F460084

General Info

Members Datasets Scaffolds Average Seq Length
531 349 490 100

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100570731|Ga0070706_1005707313
Length 112
Sequence MTPGELFTDGPDHILNVGRRTLTLVVQNTADRPIQVGSHYHFAETNAALGFDREAAHGMRLNIASGTAVRFEPGQQRTVELVDYAGERKVFGFRGLVQGGLDEFGQSQKGTT

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
9 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
10 2643221656 Pelomonas sp. Root405 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738541337 Pelomonas sp. BT06 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2818991446 Variovorax sp. 1180 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2842677519 Variovorax sp. R-72495 Isolate Unclassified
21 2842747753 Variovorax sp. R-72060 Isolate Unclassified
22 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
27 2904456579 Variovorax sp. 2002 Isolate Unclassified
28 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
29 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
30 2928037797 Variovorax sp. 1126 Isolate Unclassified
31 2928044640 Variovorax sp. 1128 Isolate Unclassified
32 2928051484 Variovorax sp. 1133 Isolate Unclassified
33 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
34 2928070936 Variovorax gossypii 1167 Isolate Unclassified
35 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
36 2929520902 Variovorax beijingensis 502 Isolate Unclassified
37 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
38 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
39 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
40 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
41 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
42 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
178 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
179 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
180 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
181 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
230 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
236 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
237 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
238 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
239 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
240 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
241 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
244 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
245 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
246 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
247 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
248 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
249 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
250 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
251 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
252 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
253 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
254 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
257 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
275 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
321 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
322 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
323 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
324 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.28
Metatranscriptomes 0
Isolates 7.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0.56
Rhizoplane 3.77
Rhizosphere 68.74
Stem 0
Stem Tuber 0
Unclassified 14.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10074167 3300001979 Bacteria 904
2 JGI25151J46595_10004477 3300003187 Bacteria 7389
3 JGI26145J50221_1031028 3300003371 Bacteria 546
4 Ga0055526_1010511 3300003771 Bacteria 4293
5 Ga0065704_10354616 3300005289 Bacteria 805
6 Ga0065715_10141381 3300005293 Bacteria 1849
7 Ga0070658_10660815 3300005327 Bacteria 907
8 Ga0070676_10009241 3300005328 Bacteria 5327
9 Ga0070676_10094674 3300005328 Bacteria 1835
10 Ga0070676_11527376 3300005328 Bacteria 515
11 Ga0070670_100008956 3300005331 Bacteria 8549
12 Ga0070670_100478685 3300005331 Bacteria 1105
13 Ga0070677_10001953 3300005333 Bacteria 6538
14 Ga0068869_100060232 3300005334 Bacteria 2782
15 Ga0070682_100124410 3300005337 Bacteria 1736
16 Ga0068868_100046006 3300005338 Bacteria 3416
17 Ga0068868_100048575 3300005338 Bacteria 3329
18 Ga0068868_101116220 3300005338 Bacteria 726
19 Ga0068868_101139752 3300005338 Bacteria 719
20 Ga0070661_100004954 3300005344 Bacteria 9170
21 Ga0070668_100292584 3300005347 Bacteria 1363
22 Ga0070669_101418915 3300005353 Bacteria 603
23 Ga0070675_100001865 3300005354 Bacteria 15533
24 Ga0070671_100006074 3300005355 Bacteria 9625
25 Ga0070671_100497419 3300005355 Bacteria 1049
26 Ga0070674_100033811 3300005356 Bacteria 3407
27 Ga0070674_100229005 3300005356 Bacteria 1449
28 Ga0070673_100015136 3300005364 Bacteria 5404
29 Ga0070673_100143932 3300005364 Bacteria 2014
30 Ga0070673_100400203 3300005364 Bacteria 1228
31 Ga0070659_100093809 3300005366 Bacteria 2409
32 Ga0070667_100012870 3300005367 Bacteria 6914
33 Ga0070667_100090149 3300005367 Bacteria 2635
34 Ga0070667_101248653 3300005367 Bacteria 696
35 Ga0070700_100581552 3300005441 Bacteria 874
36 Ga0070708_101933205 3300005445 Bacteria 547
37 Ga0070663_101421954 3300005455 Bacteria 615
38 Ga0070678_100288479 3300005456 Bacteria 1390
39 Ga0070662_101575460 3300005457 Bacteria 567
40 Ga0068867_100008603 3300005459 Bacteria 7206
41 Ga0068867_100062191 3300005459 Bacteria 2773
42 Ga0068867_100369013 3300005459 Bacteria 1203
43 Ga0070685_10486620 3300005466 Bacteria 871
44 Ga0070706_100570731 3300005467 Bacteria 1052
45 Ga0070698_100883678 3300005471 Bacteria 839
46 Ga0068853_100003649 3300005539 Bacteria 11806
47 Ga0070672_100001038 3300005543 Bacteria 16915
48 Ga0070672_100216659 3300005543 Bacteria 1605
49 Ga0070686_100737827 3300005544 Bacteria 789
50 Ga0070665_100012122 3300005548 Bacteria 8698
51 Ga0070665_100826227 3300005548 Bacteria 940
52 Ga0068855_100181559 3300005563 Bacteria 2379
53 Ga0068855_101053977 3300005563 Bacteria 852
54 Ga0070664_100015182 3300005564 Bacteria 6293
55 Ga0070664_100203886 3300005564 Bacteria 1766
56 Ga0070664_100787116 3300005564 Bacteria 889
57 Ga0068852_100287525 3300005616 Bacteria 1587
58 Ga0068859_101341288 3300005617 Bacteria 789
59 Ga0068864_100844992 3300005618 Bacteria 902
60 Ga0068851_10080525 3300005834 Bacteria 1700
61 Ga0068851_10782916 3300005834 Bacteria 592
62 Ga0068870_10132495 3300005840 Bacteria 1450
63 Ga0068863_101061597 3300005841 Bacteria 814
64 Ga0068862_100502876 3300005844 Bacteria 1151
65 Ga0068862_100864850 3300005844 Bacteria 887
66 Ga0075365_11340471 3300006038 Bacteria 503
67 Ga0075363_100090383 3300006048 Bacteria 1684
68 Ga0075363_100161342 3300006048 Bacteria 1269
69 Ga0075362_10009200 3300006177 Bacteria 3809
70 Ga0075362_10088362 3300006177 Bacteria 1436
71 Ga0075362_10215864 3300006177 Bacteria 936
72 Ga0075362_10588995 3300006177 Bacteria 574
73 Ga0075367_10087276 3300006178 Bacteria 1894
74 Ga0075367_10443348 3300006178 Bacteria 823
75 Ga0075369_10077775 3300006186 Bacteria 1468
76 Ga0075369_10341583 3300006186 Bacteria 702
77 Ga0075366_10012808 3300006195 Bacteria 4766
78 Ga0075366_10839411 3300006195 Bacteria 572
79 Ga0097621_100903473 3300006237 Bacteria 823
80 Ga0075370_10001060 3300006353 Bacteria 11451
81 Ga0075370_10004565 3300006353 Bacteria 6745
82 Ga0075370_10275104 3300006353 Bacteria 1000
83 Ga0068865_100314516 3300006881 Bacteria 1257
