ga0099826_10178794 | Ga0099826_101787942 | 101 |
| 160 | 3300009036 | Ga0105244_10193198 | Ga0105244_101931982 | 101 |
| 161 | 3300009036 | Ga0105244_10401037 | Ga0105244_104010372 | 101 |
| 162 | 3300009093 | Ga0105240_10469443 | Ga0105240_104694432 | 101 |
| 163 | 3300009093 | Ga0105240_10999067 | Ga0105240_109990672 | 101 |
| 164 | 3300009098 | Ga0105245_12746268 | Ga0105245_127462682 | 101 |
| 165 | 3300009148 | Ga0105243_10054731 | Ga0105243_100547312 | 101 |
| 166 | 3300009148 | Ga0105243_10196098 | Ga0105243_101960983 | 101 |
| 167 | 3300009148 | Ga0105243_11174070 | Ga0105243_111740702 | 101 |
| 168 | 3300009176 | Ga0105242_10318560 | Ga0105242_103185602 | 101 |
| 169 | 3300009545 | Ga0105237_12537574 | Ga0105237_125375742 | 101 |
| 170 | 3300009551 | Ga0105238_10153210 | Ga0105238_101532104 | 101 |
| 171 | 3300009551 | Ga0105238_11167957 | Ga0105238_111679572 | 101 |
| 172 | 3300009553 | Ga0105249_11686855 | Ga0105249_116868553 | 101 |
| 173 | 3300010375 | Ga0105239_10891399 | Ga0105239_108913992 | 101 |
| 174 | 3300011119 | Ga0105246_10458212 | Ga0105246_104582122 | 101 |
| 175 | 3300012502 | Ga0157347_1016319 | Ga0157347_10163192 | 101 |
| 176 | 3300012513 | Ga0157326_1003093 | Ga0157326_10030933 | 101 |
| 177 | 3300013104 | Ga0157370_10004419 | Ga0157370_1000441916 | 101 |
| 178 | 3300013105 | Ga0157369_10015097 | Ga0157369_100150977 | 101 |
| 179 | 3300013296 | Ga0157374_12533313 | Ga0157374_125333131 | 101 |
| 180 | 3300013308 | Ga0157375_10951052 | Ga0157375_109510521 | 101 |
| 181 | 3300014497 | Ga0182008_10208454 | Ga0182008_102084542 | 101 |
| 182 | 3300014745 | Ga0157377_10846163 | Ga0157377_108461632 | 101 |
| 183 | 3300014968 | Ga0157379_10446943 | Ga0157379_104469432 | 101 |
| 184 | 3300014969 | Ga0157376_12160705 | Ga0157376_121607051 | 101 |
| 185 | 3300014969 | Ga0157376_12882393 | Ga0157376_128823932 | 101 |
| 186 | 3300015261 | Ga0182006_1070612 | Ga0182006_10706122 | 101 |
| 187 | 3300017792 | Ga0163161_10000099 | Ga0163161_1000009954 | 101 |
| 188 | 3300017792 | Ga0163161_10724669 | Ga0163161_107246692 | 101 |
| 189 | 3300017792 | Ga0163161_11158677 | Ga0163161_111586772 | 101 |
| 190 | 3300025256 | Ga0209759_1056890 | Ga0209759_10568902 | 101 |
| 191 | 3300025258 | Ga0209129_1004728 | Ga0209129_10047282 | 101 |
| 192 | 3300025294 | Ga0209025_1000174 | Ga0209025_100017487 | 101 |
| 193 | 3300025295 | Ga0209564_1001971 | Ga0209564_100197116 | 101 |
| 194 | 3300025298 | Ga0209050_1014278 | Ga0209050_10142784 | 101 |
| 195 | 3300025299 | Ga0209256_1031123 | Ga0209256_10311233 | 101 |
| 196 | 3300025303 | Ga0209051_1000099 | Ga0209051_100009928 | 101 |
| 197 | 3300025304 | Ga0209257_1039876 | Ga0209257_10398762 | 101 |
| 198 | 3300025315 | Ga0207697_10312911 | Ga0207697_103129112 | 101 |
| 199 | 3300025907 | Ga0207645_10050327 | Ga0207645_100503273 | 101 |
| 200 | 3300025909 | Ga0207705_10699189 | Ga0207705_106991892 | 101 |
| 201 | 3300025913 | Ga0207695_10008803 | Ga0207695_1000880311 | 101 |
| 202 | 3300025913 | Ga0207695_10386796 | Ga0207695_103867962 | 101 |
| 203 | 3300025914 | Ga0207671_10011507 | Ga0207671_100115074 | 101 |
| 204 | 3300025914 | Ga0207671_10186790 | Ga0207671_101867902 | 101 |
| 205 | 3300025914 | Ga0207671_10527656 | Ga0207671_105276562 | 101 |
| 206 | 3300025920 | Ga0207649_10000421 | Ga0207649_100004215 | 101 |
| 207 | 3300025920 | Ga0207649_10686346 | Ga0207649_106863462 | 101 |
| 208 | 3300025923 | Ga0207681_11006598 | Ga0207681_110065982 | 101 |
| 209 | 3300025924 | Ga0207694_10015587 | Ga0207694_100155872 | 101 |
| 210 | 3300025925 | Ga0207650_10082923 | Ga0207650_100829235 | 101 |
| 211 | 3300025925 | Ga0207650_10136256 | Ga0207650_101362562 | 101 |
| 212 | 3300025925 | Ga0207650_10923140 | Ga0207650_109231402 | 101 |
| 213 | 3300025926 | Ga0207659_10077358 | Ga0207659_100773582 | 101 |
| 214 | 3300025927 | Ga0207687_10492960 | Ga0207687_104929603 | 101 |
| 215 | 3300025931 | Ga0207644_10635592 | Ga0207644_106355923 | 101 |
| 216 | 3300025932 | Ga0207690_10041143 | Ga0207690_100411433 | 101 |
| 217 | 3300025933 | Ga0207706_11387904 | Ga0207706_113879042 | 101 |
| 218 | 3300025934 | Ga0207686_10409678 | Ga0207686_104096782 | 101 |
| 219 | 3300025935 | Ga0207709_10016596 | Ga0207709_100165963 | 101 |
| 220 | 3300025935 | Ga0207709_10028184 | Ga0207709_100281845 | 101 |
| 221 | 3300025935 | Ga0207709_10814636 | Ga0207709_108146361 | 101 |
| 222 | 3300025937 | Ga0207669_10847937 | Ga0207669_108479372 | 101 |
| 223 | 3300025938 | Ga0207704_10118044 | Ga0207704_101180443 | 101 |
| 224 | 3300025940 | Ga0207691_10063148 | Ga0207691_100631481 | 101 |
| 225 | 3300025941 | Ga0207711_10751178 | Ga0207711_107511782 | 101 |
| 226 | 3300025942 | Ga0207689_10191493 | Ga0207689_101914933 | 101 |
| 227 | 3300025945 | Ga0207679_10000047 | Ga0207679_100000474 | 101 |
| 228 | 3300025945 | Ga0207679_10927237 | Ga0207679_109272372 | 101 |
| 229 | 3300025945 | Ga0207679_11818358 | Ga0207679_118183582 | 101 |
| 230 | 3300025949 | Ga0207667_10142752 | Ga0207667_101427522 | 101 |
| 231 | 3300025949 | Ga0207667_10210465 | Ga0207667_102104652 | 101 |
| 232 | 3300025960 | Ga0207651_10004851 | Ga0207651_100048516 | 101 |
| 233 | 3300025960 | Ga0207651_10209622 | Ga0207651_102096223 | 101 |
| 234 | 3300025961 | Ga0207712_11240938 | Ga0207712_112409383 | 101 |
| 235 | 3300025972 | Ga0207668_10283085 | Ga0207668_102830852 | 101 |
| 236 | 3300025986 | Ga0207658_10007097 | Ga0207658_100070977 | 101 |
| 237 | 3300026023 | Ga0207677_10827195 | Ga0207677_108271952 | 101 |
| 238 | 3300026023 | Ga0207677_10974017 | Ga0207677_109740173 | 101 |
| 239 | 3300026041 | Ga0207639_10485389 | Ga0207639_104853892 | 101 |
| 240 | 3300026041 | Ga0207639_11353097 | Ga0207639_113530971 | 101 |
| 241 | 3300026067 | Ga0207678_10358236 | Ga0207678_103582362 | 101 |
| 242 | 3300026089 | Ga0207648_10285934 | Ga0207648_102859342 | 101 |
| 243 | 3300026089 | Ga0207648_10420669 | Ga0207648_104206692 | 101 |
| 244 | 3300026116 | Ga0207674_10432576 | Ga0207674_104325763 | 101 |
| 245 | 3300026116 | Ga0207674_10595160 | Ga0207674_105951602 | 101 |
| 246 | 3300026121 | Ga0207683_10177699 | Ga0207683_101776992 | 101 |
| 247 | 3300026121 | Ga0207683_10902858 | Ga0207683_109028582 | 101 |
| 248 | 3300026142 | Ga0207698_11443285 | Ga0207698_114432852 | 101 |
| 249 | 3300027876 | Ga0209974_10019883 | Ga0209974_100198833 | 101 |
| 250 | 3300027907 | Ga0207428_10297293 | Ga0207428_102972932 | 101 |
| 251 | 3300028379 | Ga0268266_10211569 | Ga0268266_102115693 | 101 |
| 252 | 3300028380 | Ga0268265_10431225 | Ga0268265_104312252 | 101 |
| 253 | 3300028794 | Ga0307515_10002229 | Ga0307515_1000222914 | 101 |
| 254 | 3300028794 | Ga0307515_10008688 | Ga0307515_1000868816 | 101 |
| 255 | 3300028794 | Ga0307515_10120794 | Ga0307515_101207941 | 101 |
| 256 | 3300028794 | Ga0307515_10127325 | Ga0307515_101273251 | 101 |
| 257 | 3300028794 | Ga0307515_10135898 | Ga0307515_101358982 | 101 |
| 258 | 3300028794 | Ga0307515_10503747 | Ga0307515_105037471 | 101 |
| 259 | 3300030522 | Ga0307512_10085589 | Ga0307512_100855893 | 101 |
| 260 | 3300030522 | Ga0307512_10129717 | Ga0307512_101297172 | 101 |
| 261 | 3300030731 | Ga0316177_1098042 | Ga0316177_10980421 | 101 |
| 262 | 3300030732 | Ga0316176_1133948 | Ga0316176_11339482 | 101 |