84 Ga0068865_100939688 3300006881 Bacteria 754
85 Ga0068865_101825411 3300006881 Bacteria 550
86 Ga0097620_101341312 3300006931 Bacteria 789
87 Ga0079104_1086544 3300006946 Bacteria 639
88 Ga0099826_10178794 3300006948 Bacteria 1183
89 Ga0105244_10193198 3300009036 Bacteria 962
90 Ga0105244_10401037 3300009036 Bacteria 631
91 Ga0105240_10002389 3300009093 Bacteria 30277
92 Ga0105240_10469443 3300009093 Bacteria 1404
93 Ga0105240_10999067 3300009093 Bacteria 895
94 Ga0105245_12746268 3300009098 Bacteria 545
95 Ga0105243_10054731 3300009148 Bacteria 3168
96 Ga0105243_10196098 3300009148 Bacteria 1768
97 Ga0105243_11174070 3300009148 Bacteria 779
98 Ga0105242_10318560 3300009176 Bacteria 1425
99 Ga0105237_10010114 3300009545 Bacteria 10055
100 Ga0105237_12537574 3300009545 Bacteria 523
101 Ga0105238_10153210 3300009551 Bacteria 2280
102 Ga0105238_10433231 3300009551 Bacteria 1311
103 Ga0105238_11167957 3300009551 Bacteria 794
104 Ga0105249_11686855 3300009553 Bacteria 706
105 Ga0105239_10000942 3300010375 Bacteria 41042
106 Ga0105239_10891399 3300010375 Bacteria 1021
107 Ga0105246_10458212 3300011119 Bacteria 1073
108 Ga0157347_1016319 3300012502 Bacteria 835
109 Ga0157326_1003093 3300012513 Bacteria 1762
110 Ga0157370_10004419 3300013104 Bacteria 16110
111 Ga0157369_10015097 3300013105 Bacteria 8716
112 Ga0157374_12533313 3300013296 Bacteria 540
113 Ga0163162_10170944 3300013306 Bacteria 2298
114 Ga0157375_10951052 3300013308 Bacteria 1001
115 Ga0157380_10739070 3300014326 Bacteria 994
116 Ga0182008_10208454 3300014497 Bacteria 996
117 Ga0157377_10846163 3300014745 Bacteria 679
118 Ga0157379_10446943 3300014968 Bacteria 1193
119 Ga0157376_10123370 3300014969 Bacteria 2300
120 Ga0157376_12160705 3300014969 Bacteria 595
121 Ga0157376_12882393 3300014969 Bacteria 520
122 Ga0182006_1070612 3300015261 Bacteria 1296
123 Ga0163161_10000099 3300017792 Bacteria 83318
124 Ga0163161_10037425 3300017792 Bacteria 3478
125 Ga0163161_10724669 3300017792 Bacteria 830
126 Ga0163161_11158677 3300017792 Bacteria 667
127 Ga0209759_1056890 3300025256 Bacteria 569
128 Ga0209129_1004728 3300025258 Bacteria 5166
129 Ga0209025_1000174 3300025294 Bacteria 158915
130 Ga0209564_1001971 3300025295 Bacteria 18070
131 Ga0209050_1014278 3300025298 Bacteria 3437
132 Ga0209256_1031123 3300025299 Bacteria 1464
133 Ga0209051_1000099 3300025303 Bacteria 165161
134 Ga0209257_1039876 3300025304 Bacteria 1407
135 Ga0207697_10312911 3300025315 Bacteria 697
136 Ga0207656_10145222 3300025321 Bacteria 1120
137 Ga0207682_10050759 3300025893 Bacteria 1716
138 Ga0207688_10047559 3300025901 Bacteria 2395
139 Ga0207645_10050327 3300025907 Bacteria 2660
140 Ga0207645_10088923 3300025907 Bacteria 1986
141 Ga0207643_10083217 3300025908 Bacteria 1856
142 Ga0207705_10699189 3300025909 Bacteria 788
143 Ga0207695_10008803 3300025913 Bacteria 12574
144 Ga0207695_10386796 3300025913 Bacteria 1284
145 Ga0207671_10011507 3300025914 Bacteria 7190
146 Ga0207671_10186790 3300025914 Bacteria 1615
147 Ga0207671_10527656 3300025914 Bacteria 941
148 Ga0207649_10000421 3300025920 Bacteria 31168
149 Ga0207649_10686346 3300025920 Bacteria 793
150 Ga0207681_11006598 3300025923 Bacteria 699
151 Ga0207694_10015587 3300025924 Bacteria 5732
152 Ga0207650_10000947 3300025925 Bacteria 21819
153 Ga0207650_10082923 3300025925 Bacteria 2435
154 Ga0207650_10136256 3300025925 Bacteria 1926
155 Ga0207650_10923140 3300025925 Bacteria 741
156 Ga0207659_10005197 3300025926 Bacteria 7883
157 Ga0207659_10077358 3300025926 Bacteria 2449
158 Ga0207687_10492960 3300025927 Bacteria 1022
159 Ga0207644_10003548 3300025931 Bacteria 10097
160 Ga0207644_10635592 3300025931 Bacteria 888
161 Ga0207690_10041143 3300025932 Bacteria 3027
162 Ga0207706_11387904 3300025933 Bacteria 577
163 Ga0207686_10409678 3300025934 Bacteria 1035
164 Ga0207709_10016596 3300025935 Bacteria 4095
165 Ga0207709_10028184 3300025935 Bacteria 3245
166 Ga0207709_10814636 3300025935 Bacteria 754
167 Ga0207669_10062096 3300025937 Bacteria 2299
168 Ga0207669_10847937 3300025937 Bacteria 760
169 Ga0207704_10118044 3300025938 Bacteria 1808
170 Ga0207691_10001498 3300025940 Bacteria 23269
171 Ga0207691_10063148 3300025940 Bacteria 3360
172 Ga0207711_10751178 3300025941 Bacteria 909
173 Ga0207689_10191493 3300025942 Bacteria 1687
174 Ga0207679_10000047 3300025945 Bacteria 119891
175 Ga0207679_10633581 3300025945 Bacteria 966
176 Ga0207679_10927237 3300025945 Bacteria 797
177 Ga0207679_11818358 3300025945 Bacteria 556
178 Ga0207667_10142752 3300025949 Bacteria 2465
179 Ga0207667_10210465 3300025949 Bacteria 1993
180 Ga0207651_10004851 3300025960 Bacteria 6850
181 Ga0207651_10007792 3300025960 Bacteria 5727
182 Ga0207651_10209622 3300025960 Bacteria 1567
183 Ga0207712_11240938 3300025961 Bacteria 665
184 Ga0207668_10283085 3300025972 Bacteria 1361
185 Ga0207658_10007097 3300025986 Bacteria 7628
186 Ga0207677_10827195 3300026023 Bacteria 830
187 Ga0207677_10974017 3300026023 Bacteria 768
188 Ga0207639_10485389 3300026041 Bacteria 1127
189 Ga0207639_11353097 3300026041 Bacteria 668
190 Ga0207678_10358236 3300026067 Bacteria 1259
191 Ga0207708_11042026 3300026075 Bacteria 712
192 Ga0207641_10832156 3300026088 Bacteria 914
193 Ga0207648_10032775 3300026089 Bacteria 4585
194 Ga0207648_10285934 3300026089 Bacteria 1475
195 Ga0207648_10420669 3300026089 Bacteria 1213
196 Ga0207676_10008533 3300026095 Bacteria 7285
197 Ga0207674_10432576 3300026116 Bacteria 1272
198 Ga0207674_10595160 3300026116 Bacteria 1068
199 Ga0207683_10177699 3300026121 Bacteria 1930
200 Ga0207683_10186239 3300026121 Bacteria 1883
201 Ga0207683_10902858 3300026121 Bacteria 820
202 Ga0207698_11443285 3300026142 Bacteria 703
203 Ga0209974_10019883 3300027876 Bacteria 2226
204 Ga0207428_10297293 3300027907 Bacteria 1195
205 Ga0268266_10211569 3300028379 Bacteria 1778
206 Ga0268265_10431225 3300028380 Bacteria 1226
207 Ga0307515_10002229 3300028794 Bacteria 42507
208 Ga0307515_10008688 3300028794 Bacteria 19755
209 Ga0307515_10020644 3300028794 Bacteria 11734
210 Ga0307515_10120794 3300028794 Bacteria 2969
211 Ga0307515_10127325 3300028794 Bacteria 2833
212 Ga0307515_10135898 3300028794 Bacteria 2674
213 Ga0307515_10503747 3300028794 Bacteria 821
214 Ga0307512_10085589 3300030522 Bacteria 2233
215 Ga0307512_10129717 3300030522 Bacteria 1586
216 Ga0316177_1098042 3300030731 Bacteria 630
217 Ga0316176_1133948 3300030732 Bacteria 734
218 Ga0314311_1041998 3300030733 Bacteria 1239
219 Ga0316179_1010299 3300030734 Bacteria 1625
220 Ga0316183_1084100 3300030742 Bacteria 1227
221 Ga0316183_1096743 3300030742 Bacteria 1362
222 Ga0316182_1205325 3300030745 Bacteria 925
223 Ga0316182_1249672 3300030745 Bacteria 1203
224 Ga0265316_10962097 3300031344 Bacteria 595
225 Ga0307513_10023805 3300031456 Bacteria 7145
226 Ga0307513_10152160 3300031456 Bacteria 2220
227 Ga0307513_10218223 3300031456 Bacteria 1731
228 Ga0307513_10243711 3300031456 Bacteria 1600
229 Ga0307513_10252571 3300031456 Bacteria 1559
230 Ga0307513_10377914 3300031456 Bacteria 1157
231 Ga0307513_10603569 3300031456 Bacteria 807
232 Ga0307509_10422457 3300031507 Bacteria 1033
233 Ga0307408_100000010 3300031548 Bacteria 420048
234 Ga0307408_100001177 3300031548 Bacteria 19819
235 Ga0307408_100023848 3300031548 Bacteria 4171
236 Ga0307408_100338634 3300031548 Bacteria 1272
237 Ga0307408_100340904 3300031548 Bacteria 1268
238 Ga0307408_100759503 3300031548 Bacteria 876
239 Ga0307508_10001872 3300031616 Bacteria 23175
240 Ga0307508_10004732 3300031616 Bacteria 13171