| 263 | 3300030733 | Ga0314311_1041998 | Ga0314311_10419982 | 101 |
| 264 | 3300030734 | Ga0316179_1010299 | Ga0316179_10102992 | 101 |
| 265 | 3300030742 | Ga0316183_1084100 | Ga0316183_10841002 | 101 |
| 266 | 3300030742 | Ga0316183_1096743 | Ga0316183_10967432 | 101 |
| 267 | 3300030745 | Ga0316182_1205325 | Ga0316182_12053252 | 101 |
| 268 | 3300030745 | Ga0316182_1249672 | Ga0316182_12496722 | 101 |
| 269 | 3300031344 | Ga0265316_10962097 | Ga0265316_109620972 | 101 |
| 270 | 3300031456 | Ga0307513_10023805 | Ga0307513_100238055 | 101 |
| 271 | 3300031456 | Ga0307513_10152160 | Ga0307513_101521602 | 101 |
| 272 | 3300031456 | Ga0307513_10218223 | Ga0307513_102182234 | 101 |
| 273 | 3300031456 | Ga0307513_10243711 | Ga0307513_102437112 | 101 |
| 274 | 3300031456 | Ga0307513_10252571 | Ga0307513_102525712 | 101 |
| 275 | 3300031456 | Ga0307513_10377914 | Ga0307513_103779142 | 101 |
| 276 | 3300031456 | Ga0307513_10603569 | Ga0307513_106035691 | 101 |
| 277 | 3300031507 | Ga0307509_10422457 | Ga0307509_104224572 | 101 |
| 278 | 3300031548 | Ga0307408_100000010 | Ga0307408_100000010168 | 101 |
| 279 | 3300031548 | Ga0307408_100001177 | Ga0307408_1000011773 | 101 |
| 280 | 3300031548 | Ga0307408_100023848 | Ga0307408_1000238483 | 101 |
| 281 | 3300031548 | Ga0307408_100338634 | Ga0307408_1003386342 | 101 |
| 282 | 3300031548 | Ga0307408_100340904 | Ga0307408_1003409042 | 101 |
| 283 | 3300031548 | Ga0307408_100759503 | Ga0307408_1007595032 | 101 |
| 284 | 3300031616 | Ga0307508_10001872 | Ga0307508_1000187215 | 101 |
| 285 | 3300031616 | Ga0307508_10004732 | Ga0307508_1000473211 | 101 |
| 286 | 3300031649 | Ga0307514_10001349 | Ga0307514_1000134919 | 101 |
| 287 | 3300031649 | Ga0307514_10130820 | Ga0307514_101308202 | 101 |
| 288 | 3300031727 | Ga0316576_10184326 | Ga0316576_101843262 | 101 |
| 289 | 3300031730 | Ga0307516_10000058 | Ga0307516_100000587 | 101 |
| 290 | 3300031730 | Ga0307516_10001572 | Ga0307516_1000157210 | 101 |
| 291 | 3300031730 | Ga0307516_10017367 | Ga0307516_100173675 | 101 |
| 292 | 3300031731 | Ga0307405_10028971 | Ga0307405_100289712 | 101 |
| 293 | 3300031731 | Ga0307405_10189369 | Ga0307405_101893692 | 101 |
| 294 | 3300031731 | Ga0307405_10322522 | Ga0307405_103225222 | 101 |
| 295 | 3300031731 | Ga0307405_11265443 | Ga0307405_112654432 | 101 |
| 296 | 3300031824 | Ga0307413_10065467 | Ga0307413_100654673 | 101 |
| 297 | 3300031824 | Ga0307413_10910796 | Ga0307413_109107962 | 101 |
| 298 | 3300031824 | Ga0307413_10982184 | Ga0307413_109821842 | 101 |
| 299 | 3300031852 | Ga0307410_10004711 | Ga0307410_100047117 | 101 |
| 300 | 3300031901 | Ga0307406_10000741 | Ga0307406_1000074114 | 101 |
| 301 | 3300031901 | Ga0307406_10009421 | Ga0307406_100094212 | 101 |
| 302 | 3300031901 | Ga0307406_10648602 | Ga0307406_106486022 | 101 |
| 303 | 3300031903 | Ga0307407_10168511 | Ga0307407_101685112 | 101 |
| 304 | 3300031903 | Ga0307407_10918065 | Ga0307407_109180652 | 101 |
| 305 | 3300031911 | Ga0307412_10002427 | Ga0307412_100024272 | 101 |
| 306 | 3300031911 | Ga0307412_10148660 | Ga0307412_101486603 | 101 |
| 307 | 3300031911 | Ga0307412_10338384 | Ga0307412_103383842 | 101 |
| 308 | 3300031911 | Ga0307412_10351962 | Ga0307412_103519621 | 101 |
| 309 | 3300031911 | Ga0307412_10615823 | Ga0307412_106158231 | 101 |
| 310 | 3300031911 | Ga0307412_10766091 | Ga0307412_107660912 | 101 |
| 311 | 3300031911 | Ga0307412_10797861 | Ga0307412_107978612 | 101 |
| 312 | 3300031911 | Ga0307412_10832685 | Ga0307412_108326852 | 101 |
| 313 | 3300031911 | Ga0307412_11643718 | Ga0307412_116437182 | 101 |
| 314 | 3300031911 | Ga0307412_12040027 | Ga0307412_120400272 | 101 |