241 Ga0307514_10001349 3300031649 Bacteria 31116
242 Ga0307514_10130820 3300031649 Bacteria 1728
243 Ga0316576_10184326 3300031727 Bacteria 1574
244 Ga0307516_10000058 3300031730 Bacteria 121424
245 Ga0307516_10001572 3300031730 Bacteria 31438
246 Ga0307516_10017367 3300031730 Bacteria 7504
247 Ga0307405_10028971 3300031731 Bacteria 3231
248 Ga0307405_10189369 3300031731 Bacteria 1484
249 Ga0307405_10322522 3300031731 Bacteria 1180
250 Ga0307405_11265443 3300031731 Bacteria 640
251 Ga0307413_10065467 3300031824 Bacteria 2263
252 Ga0307413_10910796 3300031824 Bacteria 747
253 Ga0307413_10982184 3300031824 Bacteria 723
254 Ga0307410_10004711 3300031852 Bacteria 7098
255 Ga0307406_10000741 3300031901 Bacteria 18289
256 Ga0307406_10009421 3300031901 Bacteria 5475
257 Ga0307406_10648602 3300031901 Bacteria 876
258 Ga0307407_10168511 3300031903 Bacteria 1440
259 Ga0307407_10918065 3300031903 Bacteria 673
260 Ga0307412_10002427 3300031911 Bacteria 10362
261 Ga0307412_10148660 3300031911 Bacteria 1725
262 Ga0307412_10338384 3300031911 Bacteria 1203
263 Ga0307412_10351962 3300031911 Bacteria 1183
264 Ga0307412_10615823 3300031911 Bacteria 921
265 Ga0307412_10766091 3300031911 Bacteria 834
266 Ga0307412_10797861 3300031911 Bacteria 819
267 Ga0307412_10832685 3300031911 Bacteria 803
268 Ga0307412_11643718 3300031911 Bacteria 587
269 Ga0307412_12040027 3300031911 Bacteria 531
270 Ga0307412_12313373 3300031911 Bacteria 502
271 Ga0307409_100030230 3300031995 Bacteria 3889
272 Ga0307409_100564026 3300031995 Bacteria 1120
273 Ga0307416_100015543 3300032002 Bacteria 5261
274 Ga0307416_100055308 3300032002 Bacteria 3195
275 Ga0307416_100476389 3300032002 Bacteria 1307
276 Ga0307416_102951397 3300032002 Bacteria 569
277 Ga0307416_103829067 3300032002 Bacteria 504
278 Ga0307414_10245353 3300032004 Bacteria 1485
279 Ga0307414_10452722 3300032004 Bacteria 1126
280 Ga0307414_11852798 3300032004 Bacteria 563
281 Ga0307411_10001517 3300032005 Bacteria 9564
282 Ga0307411_10207656 3300032005 Bacteria 1509
283 Ga0307411_10229829 3300032005 Bacteria 1445
284 Ga0307411_10303472 3300032005 Bacteria 1281
285 Ga0307411_10552571 3300032005 Bacteria 982
286 Ga0307411_11977192 3300032005 Bacteria 544
287 Ga0307415_100182612 3300032126 Bacteria 1647
288 Ga0307415_100857765 3300032126 Bacteria 834
289 Ga0307415_101536442 3300032126 Bacteria 638
290 Ga0307507_10075671 3300033179 Bacteria 3009
291 Ga0307507_10160163 3300033179 Bacteria 1665
292 Ga0307510_10006135 3300033180 Bacteria 14324
293 Ga0307510_10232538 3300033180 Bacteria 1344
294 Ga0373948_0001520 3300034817 Bacteria 3241
295 Ga0373959_0080550 3300034820 Bacteria 749
296 Ga0373934_0440794 3300035086 Bacteria 546
297 Ga0373944_0182125 3300035089 Bacteria 754
298 Ga0373951_0009036 3300035091 Bacteria 2247
299 Ga0373951_0069480 3300035091 Bacteria 895
300 Ga0373923_0165716 3300035111 Bacteria 1010
301 Ga0373923_0365307 3300035111 Bacteria 691
302 Ga0373932_0025075 3300035112 Bacteria 1611
303 Ga0373936_0070094 3300035113 Bacteria 1444
304 Ga0373939_0000036 3300035114 Bacteria 48825
305 Ga0373945_0094123 3300035116 Bacteria 1164
306 Ga0373954_0242100 3300035118 Bacteria 888
307 Ga0373954_0563481 3300035118 Bacteria 565
308 Ga0373956_0306666 3300035119 Bacteria 756
309 Ga0373960_0021758 3300035121 Bacteria 1709
310 Ga0373943_0042479 3300035170 Bacteria 2204
311 Ga0373943_0301170 3300035170 Bacteria 910
312 Ga0373955_0016521 3300035172 Bacteria 3635
313 Ga0373955_0041212 3300035172 Bacteria 2474
314 Ga0373961_0236665 3300035241 Bacteria 656
315 Ga0373924_0073943 3300035410 Bacteria 1441
316 Ga0373931_0005162 3300035691 Bacteria 6019
317 Ga0373931_0019544 3300035691 Bacteria 3383
318 Ga0373931_0197628 3300035691 Bacteria 1200
319 Ga0373935_0281752 3300035692 Bacteria 1170
320 Ga0373933_0661131 3300035724 Bacteria 687
321 Ga0373947_0042936 3300035725 Bacteria 2699
322 Ga0373937_0394749 3300036401 Bacteria 1312
323 Ga0395905_0000600 3300037471 Bacteria 48145
324 Ga0395905_0046576 3300037471 Bacteria 4066
325 Ga0439436_0028989 3300041404 Bacteria 1613
326 Ga0439465_0032873 3300041413 Bacteria 1657
327 Ga0451789_0151812 3300041443 Bacteria 1331
328 Ga0451789_0544890 3300041443 Bacteria 567
329 Ga0451797_0677519 3300041453 Bacteria 689
330 Ga0451797_1429463 3300041453 Bacteria 841
331 Ga0451800_0842469 3300041459 Bacteria 738
332 Ga0451800_1026996 3300041459 Bacteria 541
333 Ga0451800_1401263 3300041459 Bacteria 554
334 Ga0451802_2141157 3300041460 Bacteria 611
335 Ga0451804_1092860 3300041463 Bacteria 505
336 Ga0451807_0521282 3300041486 Bacteria 765
337 Ga0451835_0332945 3300041492 Bacteria 578
338 Ga0451839_1391327 3300041496 Bacteria 835
339 Ga0451841_0202857 3300041498 Bacteria 519
340 Ga0451845_0502849 3300041501 Bacteria 1626
341 Ga0451847_0777924 3300041503 Bacteria 948
342 Ga0451849_0735763 3300041505 Bacteria 569
343 Ga0451851_0055416 3300041507 Bacteria 1079
344 Ga0439433_0037076 3300041999 Bacteria 1128
345 Ga0439442_003576 3300042002 Bacteria 3075
346 Ga0439452_089718 3300042010 Bacteria 665
347 Ga0450919_016249 3300042121 Bacteria 840
348 Ga0450923_124371 3300042125 Bacteria 610
349 Ga0450898_024480 3300042134 Bacteria 1079
350 Ga0450899_008107 3300042135 Bacteria 1149
351 Ga0450889_021351 3300042144 Bacteria 721
352 Ga0450906_006856 3300042145 Bacteria 2278
353 Ga0450910_003954 3300042147 Bacteria 1991
354 Ga0439446_0238372 3300042156 Bacteria 624
355 Ga0450908_004610 3300042184 Bacteria 2654
356 Ga0450909_017454 3300042185 Bacteria 1063
357 Ga0439434_0025270 3300042435 Bacteria 1792
358 Ga0450918_006736 3300042531 Bacteria 2044
359 Ga0450893_0014508 3300042532 Bacteria 1322
360 Ga0451577_0022469 3300042876 Bacteria 5759
361 Ga0453684_2386388 3300044712 Bacteria 524
362 Ga0466957_0969017 3300044842 Bacteria 610
363 Ga0451576_0098993 3300045051 Bacteria 3033
364 Ga0495627_019484 3300046453 Bacteria 2274
365 Ga0495592_0629263 3300046454 Bacteria 652
366 Ga0495629_0049614 3300046459 Bacteria 2941
367 Ga0495638_0070970 3300046460 Bacteria 2131
368 Ga0495650_0005014 3300046471 Bacteria 8800
369 Ga0495580_0060253 3300046472 Bacteria 2667
370 Ga0495582_0046755 3300046473 Bacteria 2384
371 Ga0495639_0420916 3300046475 Bacteria 676
372 Ga0495662_0180964 3300046476 Bacteria 1039
373 Ga0495606_0373261 3300046507 Bacteria 750
374 Ga0495610_0036371 3300046512 Bacteria 2517
375 Ga0495610_0039514 3300046512 Bacteria 2385
376 Ga0495616_0038655 3300046513 Bacteria 2449
377 Ga0495620_0033235 3300046515 Bacteria 2343
378 Ga0495628_0995660 3300046516 Bacteria 577
379 Ga0495630_1380714 3300046517 Bacteria 530
380 Ga0495631_0000073 3300046518 Bacteria 64358
381 Ga0495632_0066357 3300046519 Bacteria 1741
382 Ga0495637_0098860 3300046520 Bacteria 1142
383 Ga0495643_0014989 3300046522 Bacteria 4595
384 Ga0495648_0407196 3300046524 Bacteria 606
385 Ga0495652_0645632 3300046529 Bacteria 717
386 Ga0495654_0001245 3300046530 Bacteria 17990
387 Ga0495654_0107228 3300046530 Bacteria 1278
388 Ga0495654_0208204 3300046530 Bacteria 833
389 Ga0495665_0631889 3300046531 Bacteria 534
390 Ga0495640_0781875 3300046533 Bacteria 570
391 Ga0495597_0000024 3300046542 Bacteria 143948
392 Ga0495645_0425310 3300046543 Bacteria 842
393 Ga0495633_0466649 3300046558 Bacteria 570
394 Ga0495667_0198405 3300046559 Bacteria 1285
395 Ga0495668_0081141 3300046616 Bacteria 1780
396 Ga0495625_0001217 3300046660 Bacteria 32653
397 Ga0495625_0086085 3300046660 Bacteria 2180
398 Ga0495625_0407396 3300046660 Bacteria 848
399 Ga0495659_0136502 3300046664 Bacteria 976
400 Ga0495661_0338713 3300046665 Bacteria 743
401 Ga0495588_0012491 3300046674 Bacteria 4016
402 Ga0495588_0457348 3300046674 Bacteria 669
403 Ga0495657_0890757 3300046675 Bacteria 506
404 Ga0495647_0226645 3300046681 Bacteria 826
405 Ga0495658_0235096 3300046683 Bacteria 1150
406 Ga0495670_0346377 3300046691 Bacteria 799
407 Ga0495671_0089351 3300046692 Bacteria 1508
408 Ga0495671_0401977 3300046692 Bacteria 656
409 Ga0495600_0482197 3300046809 Bacteria 764
410 Ga0495660_0322188 3300046810 Bacteria 694
411 Ga0495676_0091783 3300047321 Bacteria 2268
412 Ga0495677_0135520 3300047445 Bacteria 944
413 Ga0495684_0193819 3300047471 Bacteria 1501
414 Ga0495684_0274416 3300047471 Bacteria 1219
415 Ga0495686_0213907 3300047472 Bacteria 1100
416 Ga0496101_0055821 3300048904 Bacteria 2854
417 Ga0496101_1181839 3300048904 Bacteria 600
418 Ga0496106_0033566 3300048909 Bacteria 3829
419 Ga0496113_0139336 3300048916 Bacteria 1908
420 Ga0496113_0406049 3300048916 Bacteria 1094
421 Ga0496114_0693241 3300048917 Bacteria 894
422 Ga0496115_0749314 3300048918 Bacteria 764
423 Ga0496116_0260160 3300048919 Bacteria 856
424 Ga0496117_0055146 3300048920 Bacteria 2779
425 Ga0496117_0069400 3300048920 Bacteria 2373
426 Ga0496117_0598014 3300048920 Bacteria 516
427 Ga0496118_0233444 3300048921 Bacteria 1059
428 Ga0496120_0459678 3300048923 Bacteria 553
429 Ga0496121_0094048 3300048924 Bacteria 2332
430 Ga0496121_0114365 3300048924 Bacteria 2051
431 Ga0496122_0103836 3300048925 Bacteria 1890
432 Ga0496122_0239281 3300048925 Bacteria 1025
433 Ga0496122_0510133 3300048925 Bacteria 582
434 Ga0496123_0104026 3300048926 Bacteria 1643
435 Ga0496123_0147661 3300048926 Bacteria 1274
436 Ga0496123_0384217 3300048926 Bacteria 643
437 Ga0496124_0261471 3300048927 Bacteria 1273
438 Ga0496125_0215883 3300048928 Bacteria 1241
439 Ga0496125_0397224 3300048928 Bacteria 807
440 Ga0501227_032723 3300049665 Bacteria 1256
441 Ga0501249_080672 3300049679 Bacteria 765
442 Ga0501259_044051 3300049688 Bacteria 887
443 Ga0501259_111756 3300049688 Bacteria 640
444 Ga0501225_0009191 3300049705 Bacteria 2822
445 Ga0501262_002190 3300049759 Bacteria 2209
446 Ga0501262_021346 3300049759 Bacteria 889
447 nmdc:mga03683_62534_c1 3300050489 Bacteria 1577
448 nmdc:mga03n38_325535_c1 3300050490 Bacteria 831
449 nmdc:mga03n38_374779_c1 3300050490 Bacteria 779
450 nmdc:mga03n38_390956_c1 3300050490 Bacteria 764
451 nmdc:mga0yw44_1121696_c1 3300050492 Bacteria 531
452 nmdc:mga0k408_115836_c1 3300050493 Bacteria 1586
453 nmdc:mga0k408_132846_c1 3300050493 Bacteria 1478
454 nmdc:mga0k408_666338_c1 3300050493 Bacteria 611
455 nmdc:mga0k408_703166_c1 3300050493 Bacteria 592
456 nmdc:mga0k408_742429_c1 3300050493 Bacteria 574
457 nmdc:mga06z11_115416_c1 3300050494 Bacteria 1492
458 nmdc:mga06z11_331667_c1 3300050494 Bacteria 909
459 nmdc:mga06z11_476152_c1 3300050494 Bacteria 755
460 nmdc:mga07m45_378022_c1 3300050496 Bacteria 823
461 nmdc:mga07m45_39111_c1 3300050496 Bacteria 2650
462 nmdc:mga07m45_407284_c1 3300050496 Bacteria 789
463 nmdc:mga07m45_47453_c1 3300050496 Bacteria 2415
464 nmdc:mga07m45_526592_c1 3300050496 Bacteria 684
465 nmdc:mga0sz30_100898_c1 3300050516 Bacteria 1261
466 Ga0495601_0094278 3300053077 Bacteria 1929
467 Ga0500610_0000329 3300053079 Bacteria 14347
468 Ga0500610_0047951 3300053079 Bacteria 2220
469 Ga0495595_0086303 3300053084 Bacteria 1501
470 Ga0495619_0492827 3300053085 Bacteria 843
471 Ga0495619_0627224 3300053085 Bacteria 734
472 Ga0500578_0254732 3300053086 Bacteria 1056
473 Ga0500644_0031465 3300053088 Bacteria 1687
474 Ga0500651_0634216 3300053093 Bacteria 577
475 Ga0500641_0131306 3300053096 Bacteria 1081
476 Ga0500562_011371 3300053108 Bacteria 2260
477 Ga0500562_137955 3300053108 Bacteria 665
478 Ga0500593_010835 3300053117 Bacteria 3835
479 Ga0500593_030693 3300053117 Bacteria 2401
480 Ga0500594_0004824 3300053118 Bacteria 2980
481 Ga0500607_020625 3300053121 Bacteria 3720
482 Ga0500607_049832 3300053121 Bacteria 2234
483 Ga0500658_0001544 3300053134 Bacteria 9206
484 Ga0500658_0048977 3300053134 Bacteria 1720
485 Ga0500568_0023470 3300053139 Bacteria 2623
486 Ga0500616_0155352 3300053153 Bacteria 1054
487 Ga0500616_0289505 3300053153 Bacteria 684
488 Ga0500627_0023457 3300053158 Bacteria 2515
489 Ga0500634_0046050 3300053161 Bacteria 2358
490 Ga0500645_016026 3300053730 Bacteria 2366

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10020644 Ga0307515_100206448 91
2 3300037471 Ga0395905_0046576 Ga0395905_0046576_2345_2650 91
3 3300041459 Ga0451800_1026996 Ga0451800_1026996_177_521 91
4 3300005293 Ga0065715_10141381 Ga0065715_101413813 92
5 3300005328 Ga0070676_10094674 Ga0070676_100946743 92
6 3300005331 Ga0070670_100008956 Ga0070670_1000089561 92
7 3300005333 Ga0070677_10001953 Ga0070677_100019538 92
8 3300005338 Ga0068868_100046006 Ga0068868_1000460062 92
9 3300005347 Ga0070668_100292584 Ga0070668_1002925842 92
10 3300005354 Ga0070675_100001865 Ga0070675_10000186515 92
11 3300005355 Ga0070671_100006074 Ga0070671_10000607410 92
12 3300005356 Ga0070674_100229005 Ga0070674_1002290052 92
13 3300005364 Ga0070673_100015136 Ga0070673_1000151366 92
14 3300005367 Ga0070667_100090149 Ga0070667_1000901493 92
15 3300005441 Ga0070700_100581552 Ga0070700_1005815522 92
16 3300005455 Ga0070663_101421954 Ga0070663_1014219541 92
17 3300005456 Ga0070678_100288479 Ga0070678_1002884792 92
18 3300005459 Ga0068867_100008603 Ga0068867_1000086033 92
19 3300005466 Ga0070685_10486620 Ga0070685_104866203 92
20 3300005543 Ga0070672_100001038 Ga0070672_1000010383 92
21 3300005544 Ga0070686_100737827 Ga0070686_1007378272 92
22 3300005564 Ga0070664_100787116 Ga0070664_1007871162 92
23 3300005618 Ga0068864_100844992 Ga0068864_1008449922 92
24 3300005834 Ga0068851_10080525 Ga0068851_100805252 92
25 3300005840 Ga0068870_10132495 Ga0068870_101324952 92
26 3300005841 Ga0068863_101061597 Ga0068863_1010615972 92
27 3300006195 Ga0075366_10839411 Ga0075366_108394112 92
28 3300006237 Ga0097621_100903473 Ga0097621_1009034732 92
29 3300006881 Ga0068865_101825411 Ga0068865_1018254111 92
30 3300013306 Ga0163162_10170944 Ga0163162_101709443 92
31 3300014326 Ga0157380_10739070 Ga0157380_107390703 92
32 3300014969 Ga0157376_10123370 Ga0157376_101233702 92
33 3300017792 Ga0163161_10037425 Ga0163161_100374253 92
34 3300025321 Ga0207656_10145222 Ga0207656_101452222 92
35 3300025893 Ga0207682_10050759 Ga0207682_100507592 92
36 3300025901 Ga0207688_10047559 Ga0207688_100475592 92
37 3300025907 Ga0207645_10088923 Ga0207645_100889233 92
38 3300025908 Ga0207643_10083217 Ga0207643_100832173 92
39 3300025925 Ga0207650_10000947 Ga0207650_100009474 92
40 3300025926 Ga0207659_10005197 Ga0207659_100051976 92
41 3300025931 Ga0207644_10003548 Ga0207644_1000354810 92
42 3300025937 Ga0207669_10062096 Ga0207669_100620962 92
43 3300025940 Ga0207691_10001498 Ga0207691_1000149818 92
44 3300025945 Ga0207679_10633581 Ga0207679_106335812 92
45 3300025960 Ga0207651_10007792 Ga0207651_100077923 92
46 3300026075 Ga0207708_11042026 Ga0207708_110420261 92
47 3300026088 Ga0207641_10832156 Ga0207641_108321562 92
48 3300026089 Ga0207648_10032775 Ga0207648_100327752 92
49 3300026095 Ga0207676_10008533 Ga0207676_100085338 92
50 3300026121 Ga0207683_10186239 Ga0207683_101862393 92
51 3300050493 nmdc:mga0k408_666338_c1 nmdc:mga0k408_666338_c1_172_477 92
52 3300050496 nmdc:mga07m45_407284_c1 nmdc:mga07m45_407284_c1_373_678 92
53 3300009093 Ga0105240_10002389 Ga0105240_100023894 95
54 3300009545 Ga0105237_10010114 Ga0105237_100101144 95
55 3300009551 Ga0105238_10433231 Ga0105238_104332312 95