| 315 | 3300031911 | Ga0307412_12313373 | Ga0307412_123133731 | 101 |
| 316 | 3300031995 | Ga0307409_100030230 | Ga0307409_1000302303 | 101 |
| 317 | 3300031995 | Ga0307409_100564026 | Ga0307409_1005640262 | 101 |
| 318 | 3300032002 | Ga0307416_100015543 | Ga0307416_1000155435 | 101 |
| 319 | 3300032002 | Ga0307416_100055308 | Ga0307416_1000553082 | 101 |
| 320 | 3300032002 | Ga0307416_100476389 | Ga0307416_1004763892 | 101 |
| 321 | 3300032002 | Ga0307416_102951397 | Ga0307416_1029513972 | 101 |
| 322 | 3300032002 | Ga0307416_103829067 | Ga0307416_1038290672 | 101 |
| 323 | 3300032004 | Ga0307414_10245353 | Ga0307414_102453532 | 101 |
| 324 | 3300032004 | Ga0307414_10452722 | Ga0307414_104527222 | 101 |
| 325 | 3300032004 | Ga0307414_11852798 | Ga0307414_118527982 | 101 |
| 326 | 3300032005 | Ga0307411_10001517 | Ga0307411_100015173 | 101 |
| 327 | 3300032005 | Ga0307411_10207656 | Ga0307411_102076562 | 101 |
| 328 | 3300032005 | Ga0307411_10229829 | Ga0307411_102298291 | 101 |
| 329 | 3300032005 | Ga0307411_10303472 | Ga0307411_103034722 | 101 |
| 330 | 3300032005 | Ga0307411_10552571 | Ga0307411_105525712 | 101 |
| 331 | 3300032005 | Ga0307411_11977192 | Ga0307411_119771921 | 101 |
| 332 | 3300032126 | Ga0307415_100182612 | Ga0307415_1001826123 | 101 |
| 333 | 3300032126 | Ga0307415_100857765 | Ga0307415_1008577652 | 101 |
| 334 | 3300032126 | Ga0307415_101536442 | Ga0307415_1015364422 | 101 |
| 335 | 3300033179 | Ga0307507_10075671 | Ga0307507_100756712 | 101 |
| 336 | 3300033179 | Ga0307507_10160163 | Ga0307507_101601631 | 101 |
| 337 | 3300033180 | Ga0307510_10006135 | Ga0307510_1000613515 | 101 |
| 338 | 3300033180 | Ga0307510_10232538 | Ga0307510_102325382 | 101 |
| 339 | 3300034817 | Ga0373948_0001520 | Ga0373948_0001520_698_1003 | 101 |
| 340 | 3300034820 | Ga0373959_0080550 | Ga0373959_0080550_58_363 | 101 |
| 341 | 3300035086 | Ga0373934_0440794 | Ga0373934_0440794_113_433 | 101 |
| 342 | 3300035089 | Ga0373944_0182125 | Ga0373944_0182125_273_578 | 101 |
| 343 | 3300035091 | Ga0373951_0009036 | Ga0373951_0009036_1415_1720 | 101 |
| 344 | 3300035091 | Ga0373951_0069480 | Ga0373951_0069480_222_527 | 101 |
| 345 | 3300035111 | Ga0373923_0165716 | Ga0373923_0165716_110_415 | 101 |
| 346 | 3300035111 | Ga0373923_0365307 | Ga0373923_0365307_334_654 | 101 |
| 347 | 3300035112 | Ga0373932_0025075 | Ga0373932_0025075_570_875 | 101 |
| 348 | 3300035113 | Ga0373936_0070094 | Ga0373936_0070094_858_1163 | 101 |
| 349 | 3300035114 | Ga0373939_0000036 | Ga0373939_0000036_43407_43712 | 101 |
| 350 | 3300035116 | Ga0373945_0094123 | Ga0373945_0094123_260_580 | 101 |
| 351 | 3300035118 | Ga0373954_0242100 | Ga0373954_0242100_504_824 | 101 |
| 352 | 3300035118 | Ga0373954_0563481 | Ga0373954_0563481_227_532 | 101 |
| 353 | 3300035119 | Ga0373956_0306666 | Ga0373956_0306666_21_326 | 101 |
| 354 | 3300035121 | Ga0373960_0021758 | Ga0373960_0021758_1364_1669 | 101 |
| 355 | 3300035170 | Ga0373943_0042479 | Ga0373943_0042479_1471_1791 | 101 |
| 356 | 3300035170 | Ga0373943_0301170 | Ga0373943_0301170_457_762 | 101 |
| 357 | 3300035172 | Ga0373955_0016521 | Ga0373955_0016521_621_926 | 101 |
| 358 | 3300035172 | Ga0373955_0041212 | Ga0373955_0041212_639_959 | 101 |
| 359 | 3300035241 | Ga0373961_0236665 | Ga0373961_0236665_229_534 | 101 |
| 360 | 3300035410 | Ga0373924_0073943 | Ga0373924_0073943_573_893 | 101 |
| 361 | 3300035691 | Ga0373931_0005162 | Ga0373931_0005162_4072_4377 | 101 |
| 362 | 3300035691 | Ga0373931_0019544 | Ga0373931_0019544_2585_2890 | 101 |
| 363 | 3300035691 | Ga0373931_0197628 | Ga0373931_0197628_571_879 | 101 |
| 364 | 3300035692 | Ga0373935_0281752 | Ga0373935_0281752_529_834 | 101 |