56 3300010375 Ga0105239_10000942 Ga0105239_100009424 95
57 iso_pu_bacteria 2585428062 2587759984 97
58 iso_pu_bacteria 2599185214 2599623439 97
59 iso_pu_bacteria 2599185226 2599675343 97
60 iso_pu_bacteria 2599185227 2599681044 97
61 iso_pu_bacteria 2599185229 2599693059 97
62 iso_pu_bacteria 2643221585 2643933556 97
63 iso_pu_bacteria 2643221628 2644161808 97
64 iso_pu_bacteria 2643221639 2644222045 97
65 iso_pu_bacteria 2643221646 2644257174 97
66 iso_pu_bacteria 2643221656 2644314805 97
67 iso_pu_bacteria 2643221672 2644399316 97
68 iso_pu_bacteria 2738541277 2738718158 97
69 iso_pu_bacteria 2738541307 2738880457 97
70 iso_pu_bacteria 2738541337 2739055269 97
71 iso_pu_bacteria 2738543013 2739247999 97
72 iso_pu_bacteria 2738543019 2739281345 97
73 iso_pu_bacteria 2818991446 2819600615 97
74 iso_pu_bacteria 2831265667 2831267659 97
75 iso_pu_bacteria 2838054893 2838061136 97
76 iso_pu_bacteria 2842677519 2842679789 97
77 iso_pu_bacteria 2842747753 2842749588 97
78 iso_pu_bacteria 2885192300 2885193129 97
79 iso_pu_bacteria 2885198086 2885198871 97
80 iso_pu_bacteria 2885211737 2885211749 97
81 iso_pu_bacteria 2899924645 2899928238 97
82 iso_pu_bacteria 2904449895 2904452478 97
83 iso_pu_bacteria 2904456579 2904460923 97
84 iso_pu_bacteria 2904541872 2904545173 97
85 iso_pu_bacteria 2919462493 2919463887 97
86 iso_pu_bacteria 2928037797 2928041189 97
87 iso_pu_bacteria 2928044640 2928048031 97
88 iso_pu_bacteria 2928051484 2928055872 97
89 iso_pu_bacteria 2928064002 2928066647 97
90 iso_pu_bacteria 2928070936 2928077200 97
91 iso_pu_bacteria 2928084124 2928087501 97
92 iso_pu_bacteria 2929520902 2929522906 97
93 iso_pu_bacteria 2945909444 2945910047 97
94 iso_pu_bacteria 2945945610 2945946026 97
95 iso_pu_bacteria 2945972063 2945975622 97
96 iso_pu_bacteria 2945984333 2945987937 97
97 iso_pu_bacteria 2954767861 2954768934 97
98 3300001979 JGI24740J21852_10074167 JGI24740J21852_100741672 101
99 3300003187 JGI25151J46595_10004477 JGI25151J46595_100044775 101
100 3300003371 JGI26145J50221_1031028 JGI26145J50221_10310281 101
101 3300003771 Ga0055526_1010511 Ga0055526_10105112 101
102 3300005289 Ga0065704_10354616 Ga0065704_103546161 101
103 3300005327 Ga0070658_10660815 Ga0070658_106608153 101
104 3300005328 Ga0070676_10009241 Ga0070676_100092414 101
105 3300005328 Ga0070676_11527376 Ga0070676_115273762 101
106 3300005331 Ga0070670_100478685 Ga0070670_1004786853 101
107 3300005334 Ga0068869_100060232 Ga0068869_1000602323 101
108 3300005337 Ga0070682_100124410 Ga0070682_1001244103 101
109 3300005338 Ga0068868_100048575 Ga0068868_1000485753 101
110 3300005338 Ga0068868_101116220 Ga0068868_1011162203 101
111 3300005338 Ga0068868_101139752 Ga0068868_1011397523 101
112 3300005344 Ga0070661_100004954 Ga0070661_1000049545 101
113 3300005353 Ga0070669_101418915 Ga0070669_1014189151 101
114 3300005355 Ga0070671_100497419 Ga0070671_1004974191 101
115 3300005356 Ga0070674_100033811 Ga0070674_1000338113 101
116 3300005364 Ga0070673_100143932 Ga0070673_1001439323 101
117 3300005364 Ga0070673_100400203 Ga0070673_1004002032 101
118 3300005366 Ga0070659_100093809 Ga0070659_1000938092 101
119 3300005367 Ga0070667_100012870 Ga0070667_1000128707 101
120 3300005367 Ga0070667_101248653 Ga0070667_1012486531 101
121 3300005445 Ga0070708_101933205 Ga0070708_1019332051 101
122 3300005457 Ga0070662_101575460 Ga0070662_1015754602 101
123 3300005459 Ga0068867_100062191 Ga0068867_1000621912 101
124 3300005459 Ga0068867_100369013 Ga0068867_1003690132 101
125 3300005467 Ga0070706_100570731 Ga0070706_1005707313 101
126 3300005471 Ga0070698_100883678 Ga0070698_1008836782 101
127 3300005539 Ga0068853_100003649 Ga0068853_1000036498 101
128 3300005543 Ga0070672_100216659 Ga0070672_1002166593 101
129 3300005548 Ga0070665_100012122 Ga0070665_1000121222 101
130 3300005548 Ga0070665_100826227 Ga0070665_1008262272 101
131 3300005563 Ga0068855_100181559 Ga0068855_1001815592 101
132 3300005563 Ga0068855_101053977 Ga0068855_1010539771 101
133 3300005564 Ga0070664_100015182 Ga0070664_1000151824 101
134 3300005564 Ga0070664_100203886 Ga0070664_1002038862 101
135 3300005616 Ga0068852_100287525 Ga0068852_1002875252 101
136 3300005617 Ga0068859_101341288 Ga0068859_1013412882 101
137 3300005834 Ga0068851_10782916 Ga0068851_107829161 101
138 3300005844 Ga0068862_100502876 Ga0068862_1005028762 101
139 3300005844 Ga0068862_100864850 Ga0068862_1008648502 101
140 3300006038 Ga0075365_11340471 Ga0075365_113404712 101
141 3300006048 Ga0075363_100090383 Ga0075363_1000903834 101
142 3300006048 Ga0075363_100161342 Ga0075363_1001613422 101
143 3300006177 Ga0075362_10009200 Ga0075362_100092003 101
144 3300006177 Ga0075362_10088362 Ga0075362_100883622 101
145 3300006177 Ga0075362_10215864 Ga0075362_102158642 101
146 3300006177 Ga0075362_10588995 Ga0075362_105889952 101
147 3300006178 Ga0075367_10087276 Ga0075367_100872762 101
148 3300006178 Ga0075367_10443348 Ga0075367_104433482 101
149 3300006186 Ga0075369_10077775 Ga0075369_100777751 101
150 3300006186 Ga0075369_10341583 Ga0075369_103415832 101
151 3300006195 Ga0075366_10012808 Ga0075366_100128084 101
152 3300006353 Ga0075370_10001060 Ga0075370_100010605 101
153 3300006353 Ga0075370_10004565 Ga0075370_100045658 101
154 3300006353 Ga0075370_10275104 Ga0075370_102751042 101
155 3300006881 Ga0068865_100314516 Ga0068865_1003145162 101
156 3300006881 Ga0068865_100939688 Ga0068865_1009396881 101
157 3300006931 Ga0097620_101341312 Ga0097620_1013413122 101
158 3300006946 Ga0079104_1086544 Ga0079104_10865442 101
159 3300006948 Ga0099826_10178794 Ga0099826_101787942 101
160 3300009036 Ga0105244_10193198 Ga0105244_101931982 101
161 3300009036 Ga0105244_10401037 Ga0105244_104010372 101
162 3300009093 Ga0105240_10469443 Ga0105240_104694432 101
163 3300009093 Ga0105240_10999067 Ga0105240_109990672 101
164 3300009098 Ga0105245_12746268 Ga0105245_127462682 101
165 3300009148 Ga0105243_10054731 Ga0105243_100547312 101
166 3300009148 Ga0105243_10196098 Ga0105243_101960983 101
167 3300009148 Ga0105243_11174070 Ga0105243_111740702 101
168 3300009176 Ga0105242_10318560 Ga0105242_103185602 101
169 3300009545 Ga0105237_12537574 Ga0105237_125375742 101
170 3300009551 Ga0105238_10153210 Ga0105238_101532104 101
171 3300009551 Ga0105238_11167957 Ga0105238_111679572 101
172 3300009553 Ga0105249_11686855 Ga0105249_116868553 101
173 3300010375 Ga0105239_10891399 Ga0105239_108913992 101
174 3300011119 Ga0105246_10458212 Ga0105246_104582122 101
175 3300012502 Ga0157347_1016319 Ga0157347_10163192 101
176 3300012513 Ga0157326_1003093 Ga0157326_10030933 101
177 3300013104 Ga0157370_10004419 Ga0157370_1000441916 101
178 3300013105 Ga0157369_10015097 Ga0157369_100150977 101
179 3300013296 Ga0157374_12533313 Ga0157374_125333131 101
180 3300013308 Ga0157375_10951052 Ga0157375_109510521 101
181 3300014497 Ga0182008_10208454 Ga0182008_102084542 101
182 3300014745 Ga0157377_10846163 Ga0157377_108461632 101
183 3300014968 Ga0157379_10446943 Ga0157379_104469432 101
184 3300014969 Ga0157376_12160705 Ga0157376_121607051 101
185 3300014969 Ga0157376_12882393 Ga0157376_128823932 101
186 3300015261 Ga0182006_1070612 Ga0182006_10706122 101
187 3300017792 Ga0163161_10000099 Ga0163161_1000009954 101
188 3300017792 Ga0163161_10724669 Ga0163161_107246692 101
189 3300017792 Ga0163161_11158677 Ga0163161_111586772 101
190 3300025256 Ga0209759_1056890 Ga0209759_10568902 101
191 3300025258 Ga0209129_1004728 Ga0209129_10047282 101
192 3300025294 Ga0209025_1000174 Ga0209025_100017487 101
193 3300025295 Ga0209564_1001971 Ga0209564_100197116 101