| 365 | 3300035724 | Ga0373933_0661131 | Ga0373933_0661131_348_653 | 101 |
| 366 | 3300035725 | Ga0373947_0042936 | Ga0373947_0042936_1460_1765 | 101 |
| 367 | 3300036401 | Ga0373937_0394749 | Ga0373937_0394749_891_1211 | 101 |
| 368 | 3300037471 | Ga0395905_0000600 | Ga0395905_0000600_30170_30475 | 101 |
| 369 | 3300041404 | Ga0439436_0028989 | Ga0439436_0028989_836_1141 | 101 |
| 370 | 3300041413 | Ga0439465_0032873 | Ga0439465_0032873_201_506 | 101 |
| 371 | 3300041443 | Ga0451789_0151812 | Ga0451789_0151812_816_1121 | 101 |
| 372 | 3300041443 | Ga0451789_0544890 | Ga0451789_0544890_123_428 | 101 |
| 373 | 3300041453 | Ga0451797_0677519 | Ga0451797_0677519_74_379 | 101 |
| 374 | 3300041453 | Ga0451797_1429463 | Ga0451797_1429463_432_737 | 101 |
| 375 | 3300041459 | Ga0451800_0842469 | Ga0451800_0842469_148_453 | 101 |
| 376 | 3300041459 | Ga0451800_1401263 | Ga0451800_1401263_84_389 | 101 |
| 377 | 3300041460 | Ga0451802_2141157 | Ga0451802_2141157_184_489 | 101 |
| 378 | 3300041463 | Ga0451804_1092860 | Ga0451804_1092860_79_384 | 101 |
| 379 | 3300041486 | Ga0451807_0521282 | Ga0451807_0521282_228_533 | 101 |
| 380 | 3300041492 | Ga0451835_0332945 | Ga0451835_0332945_72_377 | 101 |
| 381 | 3300041496 | Ga0451839_1391327 | Ga0451839_1391327_404_709 | 101 |
| 382 | 3300041498 | Ga0451841_0202857 | Ga0451841_0202857_102_407 | 101 |
| 383 | 3300041501 | Ga0451845_0502849 | Ga0451845_0502849_409_714 | 101 |
| 384 | 3300041503 | Ga0451847_0777924 | Ga0451847_0777924_554_859 | 101 |
| 385 | 3300041505 | Ga0451849_0735763 | Ga0451849_0735763_180_485 | 101 |
| 386 | 3300041507 | Ga0451851_0055416 | Ga0451851_0055416_11_316 | 101 |
| 387 | 3300041999 | Ga0439433_0037076 | Ga0439433_0037076_375_680 | 101 |
| 388 | 3300042002 | Ga0439442_003576 | Ga0439442_003576_711_1016 | 101 |
| 389 | 3300042010 | Ga0439452_089718 | Ga0439452_089718_133_438 | 101 |
| 390 | 3300042121 | Ga0450919_016249 | Ga0450919_016249_391_696 | 101 |
| 391 | 3300042125 | Ga0450923_124371 | Ga0450923_124371_168_473 | 101 |
| 392 | 3300042134 | Ga0450898_024480 | Ga0450898_024480_690_995 | 101 |
| 393 | 3300042135 | Ga0450899_008107 | Ga0450899_008107_310_615 | 101 |
| 394 | 3300042144 | Ga0450889_021351 | Ga0450889_021351_333_638 | 101 |
| 395 | 3300042145 | Ga0450906_006856 | Ga0450906_006856_338_643 | 101 |
| 396 | 3300042147 | Ga0450910_003954 | Ga0450910_003954_1326_1631 | 101 |
| 397 | 3300042156 | Ga0439446_0238372 | Ga0439446_0238372_106_411 | 101 |
| 398 | 3300042184 | Ga0450908_004610 | Ga0450908_004610_315_620 | 101 |
| 399 | 3300042185 | Ga0450909_017454 | Ga0450909_017454_572_877 | 101 |
| 400 | 3300042435 | Ga0439434_0025270 | Ga0439434_0025270_690_995 | 101 |
| 401 | 3300042531 | Ga0450918_006736 | Ga0450918_006736_306_611 | 101 |
| 402 | 3300042532 | Ga0450893_0014508 | Ga0450893_0014508_644_949 | 101 |
| 403 | 3300042876 | Ga0451577_0022469 | Ga0451577_0022469_519_824 | 101 |
| 404 | 3300044712 | Ga0453684_2386388 | Ga0453684_2386388_19_324 | 101 |
| 405 | 3300044842 | Ga0466957_0969017 | Ga0466957_0969017_253_558 | 101 |
| 406 | 3300045051 | Ga0451576_0098993 | Ga0451576_0098993_2716_3021 | 101 |
| 407 | 3300046453 | Ga0495627_019484 | Ga0495627_019484_555_860 | 101 |
| 408 | 3300046454 | Ga0495592_0629263 | Ga0495592_0629263_135_455 | 101 |
| 409 | 3300046459 | Ga0495629_0049614 | Ga0495629_0049614_2028_2348 | 101 |
| 410 | 3300046460 | Ga0495638_0070970 | Ga0495638_0070970_944_1249 | 101 |
| 411 | 3300046471 | Ga0495650_0005014 | Ga0495650_0005014_6855_7160 | 101 |
| 412 | 3300046472 | Ga0495580_0060253 | Ga0495580_0060253_2042_2347 | 101 |
| 413 | 3300046473 | Ga0495582_0046755 | Ga0495582_0046755_1922_2227 | 101 |
| 414 | 3300046475 | Ga0495639_0420916 | Ga0495639_0420916_55_375 | 101 |
| 415 | 3300046476 | Ga0495662_0180964 | Ga0495662_0180964_28_348 | 101 |
| 416 | 3300046507 | Ga0495606_0373261 | Ga0495606_0373261_255_560 | 101 |
| 417 | 3300046512 | Ga0495610_0036371 | Ga0495610_0036371_1007_1312 | 101 |
| 418 | 3300046512 | Ga0495610_0039514 | Ga0495610_0039514_1456_1761 | 101 |
| 419 | 3300046513 | Ga0495616_0038655 | Ga0495616_0038655_703_1008 | 101 |
| 420 | 3300046515 | Ga0495620_0033235 | Ga0495620_0033235_608_913 | 101 |
| 421 | 3300046516 | Ga0495628_0995660 | Ga0495628_0995660_232_537 | 101 |
| 422 | 3300046517 | Ga0495630_1380714 | Ga0495630_1380714_76_381 | 101 |
| 423 | 3300046518 | Ga0495631_0000073 | Ga0495631_0000073_1392_1697 | 101 |
| 424 | 3300046519 | Ga0495632_0066357 | Ga0495632_0066357_1238_1543 | 101 |
| 425 | 3300046520 | Ga0495637_0098860 | Ga0495637_0098860_366_671 | 101 |
| 426 | 3300046522 | Ga0495643_0014989 | Ga0495643_0014989_1105_1410 | 101 |
| 427 | 3300046524 | Ga0495648_0407196 | Ga0495648_0407196_131_436 | 101 |
| 428 | 3300046529 | Ga0495652_0645632 | Ga0495652_0645632_35_340 | 101 |
| 429 | 3300046530 | Ga0495654_0001245 | Ga0495654_0001245_4007_4312 | 101 |
| 430 | 3300046530 | Ga0495654_0107228 | Ga0495654_0107228_768_1073 | 101 |
| 431 | 3300046530 | Ga0495654_0208204 | Ga0495654_0208204_173_478 | 101 |
| 432 | 3300046531 | Ga0495665_0631889 | Ga0495665_0631889_210_515 | 101 |
| 433 | 3300046533 | Ga0495640_0781875 | Ga0495640_0781875_101_406 | 101 |
| 434 | 3300046542 | Ga0495597_0000024 | Ga0495597_0000024_24331_24657 | 101 |
| 435 | 3300046543 | Ga0495645_0425310 | Ga0495645_0425310_401_706 | 101 |
| 436 | 3300046558 | Ga0495633_0466649 | Ga0495633_0466649_143_448 | 101 |
| 437 | 3300046559 | Ga0495667_0198405 | Ga0495667_0198405_169_474 | 101 |
| 438 | 3300046616 | Ga0495668_0081141 | Ga0495668_0081141_1109_1414 | 101 |
| 439 | 3300046660 | Ga0495625_0001217 | Ga0495625_0001217_31712_32017 | 101 |
| 440 | 3300046660 | Ga0495625_0086085 | Ga0495625_0086085_593_898 | 101 |
| 441 | 3300046660 | Ga0495625_0407396 | Ga0495625_0407396_247_552 | 101 |
| 442 | 3300046664 | Ga0495659_0136502 | Ga0495659_0136502_290_595 | 101 |
| 443 | 3300046665 | Ga0495661_0338713 | Ga0495661_0338713_231_536 | 101 |
| 444 | 3300046674 | Ga0495588_0012491 | Ga0495588_0012491_708_1013 | 101 |
| 445 | 3300046674 | Ga0495588_0457348 | Ga0495588_0457348_148_453 | 101 |
| 446 | 3300046675 | Ga0495657_0890757 | Ga0495657_0890757_95_400 | 101 |
| 447 | 3300046681 | Ga0495647_0226645 | Ga0495647_0226645_237_542 | 101 |
| 448 | 3300046683 | Ga0495658_0235096 | Ga0495658_0235096_262_567 | 101 |
| 449 | 3300046691 | Ga0495670_0346377 | Ga0495670_0346377_177_482 | 101 |
| 450 | 3300046692 | Ga0495671_0089351 | Ga0495671_0089351_727_1032 | 101 |
| 451 | 3300046692 | Ga0495671_0401977 | Ga0495671_0401977_97_402 | 101 |
| 452 | 3300046809 | Ga0495600_0482197 | Ga0495600_0482197_327_632 | 101 |
| 453 | 3300046810 | Ga0495660_0322188 | Ga0495660_0322188_101_406 | 101 |
| 454 | 3300047321 | Ga0495676_0091783 | Ga0495676_0091783_746_1051 | 101 |
| 455 | 3300047445 | Ga0495677_0135520 | Ga0495677_0135520_520_825 | 101 |
| 456 | 3300047471 | Ga0495684_0193819 | Ga0495684_0193819_133_438 | 101 |
| 457 | 3300047471 | Ga0495684_0274416 | Ga0495684_0274416_868_1188 | 101 |
| 458 | 3300047472 | Ga0495686_0213907 | Ga0495686_0213907_777_1082 | 101 |
| 459 | 3300048904 | Ga0496101_0055821 | Ga0496101_0055821_780_1085 | 101 |
| 460 | 3300048904 | Ga0496101_1181839 | Ga0496101_1181839_199_504 | 101 |