194 3300025298 Ga0209050_1014278 Ga0209050_10142784 101
195 3300025299 Ga0209256_1031123 Ga0209256_10311233 101
196 3300025303 Ga0209051_1000099 Ga0209051_100009928 101
197 3300025304 Ga0209257_1039876 Ga0209257_10398762 101
198 3300025315 Ga0207697_10312911 Ga0207697_103129112 101
199 3300025907 Ga0207645_10050327 Ga0207645_100503273 101
200 3300025909 Ga0207705_10699189 Ga0207705_106991892 101
201 3300025913 Ga0207695_10008803 Ga0207695_1000880311 101
202 3300025913 Ga0207695_10386796 Ga0207695_103867962 101
203 3300025914 Ga0207671_10011507 Ga0207671_100115074 101
204 3300025914 Ga0207671_10186790 Ga0207671_101867902 101
205 3300025914 Ga0207671_10527656 Ga0207671_105276562 101
206 3300025920 Ga0207649_10000421 Ga0207649_100004215 101
207 3300025920 Ga0207649_10686346 Ga0207649_106863462 101
208 3300025923 Ga0207681_11006598 Ga0207681_110065982 101
209 3300025924 Ga0207694_10015587 Ga0207694_100155872 101
210 3300025925 Ga0207650_10082923 Ga0207650_100829235 101
211 3300025925 Ga0207650_10136256 Ga0207650_101362562 101
212 3300025925 Ga0207650_10923140 Ga0207650_109231402 101
213 3300025926 Ga0207659_10077358 Ga0207659_100773582 101
214 3300025927 Ga0207687_10492960 Ga0207687_104929603 101
215 3300025931 Ga0207644_10635592 Ga0207644_106355923 101
216 3300025932 Ga0207690_10041143 Ga0207690_100411433 101
217 3300025933 Ga0207706_11387904 Ga0207706_113879042 101
218 3300025934 Ga0207686_10409678 Ga0207686_104096782 101
219 3300025935 Ga0207709_10016596 Ga0207709_100165963 101
220 3300025935 Ga0207709_10028184 Ga0207709_100281845 101
221 3300025935 Ga0207709_10814636 Ga0207709_108146361 101
222 3300025937 Ga0207669_10847937 Ga0207669_108479372 101
223 3300025938 Ga0207704_10118044 Ga0207704_101180443 101
224 3300025940 Ga0207691_10063148 Ga0207691_100631481 101
225 3300025941 Ga0207711_10751178 Ga0207711_107511782 101
226 3300025942 Ga0207689_10191493 Ga0207689_101914933 101
227 3300025945 Ga0207679_10000047 Ga0207679_100000474 101
228 3300025945 Ga0207679_10927237 Ga0207679_109272372 101
229 3300025945 Ga0207679_11818358 Ga0207679_118183582 101
230 3300025949 Ga0207667_10142752 Ga0207667_101427522 101
231 3300025949 Ga0207667_10210465 Ga0207667_102104652 101
232 3300025960 Ga0207651_10004851 Ga0207651_100048516 101
233 3300025960 Ga0207651_10209622 Ga0207651_102096223 101
234 3300025961 Ga0207712_11240938 Ga0207712_112409383 101
235 3300025972 Ga0207668_10283085 Ga0207668_102830852 101
236 3300025986 Ga0207658_10007097 Ga0207658_100070977 101
237 3300026023 Ga0207677_10827195 Ga0207677_108271952 101
238 3300026023 Ga0207677_10974017 Ga0207677_109740173 101
239 3300026041 Ga0207639_10485389 Ga0207639_104853892 101
240 3300026041 Ga0207639_11353097 Ga0207639_113530971 101
241 3300026067 Ga0207678_10358236 Ga0207678_103582362 101
242 3300026089 Ga0207648_10285934 Ga0207648_102859342 101
243 3300026089 Ga0207648_10420669 Ga0207648_104206692 101
244 3300026116 Ga0207674_10432576 Ga0207674_104325763 101
245 3300026116 Ga0207674_10595160 Ga0207674_105951602 101
246 3300026121 Ga0207683_10177699 Ga0207683_101776992 101
247 3300026121 Ga0207683_10902858 Ga0207683_109028582 101
248 3300026142 Ga0207698_11443285 Ga0207698_114432852 101
249 3300027876 Ga0209974_10019883 Ga0209974_100198833 101
250 3300027907 Ga0207428_10297293 Ga0207428_102972932 101
251 3300028379 Ga0268266_10211569 Ga0268266_102115693 101
252 3300028380 Ga0268265_10431225 Ga0268265_104312252 101
253 3300028794 Ga0307515_10002229 Ga0307515_1000222914 101
254 3300028794 Ga0307515_10008688 Ga0307515_1000868816 101
255 3300028794 Ga0307515_10120794 Ga0307515_101207941 101
256 3300028794 Ga0307515_10127325 Ga0307515_101273251 101
257 3300028794 Ga0307515_10135898 Ga0307515_101358982 101
258 3300028794 Ga0307515_10503747 Ga0307515_105037471 101
259 3300030522 Ga0307512_10085589 Ga0307512_100855893 101
260 3300030522 Ga0307512_10129717 Ga0307512_101297172 101
261 3300030731 Ga0316177_1098042 Ga0316177_10980421 101
262 3300030732 Ga0316176_1133948 Ga0316176_11339482 101
263 3300030733 Ga0314311_1041998 Ga0314311_10419982 101
264 3300030734 Ga0316179_1010299 Ga0316179_10102992 101
265 3300030742 Ga0316183_1084100 Ga0316183_10841002 101
266 3300030742 Ga0316183_1096743 Ga0316183_10967432 101
267 3300030745 Ga0316182_1205325 Ga0316182_12053252 101
268 3300030745 Ga0316182_1249672 Ga0316182_12496722 101
269 3300031344 Ga0265316_10962097 Ga0265316_109620972 101
270 3300031456 Ga0307513_10023805 Ga0307513_100238055 101
271 3300031456 Ga0307513_10152160 Ga0307513_101521602 101
272 3300031456 Ga0307513_10218223 Ga0307513_102182234 101
273 3300031456 Ga0307513_10243711 Ga0307513_102437112 101
274 3300031456 Ga0307513_10252571 Ga0307513_102525712 101
275 3300031456 Ga0307513_10377914 Ga0307513_103779142 101
276 3300031456 Ga0307513_10603569 Ga0307513_106035691 101
277 3300031507 Ga0307509_10422457 Ga0307509_104224572 101
278 3300031548 Ga0307408_100000010 Ga0307408_100000010168 101
279 3300031548 Ga0307408_100001177 Ga0307408_1000011773 101
280 3300031548 Ga0307408_100023848 Ga0307408_1000238483 101
281 3300031548 Ga0307408_100338634 Ga0307408_1003386342 101
282 3300031548 Ga0307408_100340904 Ga0307408_1003409042 101
283 3300031548 Ga0307408_100759503 Ga0307408_1007595032 101
284 3300031616 Ga0307508_10001872 Ga0307508_1000187215 101
285 3300031616 Ga0307508_10004732 Ga0307508_1000473211 101
286 3300031649 Ga0307514_10001349 Ga0307514_1000134919 101
287 3300031649 Ga0307514_10130820 Ga0307514_101308202 101
288 3300031727 Ga0316576_10184326 Ga0316576_101843262 101
289 3300031730 Ga0307516_10000058 Ga0307516_100000587 101
290 3300031730 Ga0307516_10001572 Ga0307516_1000157210 101
291 3300031730 Ga0307516_10017367 Ga0307516_100173675 101
292 3300031731 Ga0307405_10028971 Ga0307405_100289712 101
293 3300031731 Ga0307405_10189369 Ga0307405_101893692 101
294 3300031731 Ga0307405_10322522 Ga0307405_103225222 101
295 3300031731 Ga0307405_11265443 Ga0307405_112654432 101
296 3300031824 Ga0307413_10065467 Ga0307413_100654673 101
297 3300031824 Ga0307413_10910796 Ga0307413_109107962 101
298 3300031824 Ga0307413_10982184 Ga0307413_109821842 101
299 3300031852 Ga0307410_10004711 Ga0307410_100047117 101
300 3300031901 Ga0307406_10000741 Ga0307406_1000074114 101
301 3300031901 Ga0307406_10009421 Ga0307406_100094212 101
302 3300031901 Ga0307406_10648602 Ga0307406_106486022 101
303 3300031903 Ga0307407_10168511 Ga0307407_101685112 101
304 3300031903 Ga0307407_10918065 Ga0307407_109180652 101
305 3300031911 Ga0307412_10002427 Ga0307412_100024272 101
306 3300031911 Ga0307412_10148660 Ga0307412_101486603 101
307 3300031911 Ga0307412_10338384 Ga0307412_103383842 101
308 3300031911 Ga0307412_10351962 Ga0307412_103519621 101
309 3300031911 Ga0307412_10615823 Ga0307412_106158231 101
310 3300031911 Ga0307412_10766091 Ga0307412_107660912 101
311 3300031911 Ga0307412_10797861 Ga0307412_107978612 101
312 3300031911 Ga0307412_10832685 Ga0307412_108326852 101
313 3300031911 Ga0307412_11643718 Ga0307412_116437182 101
314 3300031911 Ga0307412_12040027 Ga0307412_120400272 101
315 3300031911 Ga0307412_12313373 Ga0307412_123133731 101
316 3300031995 Ga0307409_100030230 Ga0307409_1000302303 101
317 3300031995 Ga0307409_100564026 Ga0307409_1005640262 101
318 3300032002 Ga0307416_100015543 Ga0307416_1000155435 101
319 3300032002 Ga0307416_100055308 Ga0307416_1000553082 101
320 3300032002 Ga0307416_100476389 Ga0307416_1004763892 101
321 3300032002 Ga0307416_102951397 Ga0307416_1029513972 101
322 3300032002 Ga0307416_103829067 Ga0307416_1038290672 101
323 3300032004 Ga0307414_10245353 Ga0307414_102453532 101
324 3300032004 Ga0307414_10452722 Ga0307414_104527222 101
325 3300032004 Ga0307414_11852798 Ga0307414_118527982 101
326 3300032005 Ga0307411_10001517 Ga0307411_100015173 101
327 3300032005 Ga0307411_10207656 Ga0307411_102076562 101
328 3300032005 Ga0307411_10229829 Ga0307411_102298291 101
329 3300032005 Ga0307411_10303472 Ga0307411_103034722 101
330 3300032005 Ga0307411_10552571 Ga0307411_105525712 101
331 3300032005 Ga0307411_11977192 Ga0307411_119771921 101
332 3300032126 Ga0307415_100182612 Ga0307415_1001826123 101
333 3300032126 Ga0307415_100857765 Ga0307415_1008577652 101
334 3300032126 Ga0307415_101536442 Ga0307415_1015364422 101
335 3300033179 Ga0307507_10075671 Ga0307507_100756712 101
336 3300033179 Ga0307507_10160163 Ga0307507_101601631 101
337 3300033180 Ga0307510_10006135 Ga0307510_1000613515 101
338 3300033180 Ga0307510_10232538 Ga0307510_102325382 101
339 3300034817 Ga0373948_0001520 Ga0373948_0001520_698_1003 101
340 3300034820 Ga0373959_0080550 Ga0373959_0080550_58_363 101
341 3300035086 Ga0373934_0440794 Ga0373934_0440794_113_433 101
342 3300035089 Ga0373944_0182125 Ga0373944_0182125_273_578 101
343 3300035091 Ga0373951_0009036 Ga0373951_0009036_1415_1720 101
344 3300035091 Ga0373951_0069480 Ga0373951_0069480_222_527 101
345 3300035111 Ga0373923_0165716 Ga0373923_0165716_110_415 101
346 3300035111 Ga0373923_0365307 Ga0373923_0365307_334_654 101
347 3300035112 Ga0373932_0025075 Ga0373932_0025075_570_875 101
348 3300035113 Ga0373936_0070094 Ga0373936_0070094_858_1163 101
349 3300035114 Ga0373939_0000036 Ga0373939_0000036_43407_43712 101
350 3300035116 Ga0373945_0094123 Ga0373945_0094123_260_580 101
351 3300035118 Ga0373954_0242100 Ga0373954_0242100_504_824 101
352 3300035118 Ga0373954_0563481 Ga0373954_0563481_227_532 101
353 3300035119 Ga0373956_0306666 Ga0373956_0306666_21_326 101
354 3300035121 Ga0373960_0021758 Ga0373960_0021758_1364_1669 101
355 3300035170 Ga0373943_0042479 Ga0373943_0042479_1471_1791 101
356 3300035170 Ga0373943_0301170 Ga0373943_0301170_457_762 101
357 3300035172 Ga0373955_0016521 Ga0373955_0016521_621_926 101
358 3300035172 Ga0373955_0041212 Ga0373955_0041212_639_959 101
359 3300035241 Ga0373961_0236665 Ga0373961_0236665_229_534 101
360 3300035410 Ga0373924_0073943 Ga0373924_0073943_573_893 101
361 3300035691 Ga0373931_0005162 Ga0373931_0005162_4072_4377 101
362 3300035691 Ga0373931_0019544 Ga0373931_0019544_2585_2890 101
363 3300035691 Ga0373931_0197628 Ga0373931_0197628_571_879 101
364 3300035692 Ga0373935_0281752 Ga0373935_0281752_529_834 101
365 3300035724 Ga0373933_0661131 Ga0373933_0661131_348_653 101
366 3300035725 Ga0373947_0042936 Ga0373947_0042936_1460_1765 101
367 3300036401 Ga0373937_0394749 Ga0373937_0394749_891_1211 101
368 3300037471 Ga0395905_0000600 Ga0395905_0000600_30170_30475 101
369 3300041404 Ga0439436_0028989 Ga0439436_0028989_836_1141 101
370 3300041413 Ga0439465_0032873 Ga0439465_0032873_201_506 101
371 3300041443 Ga0451789_0151812 Ga0451789_0151812_816_1121 101
372 3300041443 Ga0451789_0544890 Ga0451789_0544890_123_428 101
373 3300041453 Ga0451797_0677519 Ga0451797_0677519_74_379 101
374 3300041453 Ga0451797_1429463 Ga0451797_1429463_432_737 101
375 3300041459 Ga0451800_0842469 Ga0451800_0842469_148_453 101
376 3300041459 Ga0451800_1401263 Ga0451800_1401263_84_389 101
377 3300041460 Ga0451802_2141157 Ga0451802_2141157_184_489 101
378 3300041463 Ga0451804_1092860 Ga0451804_1092860_79_384 101
379 3300041486 Ga0451807_0521282 Ga0451807_0521282_228_533 101
380 3300041492 Ga0451835_0332945 Ga0451835_0332945_72_377 101
381 3300041496 Ga0451839_1391327 Ga0451839_1391327_404_709 101
382 3300041498 Ga0451841_0202857 Ga0451841_0202857_102_407 101
383 3300041501 Ga0451845_0502849 Ga0451845_0502849_409_714 101
384 3300041503 Ga0451847_0777924 Ga0451847_0777924_554_859 101
385 3300041505 Ga0451849_0735763 Ga0451849_0735763_180_485 101
386 3300041507 Ga0451851_0055416 Ga0451851_0055416_11_316 101
387 3300041999 Ga0439433_0037076 Ga0439433_0037076_375_680 101
388 3300042002 Ga0439442_003576 Ga0439442_003576_711_1016 101
389 3300042010 Ga0439452_089718 Ga0439452_089718_133_438 101
390 3300042121 Ga0450919_016249 Ga0450919_016249_391_696 101
391 3300042125 Ga0450923_124371 Ga0450923_124371_168_473 101
392 3300042134 Ga0450898_024480 Ga0450898_024480_690_995 101
393 3300042135 Ga0450899_008107 Ga0450899_008107_310_615 101
394 3300042144 Ga0450889_021351 Ga0450889_021351_333_638 101
395 3300042145 Ga0450906_006856 Ga0450906_006856_338_643 101
396 3300042147 Ga0450910_003954 Ga0450910_003954_1326_1631 101
397 3300042156 Ga0439446_0238372 Ga0439446_0238372_106_411 101
398 3300042184 Ga0450908_004610 Ga0450908_004610_315_620 101
399 3300042185 Ga0450909_017454 Ga0450909_017454_572_877 101
400 3300042435 Ga0439434_0025270 Ga0439434_0025270_690_995 101
401 3300042531 Ga0450918_006736 Ga0450918_006736_306_611 101
402 3300042532 Ga0450893_0014508 Ga0450893_0014508_644_949 101
403 3300042876 Ga0451577_0022469 Ga0451577_0022469_519_824 101
404 3300044712 Ga0453684_2386388 Ga0453684_2386388_19_324 101
405 3300044842 Ga0466957_0969017 Ga0466957_0969017_253_558 101
406 3300045051 Ga0451576_0098993 Ga0451576_0098993_2716_3021 101
407 3300046453 Ga0495627_019484 Ga0495627_019484_555_860 101
408 3300046454 Ga0495592_0629263 Ga0495592_0629263_135_455 101
409 3300046459 Ga0495629_0049614 Ga0495629_0049614_2028_2348 101
410 3300046460 Ga0495638_0070970 Ga0495638_0070970_944_1249 101
411 3300046471 Ga0495650_0005014 Ga0495650_0005014_6855_7160 101
412 3300046472 Ga0495580_0060253 Ga0495580_0060253_2042_2347 101
413 3300046473 Ga0495582_0046755 Ga0495582_0046755_1922_2227 101
414 3300046475 Ga0495639_0420916 Ga0495639_0420916_55_375 101
415 3300046476 Ga0495662_0180964 Ga0495662_0180964_28_348 101
416 3300046507 Ga0495606_0373261 Ga0495606_0373261_255_560 101
417 3300046512 Ga0495610_0036371 Ga0495610_0036371_1007_1312 101
418 3300046512 Ga0495610_0039514 Ga0495610_0039514_1456_1761 101
419 3300046513 Ga0495616_0038655 Ga0495616_0038655_703_1008 101
420 3300046515 Ga0495620_0033235 Ga0495620_0033235_608_913 101
421 3300046516 Ga0495628_0995660 Ga0495628_0995660_232_537 101
422 3300046517 Ga0495630_1380714 Ga0495630_1380714_76_381 101
423 3300046518 Ga0495631_0000073 Ga0495631_0000073_1392_1697 101
424 3300046519 Ga0495632_0066357 Ga0495632_0066357_1238_1543 101
425 3300046520 Ga0495637_0098860 Ga0495637_0098860_366_671 101
426 3300046522 Ga0495643_0014989 Ga0495643_0014989_1105_1410 101
427 3300046524 Ga0495648_0407196 Ga0495648_0407196_131_436 101
428 3300046529 Ga0495652_0645632 Ga0495652_0645632_35_340 101
429 3300046530 Ga0495654_0001245 Ga0495654_0001245_4007_4312 101
430 3300046530 Ga0495654_0107228 Ga0495654_0107228_768_1073 101
431 3300046530 Ga0495654_0208204 Ga0495654_0208204_173_478 101
432 3300046531 Ga0495665_0631889 Ga0495665_0631889_210_515 101
433 3300046533 Ga0495640_0781875 Ga0495640_0781875_101_406 101
434 3300046542 Ga0495597_0000024 Ga0495597_0000024_24331_24657 101
435 3300046543 Ga0495645_0425310 Ga0495645_0425310_401_706 101
436 3300046558 Ga0495633_0466649 Ga0495633_0466649_143_448 101
437 3300046559 Ga0495667_0198405 Ga0495667_0198405_169_474 101
438 3300046616 Ga0495668_0081141 Ga0495668_0081141_1109_1414 101
439 3300046660 Ga0495625_0001217 Ga0495625_0001217_31712_32017 101
440 3300046660 Ga0495625_0086085 Ga0495625_0086085_593_898 101
441 3300046660 Ga0495625_0407396 Ga0495625_0407396_247_552 101
442 3300046664 Ga0495659_0136502 Ga0495659_0136502_290_595 101