| 461 | 3300048909 | Ga0496106_0033566 | Ga0496106_0033566_3455_3760 | 101 |
| 462 | 3300048916 | Ga0496113_0139336 | Ga0496113_0139336_1369_1674 | 101 |
| 463 | 3300048916 | Ga0496113_0406049 | Ga0496113_0406049_424_729 | 101 |
| 464 | 3300048917 | Ga0496114_0693241 | Ga0496114_0693241_510_815 | 101 |
| 465 | 3300048918 | Ga0496115_0749314 | Ga0496115_0749314_238_543 | 101 |
| 466 | 3300048919 | Ga0496116_0260160 | Ga0496116_0260160_123_428 | 101 |
| 467 | 3300048920 | Ga0496117_0055146 | Ga0496117_0055146_1002_1307 | 101 |
| 468 | 3300048920 | Ga0496117_0069400 | Ga0496117_0069400_1686_1991 | 101 |
| 469 | 3300048920 | Ga0496117_0598014 | Ga0496117_0598014_90_395 | 101 |
| 470 | 3300048921 | Ga0496118_0233444 | Ga0496118_0233444_362_667 | 101 |
| 471 | 3300048923 | Ga0496120_0459678 | Ga0496120_0459678_139_444 | 101 |
| 472 | 3300048924 | Ga0496121_0094048 | Ga0496121_0094048_2003_2308 | 101 |
| 473 | 3300048924 | Ga0496121_0114365 | Ga0496121_0114365_544_849 | 101 |
| 474 | 3300048925 | Ga0496122_0103836 | Ga0496122_0103836_567_872 | 101 |
| 475 | 3300048925 | Ga0496122_0239281 | Ga0496122_0239281_355_660 | 101 |
| 476 | 3300048925 | Ga0496122_0510133 | Ga0496122_0510133_79_384 | 101 |
| 477 | 3300048926 | Ga0496123_0104026 | Ga0496123_0104026_126_431 | 101 |
| 478 | 3300048926 | Ga0496123_0147661 | Ga0496123_0147661_892_1197 | 101 |
| 479 | 3300048926 | Ga0496123_0384217 | Ga0496123_0384217_163_468 | 101 |
| 480 | 3300048927 | Ga0496124_0261471 | Ga0496124_0261471_504_809 | 101 |
| 481 | 3300048928 | Ga0496125_0215883 | Ga0496125_0215883_614_919 | 101 |
| 482 | 3300048928 | Ga0496125_0397224 | Ga0496125_0397224_21_326 | 101 |
| 483 | 3300049665 | Ga0501227_032723 | Ga0501227_032723_791_1096 | 101 |
| 484 | 3300049679 | Ga0501249_080672 | Ga0501249_080672_418_723 | 101 |
| 485 | 3300049688 | Ga0501259_044051 | Ga0501259_044051_91_396 | 101 |
| 486 | 3300049688 | Ga0501259_111756 | Ga0501259_111756_71_376 | 101 |
| 487 | 3300049705 | Ga0501225_0009191 | Ga0501225_0009191_664_969 | 101 |
| 488 | 3300049759 | Ga0501262_002190 | Ga0501262_002190_1866_2171 | 101 |
| 489 | 3300049759 | Ga0501262_021346 | Ga0501262_021346_242_547 | 101 |
| 490 | 3300050489 | nmdc:mga03683_62534_c1 | nmdc:mga03683_62534_c1_610_915 | 101 |
| 491 | 3300050490 | nmdc:mga03n38_325535_c1 | nmdc:mga03n38_325535_c1_179_484 | 101 |
| 492 | 3300050490 | nmdc:mga03n38_374779_c1 | nmdc:mga03n38_374779_c1_109_414 | 101 |
| 493 | 3300050490 | nmdc:mga03n38_390956_c1 | nmdc:mga03n38_390956_c1_216_521 | 101 |
| 494 | 3300050492 | nmdc:mga0yw44_1121696_c1 | nmdc:mga0yw44_1121696_c1_181_486 | 101 |
| 495 | 3300050493 | nmdc:mga0k408_115836_c1 | nmdc:mga0k408_115836_c1_763_1068 | 101 |
| 496 | 3300050493 | nmdc:mga0k408_132846_c1 | nmdc:mga0k408_132846_c1_422_727 | 101 |
| 497 | 3300050493 | nmdc:mga0k408_703166_c1 | nmdc:mga0k408_703166_c1_100_405 | 101 |
| 498 | 3300050493 | nmdc:mga0k408_742429_c1 | nmdc:mga0k408_742429_c1_72_377 | 101 |
| 499 | 3300050494 | nmdc:mga06z11_115416_c1 | nmdc:mga06z11_115416_c1_495_800 | 101 |
| 500 | 3300050494 | nmdc:mga06z11_331667_c1 | nmdc:mga06z11_331667_c1_311_616 | 101 |
| 501 | 3300050494 | nmdc:mga06z11_476152_c1 | nmdc:mga06z11_476152_c1_370_675 | 101 |
| 502 | 3300050496 | nmdc:mga07m45_378022_c1 | nmdc:mga07m45_378022_c1_256_561 | 101 |
| 503 | 3300050496 | nmdc:mga07m45_39111_c1 | nmdc:mga07m45_39111_c1_1847_2152 | 101 |
| 504 | 3300050496 | nmdc:mga07m45_47453_c1 | nmdc:mga07m45_47453_c1_603_908 | 101 |
| 505 | 3300050496 | nmdc:mga07m45_526592_c1 | nmdc:mga07m45_526592_c1_137_442 | 101 |
| 506 | 3300050516 | nmdc:mga0sz30_100898_c1 | nmdc:mga0sz30_100898_c1_209_514 | 101 |