443 3300046665 Ga0495661_0338713 Ga0495661_0338713_231_536 101
444 3300046674 Ga0495588_0012491 Ga0495588_0012491_708_1013 101
445 3300046674 Ga0495588_0457348 Ga0495588_0457348_148_453 101
446 3300046675 Ga0495657_0890757 Ga0495657_0890757_95_400 101
447 3300046681 Ga0495647_0226645 Ga0495647_0226645_237_542 101
448 3300046683 Ga0495658_0235096 Ga0495658_0235096_262_567 101
449 3300046691 Ga0495670_0346377 Ga0495670_0346377_177_482 101
450 3300046692 Ga0495671_0089351 Ga0495671_0089351_727_1032 101
451 3300046692 Ga0495671_0401977 Ga0495671_0401977_97_402 101
452 3300046809 Ga0495600_0482197 Ga0495600_0482197_327_632 101
453 3300046810 Ga0495660_0322188 Ga0495660_0322188_101_406 101
454 3300047321 Ga0495676_0091783 Ga0495676_0091783_746_1051 101
455 3300047445 Ga0495677_0135520 Ga0495677_0135520_520_825 101
456 3300047471 Ga0495684_0193819 Ga0495684_0193819_133_438 101
457 3300047471 Ga0495684_0274416 Ga0495684_0274416_868_1188 101
458 3300047472 Ga0495686_0213907 Ga0495686_0213907_777_1082 101
459 3300048904 Ga0496101_0055821 Ga0496101_0055821_780_1085 101
460 3300048904 Ga0496101_1181839 Ga0496101_1181839_199_504 101
461 3300048909 Ga0496106_0033566 Ga0496106_0033566_3455_3760 101
462 3300048916 Ga0496113_0139336 Ga0496113_0139336_1369_1674 101
463 3300048916 Ga0496113_0406049 Ga0496113_0406049_424_729 101
464 3300048917 Ga0496114_0693241 Ga0496114_0693241_510_815 101
465 3300048918 Ga0496115_0749314 Ga0496115_0749314_238_543 101
466 3300048919 Ga0496116_0260160 Ga0496116_0260160_123_428 101
467 3300048920 Ga0496117_0055146 Ga0496117_0055146_1002_1307 101
468 3300048920 Ga0496117_0069400 Ga0496117_0069400_1686_1991 101
469 3300048920 Ga0496117_0598014 Ga0496117_0598014_90_395 101
470 3300048921 Ga0496118_0233444 Ga0496118_0233444_362_667 101
471 3300048923 Ga0496120_0459678 Ga0496120_0459678_139_444 101
472 3300048924 Ga0496121_0094048 Ga0496121_0094048_2003_2308 101
473 3300048924 Ga0496121_0114365 Ga0496121_0114365_544_849 101
474 3300048925 Ga0496122_0103836 Ga0496122_0103836_567_872 101
475 3300048925 Ga0496122_0239281 Ga0496122_0239281_355_660 101
476 3300048925 Ga0496122_0510133 Ga0496122_0510133_79_384 101
477 3300048926 Ga0496123_0104026 Ga0496123_0104026_126_431 101
478 3300048926 Ga0496123_0147661 Ga0496123_0147661_892_1197 101
479 3300048926 Ga0496123_0384217 Ga0496123_0384217_163_468 101
480 3300048927 Ga0496124_0261471 Ga0496124_0261471_504_809 101
481 3300048928 Ga0496125_0215883 Ga0496125_0215883_614_919 101
482 3300048928 Ga0496125_0397224 Ga0496125_0397224_21_326 101
483 3300049665 Ga0501227_032723 Ga0501227_032723_791_1096 101
484 3300049679 Ga0501249_080672 Ga0501249_080672_418_723 101
485 3300049688 Ga0501259_044051 Ga0501259_044051_91_396 101
486 3300049688 Ga0501259_111756 Ga0501259_111756_71_376 101
487 3300049705 Ga0501225_0009191 Ga0501225_0009191_664_969 101
488 3300049759 Ga0501262_002190 Ga0501262_002190_1866_2171 101
489 3300049759 Ga0501262_021346 Ga0501262_021346_242_547 101
490 3300050489 nmdc:mga03683_62534_c1 nmdc:mga03683_62534_c1_610_915 101
491 3300050490 nmdc:mga03n38_325535_c1 nmdc:mga03n38_325535_c1_179_484 101
492 3300050490 nmdc:mga03n38_374779_c1 nmdc:mga03n38_374779_c1_109_414 101
493 3300050490 nmdc:mga03n38_390956_c1 nmdc:mga03n38_390956_c1_216_521 101
494 3300050492 nmdc:mga0yw44_1121696_c1 nmdc:mga0yw44_1121696_c1_181_486 101
495 3300050493 nmdc:mga0k408_115836_c1 nmdc:mga0k408_115836_c1_763_1068 101
496 3300050493 nmdc:mga0k408_132846_c1 nmdc:mga0k408_132846_c1_422_727 101
497 3300050493 nmdc:mga0k408_703166_c1 nmdc:mga0k408_703166_c1_100_405 101
498 3300050493 nmdc:mga0k408_742429_c1 nmdc:mga0k408_742429_c1_72_377 101
499 3300050494 nmdc:mga06z11_115416_c1 nmdc:mga06z11_115416_c1_495_800 101
500 3300050494 nmdc:mga06z11_331667_c1 nmdc:mga06z11_331667_c1_311_616 101
501 3300050494 nmdc:mga06z11_476152_c1 nmdc:mga06z11_476152_c1_370_675 101
502 3300050496 nmdc:mga07m45_378022_c1 nmdc:mga07m45_378022_c1_256_561 101
503 3300050496 nmdc:mga07m45_39111_c1 nmdc:mga07m45_39111_c1_1847_2152 101
504 3300050496 nmdc:mga07m45_47453_c1 nmdc:mga07m45_47453_c1_603_908 101
505 3300050496 nmdc:mga07m45_526592_c1 nmdc:mga07m45_526592_c1_137_442 101
506 3300050516 nmdc:mga0sz30_100898_c1 nmdc:mga0sz30_100898_c1_209_514 101
507 3300053077 Ga0495601_0094278 Ga0495601_0094278_1008_1328 101
508 3300053079 Ga0500610_0000329 Ga0500610_0000329_5558_5863 101
509 3300053079 Ga0500610_0047951 Ga0500610_0047951_715_1020 101
510 3300053084 Ga0495595_0086303 Ga0495595_0086303_185_505 101
511 3300053085 Ga0495619_0492827 Ga0495619_0492827_364_669 101
512 3300053085 Ga0495619_0627224 Ga0495619_0627224_316_636 101
513 3300053086 Ga0500578_0254732 Ga0500578_0254732_547_852 101
514 3300053088 Ga0500644_0031465 Ga0500644_0031465_810_1115 101
515 3300053093 Ga0500651_0634216 Ga0500651_0634216_28_333 101
516 3300053096 Ga0500641_0131306 Ga0500641_0131306_518_823 101
517 3300053108 Ga0500562_011371 Ga0500562_011371_1758_2063 101
518 3300053108 Ga0500562_137955 Ga0500562_137955_129_434 101
519 3300053117 Ga0500593_010835 Ga0500593_010835_2271_2576 101
520 3300053117 Ga0500593_030693 Ga0500593_030693_545_850 101
521 3300053118 Ga0500594_0004824 Ga0500594_0004824_2215_2520 101
522 3300053121 Ga0500607_020625 Ga0500607_020625_3004_3309 101
523 3300053121 Ga0500607_049832 Ga0500607_049832_1446_1751 101
524 3300053134 Ga0500658_0001544 Ga0500658_0001544_2352_2657 101
525 3300053134 Ga0500658_0048977 Ga0500658_0048977_604_909 101
526 3300053139 Ga0500568_0023470 Ga0500568_0023470_529_834 101
527 3300053153 Ga0500616_0155352 Ga0500616_0155352_60_365 101
528 3300053153 Ga0500616_0289505 Ga0500616_0289505_340_645 101
529 3300053158 Ga0500627_0023457 Ga0500627_0023457_780_1085 101
530 3300053161 Ga0500634_0046050 Ga0500634_0046050_529_834 101
531 3300053730 Ga0500645_016026 Ga0500645_016026_448_753 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00699

Urease_beta

Urease beta subunit

3

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gy7-assembly1.cif.gz_A crystallographic structure analysis of urease from jack bean (canavalia ensiformis) at 1.49 a resolution 0.9063 15 92
4goa-assembly1.cif.gz_A crystal structure of jack bean urease inhibited with fluoride 0.9063 15 92
4g7e-assembly1.cif.gz_B-3 crystal structure of pigeon pea urease 0.9046 15 92
4g7e-assembly1.cif.gz_A crystal structure of pigeon pea urease 0.9037 15 92
7kns-assembly1.cif.gz_F cryo-em structure of jack bean urease 0.9035 15 92
ID Description Score Start End Superfamily
3la4A03 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8366 20 92 2.10.150.10
1s3tB00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.8242 1 92 2.10.150.10
3qgaA02 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.7859 1 99 2.10.150.10
4z42K00 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.7825 4 99 2.10.150.10
3qgaA02 Mainly Beta;Ribbon;Urease, subunit B;Urease, beta subunit 0.7641 1 99 2.10.150.10
ID Description Score Start End GO Terms
AF-A0A3C0N2Z2-F1-model_v4 Urease subunit beta 1.01 28 77 GO:0009039
GO:0035550
GO:0043419
AF-A0A0F7GA08-F1-model_v4 Urease B (EC 3.5.1.5) 1.005 18 83 GO:0009039
GO:0035550
GO:0043419
AF-A0A7S0UIM6-F1-model_v4 urease (EC 3.5.1.5) 1.004 24 83 GO:0009039
GO:0016151
GO:0035550
GO:0043419
AF-A0A167J1M4-F1-model_v4 urease (EC 3.5.1.5) 0.9896 15 83 GO:0009039
GO:0016151
GO:0035550
GO:0043419
AF-A0A0F7GA08-F1-model_v4 Urease B (EC 3.5.1.5) 0.9756 18 83 GO:0009039
GO:0035550
GO:0043419

Feature Viewer

pLDDT pTM Quality
86.72 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map