| 507 | 3300053077 | Ga0495601_0094278 | Ga0495601_0094278_1008_1328 | 101 |
| 508 | 3300053079 | Ga0500610_0000329 | Ga0500610_0000329_5558_5863 | 101 |
| 509 | 3300053079 | Ga0500610_0047951 | Ga0500610_0047951_715_1020 | 101 |
| 510 | 3300053084 | Ga0495595_0086303 | Ga0495595_0086303_185_505 | 101 |
| 511 | 3300053085 | Ga0495619_0492827 | Ga0495619_0492827_364_669 | 101 |
| 512 | 3300053085 | Ga0495619_0627224 | Ga0495619_0627224_316_636 | 101 |
| 513 | 3300053086 | Ga0500578_0254732 | Ga0500578_0254732_547_852 | 101 |
| 514 | 3300053088 | Ga0500644_0031465 | Ga0500644_0031465_810_1115 | 101 |
| 515 | 3300053093 | Ga0500651_0634216 | Ga0500651_0634216_28_333 | 101 |
| 516 | 3300053096 | Ga0500641_0131306 | Ga0500641_0131306_518_823 | 101 |
| 517 | 3300053108 | Ga0500562_011371 | Ga0500562_011371_1758_2063 | 101 |
| 518 | 3300053108 | Ga0500562_137955 | Ga0500562_137955_129_434 | 101 |
| 519 | 3300053117 | Ga0500593_010835 | Ga0500593_010835_2271_2576 | 101 |
| 520 | 3300053117 | Ga0500593_030693 | Ga0500593_030693_545_850 | 101 |
| 521 | 3300053118 | Ga0500594_0004824 | Ga0500594_0004824_2215_2520 | 101 |
| 522 | 3300053121 | Ga0500607_020625 | Ga0500607_020625_3004_3309 | 101 |
| 523 | 3300053121 | Ga0500607_049832 | Ga0500607_049832_1446_1751 | 101 |
| 524 | 3300053134 | Ga0500658_0001544 | Ga0500658_0001544_2352_2657 | 101 |
| 525 | 3300053134 | Ga0500658_0048977 | Ga0500658_0048977_604_909 | 101 |
| 526 | 3300053139 | Ga0500568_0023470 | Ga0500568_0023470_529_834 | 101 |
| 527 | 3300053153 | Ga0500616_0155352 | Ga0500616_0155352_60_365 | 101 |
| 528 | 3300053153 | Ga0500616_0289505 | Ga0500616_0289505_340_645 | 101 |
| 529 | 3300053158 | Ga0500627_0023457 | Ga0500627_0023457_780_1085 | 101 |
| 530 | 3300053161 | Ga0500634_0046050 | Ga0500634_0046050_529_834 | 101 |
| 531 | 3300053730 | Ga0500645_016026 | Ga0500645_016026_448_753 | 101 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gy7-assembly1.cif.gz_A | crystallographic structure analysis of urease from jack bean (canavalia ensiformis) at 1.49 a resolution | 0.9063 | 15 | 92 |
| 4goa-assembly1.cif.gz_A | crystal structure of jack bean urease inhibited with fluoride | 0.9063 | 15 | 92 |
| 4g7e-assembly1.cif.gz_B-3 | crystal structure of pigeon pea urease | 0.9046 | 15 | 92 |
| 4g7e-assembly1.cif.gz_A | crystal structure of pigeon pea urease | 0.9037 | 15 | 92 |
| 7kns-assembly1.cif.gz_F | cryo-em structure of jack bean urease | 0.9035 | 15 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3la4A03 | Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit | 0.8366 | 20 | 92 | 2.10.150.10 |
| 1s3tB00 | Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit | 0.8242 | 1 | 92 | 2.10.150.10 |
| 3qgaA02 | Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit | 0.7859 | 1 | 99 | 2.10.150.10 |
| 4z42K00 | Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit | 0.7825 | 4 | 99 | 2.10.150.10 |
| 3qgaA02 | Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit | 0.7641 | 1 | 99 | 2.10.150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0N2Z2-F1-model_v4 | Urease subunit beta | 1.01 | 28 | 77 |
GO:0009039
GO:0035550 GO:0043419 |
| AF-A0A0F7GA08-F1-model_v4 | Urease B (EC 3.5.1.5) | 1.005 | 18 | 83 |
GO:0009039
GO:0035550 GO:0043419 |
| AF-A0A7S0UIM6-F1-model_v4 | urease (EC 3.5.1.5) | 1.004 | 24 | 83 |
GO:0009039
GO:0016151 GO:0035550 GO:0043419 |
| AF-A0A167J1M4-F1-model_v4 | urease (EC 3.5.1.5) | 0.9896 | 15 | 83 |
GO:0009039
GO:0016151 GO:0035550 GO:0043419 |
| AF-A0A0F7GA08-F1-model_v4 | Urease B (EC 3.5.1.5) | 0.9756 | 18 | 83 |
GO:0009039
GO:0035550 GO:0043419 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar