F460106

General Info

Members Datasets Scaffolds Average Seq Length
531 223 522 309

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100027920|Ga0075428_1000279202
Length 328
Sequence MWIRFGVSATTVGIIISALLVISLSVIVGRVSAQRAIAPAXXXXSSSAQIRRQANGKPDFSGIWQANNTANWDLVTHEAMPARVMQTGVHPLSPVPAAPVLALGAVGGVPPGPGVVEGDVIPYKPEALQRKKDNFEHWLDRDPEIKCYQPGVPRAMYMPYPFQILQGTNKIMMVFEYANAQRTIHLDQVEPYPNDSWMGHSVGNWEGDTLVVDVTSQIDKTWFDRAGDFHSDALHVVERYRMMTPDAIWYEATIEDPNVFTRPWKIAMPLYRHLEPGAQLMDYRCIEMVEELLYGHLRKQPLVSNWEGQTLTVRVERKVPPPDVLYER

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0.38
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100068226 3300005329 Unclassified 3313
2 Ga0070683_100068666 3300005329 Bacteria 3302
3 Ga0070690_100153375 3300005330 Unclassified 1573
4 Ga0070670_100000419 3300005331 Bacteria 34947
5 Ga0070670_100076749 3300005331 Bacteria 2871
6 Ga0068869_100437950 3300005334 Unclassified 1081
7 Ga0070666_10083885 3300005335 Unclassified 2180
8 Ga0070666_10084797 3300005335 Bacteria 2169
9 Ga0070666_10171588 3300005335 Unclassified 1519
10 Ga0068868_100000775 3300005338 Bacteria 21626
11 Ga0068868_100241025 3300005338 Unclassified 1519
12 Ga0068868_100452269 3300005338 Unclassified 1117
13 Ga0070660_100212972 3300005339 Bacteria 1569
14 Ga0070689_100042658 3300005340 Bacteria 3483
15 Ga0070689_100056515 3300005340 Unclassified 3043
16 Ga0070689_100086462 3300005340 Bacteria 2466
17 Ga0070689_100086795 3300005340 Bacteria 2461
18 Ga0070691_10000667 3300005341 Bacteria 13322
19 Ga0070687_100085182 3300005343 Unclassified 1734
20 Ga0070661_100047111 3300005344 Bacteria 3155
21 Ga0070692_10043331 3300005345 Unclassified 2314
22 Ga0070669_100115116 3300005353 Unclassified 2045
23 Ga0070675_100000093 3300005354 Bacteria 51263
24 Ga0070675_100000173 3300005354 Bacteria 39883
25 Ga0070675_100000413 3300005354 Bacteria 29141
26 Ga0070675_100002006 3300005354 Bacteria 15103
27 Ga0070675_100104700 3300005354 Unclassified 2387
28 Ga0070675_100116588 3300005354 Unclassified 2265
29 Ga0070675_100194198 3300005354 Unclassified 1760
30 Ga0070671_100007337 3300005355 Bacteria 8805
31 Ga0070671_100009227 3300005355 Bacteria 7924
32 Ga0070671_100131888 3300005355 Bacteria 2104
33 Ga0070673_100003330 3300005364 Bacteria 9982
34 Ga0070673_100016284 3300005364 Bacteria 5253
35 Ga0070673_100069866 3300005364 Bacteria 2817
36 Ga0070673_100208615 3300005364 Unclassified 1686
37 Ga0070673_100463228 3300005364 Bacteria 1142
38 Ga0070688_100035372 3300005365 Unclassified 3034
39 Ga0070688_100050349 3300005365 Bacteria 2594
40 Ga0070667_100008037 3300005367 Bacteria 8749
41 Ga0070667_100008750 3300005367 Bacteria 8390
42 Ga0070667_100026133 3300005367 Unclassified 4855
43 Ga0070714_100006277 3300005435 Bacteria 9160
44 Ga0070713_100001089 3300005436 Bacteria 17388
45 Ga0070713_100002372 3300005436 Bacteria 12275
46 Ga0070713_100570711 3300005436 Bacteria 1073
47 Ga0070701_10148434 3300005438 Bacteria 1348
48 Ga0070701_10184963 3300005438 Unclassified 1222
49 Ga0070705_100002127 3300005440 Bacteria 10072
50 Ga0070705_100009312 3300005440 Bacteria 4880
51 Ga0070705_100026527 3300005440 Bacteria 3154
52 Ga0070705_100178953 3300005440 Bacteria 1435
53 Ga0070694_100000733 3300005444 Bacteria 18330
54 Ga0070694_100003516 3300005444 Bacteria 9366
55 Ga0070694_100018041 3300005444 Bacteria 4471
56 Ga0070694_100139408 3300005444 Bacteria 1760
57 Ga0070694_100187585 3300005444 Bacteria 1533
58 Ga0070708_100173867 3300005445 Bacteria 2012
59 Ga0070708_100253660 3300005445 Bacteria 1653
60 Ga0070678_100027943 3300005456 Bacteria 3839
61 Ga0070678_100067807 3300005456 Unclassified 2657
62 Ga0070662_100065442 3300005457 Bacteria 2665
63 Ga0070662_100233894 3300005457 Bacteria 1471
64 Ga0070681_10021472 3300005458 Bacteria 6472
65 Ga0068867_100249477 3300005459 Bacteria 1443
66 Ga0068867_100250579 3300005459 Bacteria 1440
67 Ga0070685_10036649 3300005466 Bacteria 2773
68 Ga0070707_100010061 3300005468 Bacteria 8805
69 Ga0070707_100047693 3300005468 Bacteria 4101
70 Ga0070707_100054382 3300005468 Bacteria 3838
71 Ga0070707_100207070 3300005468 Unclassified 1912
72 Ga0070698_100005682 3300005471 Bacteria 13652
73 Ga0070698_100007072 3300005471 Bacteria 12154
74 Ga0070698_100007846 3300005471 Bacteria 11556
75 Ga0070698_100032318 3300005471 Bacteria 5421
76 Ga0070698_100051432 3300005471 Bacteria 4196
77 Ga0070698_100247410 3300005471 Bacteria 1716
78 Ga0070699_100000583 3300005518 Bacteria 34487
79 Ga0070699_100001609 3300005518 Bacteria 20621
80 Ga0070699_100014311 3300005518 Bacteria 6821
81 Ga0070699_100063563 3300005518 Bacteria 3200
82 Ga0070699_100123113 3300005518 Bacteria 2281
83 Ga0070699_100132767 3300005518 Bacteria 2195
84 Ga0070699_100167805 3300005518 Bacteria 1944
85 Ga0070679_100008841 3300005530 Bacteria 9504
86 Ga0070684_100002037 3300005535 Bacteria 14883
87 Ga0070684_100019645 3300005535 Bacteria 5591
88 Ga0070684_100137399 3300005535 Bacteria 2209
89 Ga0070697_100056829 3300005536 Bacteria 3184
90 Ga0070697_100058190 3300005536 Unclassified 3145
91 Ga0068853_100031857 3300005539 Bacteria 4463
92 Ga0070672_100008033 3300005543 Bacteria 7207
93 Ga0070672_100070414 3300005543 Unclassified 2779
94 Ga0070695_100000219 3300005545 Bacteria 27963
95 Ga0070695_100016127 3300005545 Bacteria 4518
96 Ga0070695_100058796 3300005545 Bacteria 2487
97 Ga0070695_100102067 3300005545 Bacteria 1933
98 Ga0070696_100000188 3300005546 Bacteria 36187
99 Ga0070696_100002056 3300005546 Bacteria 13192
100 Ga0070696_100034651 3300005546 Bacteria 3473
101 Ga0070696_100036776 3300005546 Bacteria 3376
102 Ga0070696_100050702 3300005546 Bacteria 2885
103 Ga0070696_100062388 3300005546 Bacteria 2609
104 Ga0070696_100190908 3300005546 Bacteria 1525
105 Ga0070696_100252782 3300005546 Bacteria 1333
106 Ga0070693_100245459 3300005547 Bacteria 1184
107 Ga0070665_100267482 3300005548 Unclassified 1711
108 Ga0070704_100001156 3300005549 Bacteria 13788
109 Ga0070704_100013795 3300005549 Bacteria 5029
110 Ga0070704_100041241 3300005549 Unclassified 3184
111 Ga0070704_100047069 3300005549 Bacteria 3013
112 Ga0070704_100060078 3300005549 Bacteria 2715
113 Ga0070704_100098014 3300005549 Bacteria 2201
114 Ga0070704_100128331 3300005549 Bacteria 1961
115 Ga0070704_100163511 3300005549 Bacteria 1763
116 Ga0068855_100012187 3300005563 Bacteria 10389
117 Ga0068855_100062315 3300005563 Bacteria 4354
118 Ga0068855_100202062 3300005563 Unclassified 2237
119 Ga0070664_100000131 3300005564 Bacteria 49975
120 Ga0070664_100054501 3300005564 Bacteria 3392
121 Ga0070664_100386820 3300005564 Unclassified 1278
122 Ga0068857_100025506 3300005577 Bacteria 5204
123 Ga0068857_100095280 3300005577 Bacteria 2666
124 Ga0068854_100059834 3300005578 Unclassified 2754
125 Ga0068856_100003282 3300005614 Bacteria 16442
126 Ga0068856_100069252 3300005614 Unclassified 3489
127 Ga0068856_100106576 3300005614 Bacteria 2797
128 Ga0070702_100034512 3300005615 Bacteria 2789
129 Ga0070702_100039637 3300005615 Unclassified 2630
130 Ga0070702_100066804 3300005615 Bacteria 2110
131 Ga0068852_100003962 3300005616 Bacteria 10402
132 Ga0068852_100431126 3300005616 Bacteria 1302
133 Ga0068852_100451375 3300005616 Bacteria 1273
134 Ga0068859_100000161 3300005617 Bacteria 65050
135 Ga0068859_100001946 3300005617 Bacteria 21062
136 Ga0068859_100008877 3300005617 Bacteria 10148
137 Ga0068859_100069643 3300005617 Bacteria 3553
138 Ga0068859_100193541 3300005617 Bacteria 2118
139 Ga0068859_100199189 3300005617 Bacteria 2087
140 Ga0068864_100000280 3300005618 Bacteria 45611
141 Ga0068864_100069903 3300005618 Unclassified 3053
142 Ga0068864_100083081 3300005618 Bacteria 2812
143 Ga0068864_100120839 3300005618 Bacteria 2342
144 Ga0068864_100146670 3300005618 Bacteria 2134
145 Ga0068861_100218651 3300005719 Bacteria 1609
146 Ga0068851_10051145 3300005834 Unclassified 2099
147 Ga0068863_100001065 3300005841 Bacteria 27415
148 Ga0068863_100001626 3300005841 Bacteria 22199
149 Ga0068863_100038749 3300005841 Unclassified 4534
150 Ga0068863_100302376 3300005841 Bacteria 1552
151 Ga0068863_100560933 3300005841 Unclassified 1128
152 Ga0068858_100043953 3300005842 Bacteria 4142
153 Ga0068858_100056308 3300005842 Bacteria 3634
154 Ga0068858_100061214 3300005842 Unclassified 3480
155 Ga0068860_100001147 3300005843 Bacteria 29074
156 Ga0068860_100004829 3300005843 Bacteria 13726
157 Ga0068862_100123977 3300005844 Bacteria 2280
158 Ga0081455_10089287 3300005937 Bacteria 2501
159 Ga0097621_100005805 3300006237 Bacteria 8717
160 Ga0097621_100096950 3300006237 Unclassified 2475
161 Ga0097621_100116556 3300006237 Bacteria 2262
162 Ga0068871_100022259 3300006358 Unclassified 4886
163 Ga0068871_100024699 3300006358 Unclassified 4664
164 Ga0068871_100027085 3300006358 Unclassified 4480
165 Ga0068871_100238356 3300006358 Unclassified 1581
166 Ga0075428_100017747 3300006844 Bacteria 7863
167 Ga0075428_100027920 3300006844 Bacteria 6245
168 Ga0075428_100055719 3300006844 Unclassified 4332
169 Ga0075428_100296256 3300006844 Bacteria 1739
170 Ga0075430_100028868 3300006846 Bacteria 4710
171 Ga0075430_100455915 3300006846 Bacteria 1055
172 Ga0075431_100007116 3300006847 Bacteria 11116
173 Ga0075431_100141063 3300006847 Unclassified 2484
174 Ga0075433_10102987 3300006852 Bacteria 2528
175 Ga0075433_10135805 3300006852 Bacteria 2186
176 Ga0075433_10138946 3300006852 Unclassified 2159
177 Ga0075433_10197243 3300006852 Bacteria 1790
178 Ga0075434_100003262 3300006871 Bacteria 14500
179 Ga0075434_100065012 3300006871 Unclassified 3633
180 Ga0075434_100171562 3300006871 Bacteria 2189
181 Ga0075434_100190595 3300006871 Unclassified 2071
182 Ga0075434_100201768 3300006871 Bacteria 2009
183 Ga0075434_100431223 3300006871 Bacteria 1339
184 Ga0075429_100068947 3300006880 Bacteria 3078
185 Ga0068865_100196496 3300006881 Bacteria 1563
186 Ga0075436_100178131 3300006914 Bacteria 1502
187 Ga0097620_100000161 3300006931 Bacteria 65050
188 Ga0097620_100001946 3300006931 Bacteria 21062
189 Ga0097620_100008878 3300006931 Bacteria 10148
190 Ga0097620_100069643 3300006931 Bacteria 3553
191 Ga0097620_100193539 3300006931 Bacteria 2118
192 Ga0097620_100199192 3300006931 Bacteria 2087
193 Ga0075435_100011219 3300007076 Bacteria 6577
194 Ga0075435_100034374 3300007076 Bacteria 4016
195 Ga0075435_100049738 3300007076 Unclassified 3372
196 Ga0075435_100188587 3300007076 Bacteria 1744
197 Ga0075435_100245108 3300007076 Bacteria 1525
198 Ga0099794_10035671 3300007265 Bacteria 2348
199 Ga0105240_10001609 3300009093 Bacteria 38288
200 Ga0105240_10010039 3300009093 Bacteria 13334
201 Ga0105240_10293034 3300009093 Bacteria 1864
202 Ga0105240_10481724 3300009093 Unclassified 1383
203 Ga0111539_10007902 3300009094 Bacteria 13575
204 Ga0111539_10029099 3300009094 Bacteria 6735
205 Ga0111539_10139687 3300009094 Unclassified 2836
206 Ga0111539_10142657 3300009094 Bacteria 2804
207 Ga0105245_10006558 3300009098 Bacteria 10218
208 Ga0105245_10042365 3300009098 Bacteria 4062
209 Ga0105245_10100336 3300009098 Bacteria 2678
210 Ga0105247_10027869 3300009101 Bacteria 3416
211 Ga0105247_10218174 3300009101 Bacteria 1290
212 Ga0114129_10000796 3300009147 Bacteria 40446
213 Ga0114129_10009049 3300009147 Bacteria 14193
214 Ga0114129_10012911 3300009147 Bacteria 11885
215 Ga0114129_10066410 3300009147 Bacteria 5032
216 Ga0114129_10077282 3300009147 Bacteria 4631
217 Ga0105243_10029290 3300009148 Bacteria 4233
218 Ga0105241_10091945 3300009174 Bacteria 2395
219 Ga0105248_10000212 3300009177 Bacteria 67170
220 Ga0105248_10000511 3300009177 Bacteria 44011
221 Ga0105248_10001915 3300009177 Bacteria 23101
222 Ga0105248_10013372 3300009177 Bacteria 9033
223 Ga0105248_10014685 3300009177 Bacteria 8618
224 Ga0105248_10050139 3300009177 Bacteria 4681
225 Ga0105248_10202656 3300009177 Unclassified 2235
226 Ga0105248_10547059 3300009177 Bacteria 1306
227 Ga0105237_10006460 3300009545 Bacteria 13001
228 Ga0105237_10008797 3300009545 Bacteria 10889
229 Ga0105237_10119281 3300009545 Bacteria 2632
230 Ga0105238_10003466 3300009551 Bacteria 15696
231 Ga0105238_10008181 3300009551 Bacteria 10460
232 Ga0105238_10027385 3300009551 Bacteria 5807
233 Ga0105238_10052656 3300009551 Bacteria 4092
234 Ga0105238_10276606 3300009551 Unclassified 1660
235 Ga0105249_10245355 3300009553 Bacteria 1773
236 Ga0105239_10002868 3300010375 Bacteria 21560
237 Ga0105239_10015025 3300010375 Bacteria 8582
238 Ga0105239_10050596 3300010375 Bacteria 4557
239 Ga0105239_10106246 3300010375 Bacteria 3110
240 Ga0105246_10026373 3300011119 Bacteria 3796
241 Ga0157371_10016055 3300013102 Bacteria 5597
242 Ga0157370_10000946 3300013104 Bacteria 36859
243 Ga0157370_10032571 3300013104 Bacteria 5089
244 Ga0157369_10002207 3300013105 Bacteria 23452
245 Ga0157369_10016546 3300013105 Bacteria 8291
246 Ga0157369_10020523 3300013105 Bacteria 7386
247 Ga0157374_10021545 3300013296 Bacteria 5737
248 Ga0157374_10046687 3300013296 Bacteria 4012
249 Ga0157374_10300727 3300013296 Bacteria 1587
250 Ga0157378_10007018 3300013297 Bacteria 9829
251 Ga0163162_10005106 3300013306 Bacteria 12653
252 Ga0163162_10010902 3300013306 Bacteria 8849
253 Ga0163162_10224699 3300013306 Bacteria 2007
254 Ga0157372_10020183 3300013307 Bacteria 7185
255 Ga0157372_10020539 3300013307 Bacteria 7126
256 Ga0157372_10040051 3300013307 Bacteria 5174
257 Ga0157375_10000265 3300013308 Bacteria 47566
258 Ga0157375_10001336 3300013308 Bacteria 21253
259 Ga0157375_10010347 3300013308 Bacteria 8212
260 Ga0157375_10014300 3300013308 Bacteria 7075
261 Ga0157375_10262715 3300013308 Bacteria 1888
262 Ga0157375_10304518 3300013308 Unclassified 1757
263 Ga0157375_10412951 3300013308 Bacteria 1516
264 Ga0163163_10017826 3300014325 Bacteria 6627
265 Ga0163163_10036725 3300014325 Unclassified 4761
266 Ga0163163_10084724 3300014325 Bacteria 3176
267 Ga0163163_10099654 3300014325 Unclassified 2927
268 Ga0163163_10219391 3300014325 Bacteria 1950
269 Ga0157380_10020746 3300014326 Bacteria 4917
270 Ga0157380_10220326 3300014326 Bacteria 1697
271 Ga0157379_10000041 3300014968 Bacteria 78644
272 Ga0157379_10000414 3300014968 Bacteria 34654
273 Ga0157379_10542578 3300014968 Unclassified 1081
274 Ga0157376_10049591 3300014969 Bacteria 3478
275 Ga0157376_10480556 3300014969 Bacteria 1217
276 Ga0163161_10020341 3300017792 Unclassified 4657
277 Ga0163161_10264086 3300017792 Bacteria 1345
278 Ga0207710_10019346 3300025900 Bacteria 2905
279 Ga0207680_10018986 3300025903 Bacteria 3669
280 Ga0207699_10070363 3300025906 Unclassified 2136
281 Ga0207645_10101219 3300025907 Bacteria 1859
282 Ga0207654_10050242 3300025911 Bacteria 2395
283 Ga0207654_10134131 3300025911 Unclassified 1571
284 Ga0207707_10001181 3300025912 Bacteria 24586
285 Ga0207695_10008926 3300025913 Bacteria 12479
286 Ga0207695_10014789 3300025913 Bacteria 9220
287 Ga0207695_10254613 3300025913 Unclassified 1654
288 Ga0207671_10016000 3300025914 Bacteria 5846
289 Ga0207671_10029567 3300025914 Unclassified 4091
290 Ga0207671_10333469 3300025914 Bacteria 1201
291 Ga0207663_10117663 3300025916 Bacteria 1814
292 Ga0207657_10021795 3300025919 Bacteria 6019
293 Ga0207652_10020563 3300025921 Bacteria 5438
294 Ga0207646_10023827 3300025922 Bacteria 5617
295 Ga0207646_10042633 3300025922 Bacteria 4076
296 Ga0207646_10078815 3300025922 Unclassified 2945
297 Ga0207646_10318615 3300025922 Unclassified 1405
298 Ga0207681_10171432 3300025923 Unclassified 1645
299 Ga0207694_10001610 3300025924 Bacteria 19042
300 Ga0207694_10063967 3300025924 Bacteria 2866
301 Ga0207650_10007495 3300025925 Bacteria 7441
302 Ga0207650_10035701 3300025925 Bacteria 3612
303 Ga0207650_10058640 3300025925 Bacteria 2867
304 Ga0207659_10000149 3300025926 Bacteria 41113
305 Ga0207659_10001425 3300025926 Bacteria 14246
306 Ga0207659_10006021 3300025926 Bacteria 7398
307 Ga0207659_10115754 3300025926 Unclassified 2046
308 Ga0207659_10516209 3300025926 Bacteria 1013
309 Ga0207687_10002463 3300025927 Bacteria 12566
310 Ga0207687_10016738 3300025927 Bacteria 4820
311 Ga0207700_10002594 3300025928 Bacteria 10394
312 Ga0207700_10003418 3300025928 Bacteria 9223
313 Ga0207664_10037330 3300025929 Bacteria 3759
314 Ga0207664_10395219 3300025929 Unclassified 1229
315 Ga0207644_10014016 3300025931 Bacteria 5358
316 Ga0207644_10090011 3300025931 Bacteria 2285
317 Ga0207706_10065367 3300025933 Bacteria 3203
318 Ga0207706_10150863 3300025933 Bacteria 2044
319 Ga0207686_10021366 3300025934 Bacteria 3714
320 Ga0207709_10018819 3300025935 Bacteria 3873
321 Ga0207670_10011610 3300025936 Bacteria 5121
322 Ga0207691_10067645 3300025940 Bacteria 3230
323 Ga0207691_10123847 3300025940 Unclassified 2288
324 Ga0207711_10001894 3300025941 Bacteria 19053
325 Ga0207711_10005536 3300025941 Bacteria 10678
326 Ga0207711_10008411 3300025941 Bacteria 8630
327 Ga0207711_10217607 3300025941 Unclassified 1746
328 Ga0207689_10419871 3300025942 Unclassified 1116
329 Ga0207661_10025917 3300025944 Bacteria 4462
330 Ga0207661_10054908 3300025944 Bacteria 3192
331 Ga0207661_10087279 3300025944 Bacteria 2590
332 Ga0207679_10004811 3300025945 Bacteria 8414
333 Ga0207679_10020015 3300025945 Unclassified 4509
334 Ga0207679_10047128 3300025945 Bacteria 3129
335 Ga0207679_10396666 3300025945 Unclassified 1213
336 Ga0207667_10000800 3300025949 Bacteria 40825
337 Ga0207667_10015941 3300025949 Bacteria 8511
338 Ga0207667_10509284 3300025949 Unclassified 1220
339 Ga0207651_10003501 3300025960 Bacteria 7717
340 Ga0207651_10011821 3300025960 Unclassified 4903
341 Ga0207640_10051399 3300025981 Unclassified 2679
342 Ga0207658_10047174 3300025986 Unclassified 3151
343 Ga0207658_10049997 3300025986 Unclassified 3074
344 Ga0207677_10002810 3300026023 Bacteria 9183
345 Ga0207703_10032572 3300026035 Unclassified 4126
346 Ga0207703_10096301 3300026035 Bacteria 2498
347 Ga0207703_10119141 3300026035 Bacteria 2264
348 Ga0207703_10455892 3300026035 Unclassified 1195
349 Ga0207702_10047426 3300026078 Unclassified 3620
350 Ga0207702_10065943 3300026078 Bacteria 3102
351 Ga0207641_10000819 3300026088 Bacteria 33028
352 Ga0207641_10006123 3300026088 Bacteria 10180
353 Ga0207641_10055150 3300026088 Unclassified 3374
354 Ga0207648_10113254 3300026089 Bacteria 2382
355 Ga0207648_10364060 3300026089 Bacteria 1305
356 Ga0207676_10002761 3300026095 Bacteria 12486
357 Ga0207676_10117149 3300026095 Unclassified 2240
358 Ga0207676_10272885 3300026095 Unclassified 1532
359 Ga0207674_10002433 3300026116 Bacteria 23506
360 Ga0207674_10054819 3300026116 Bacteria 4057
361 Ga0207674_10167529 3300026116 Unclassified 2150
362 Ga0207675_100293670 3300026118 Bacteria 1581
363 Ga0207698_10274444 3300026142 Bacteria 1556
364 Ga0207428_10010373 3300027907 Bacteria 8328
365 Ga0268266_10341914 3300028379 Unclassified 1405
366 Ga0268264_10005613 3300028381 Bacteria 10627
367 Ga0268264_10021928 3300028381 Bacteria 5213
368 Ga0265331_10038562 3300031250 Bacteria 2335
369 Ga0265313_10001870 3300031595 Bacteria 19154
370 Ga0265314_10004161 3300031711 Bacteria 13607
371 Ga0265314_10022469 3300031711 Bacteria 4831
372 Ga0265342_10013118 3300031712 Bacteria 5575
373 Ga0373926_0003476 3300035083 Bacteria 5088
374 Ga0373934_0013218 3300035086 Unclassified 3119
375 Ga0373944_0012165 3300035089 Bacteria 2368
376 Ga0373923_0011213 3300035111 Unclassified 3282
377 Ga0373941_0024599 3300035115 Bacteria 1731
378 Ga0373953_0002851 3300035117 Bacteria 5271
379 Ga0373954_0006692 3300035118 Bacteria 5028
380 Ga0373954_0012682 3300035118 Unclassified 3750
381 Ga0373931_0068851 3300035691 Bacteria 1927
382 Ga0373935_0013153 3300035692 Unclassified 4989
383 Ga0373927_0231124 3300035695 Unclassified 1215
384 Ga0373933_0139739 3300035724 Bacteria 1529
385 Ga0373933_0270901 3300035724 Bacteria 1096
386 Ga0373933_0298677 3300035724 Unclassified 1042
387 Ga0373937_0003261 3300036401 Bacteria 13614
388 Ga0373937_0009455 3300036401 Bacteria 8473
389 Ga0373937_0025174 3300036401 Bacteria 5374
390 Ga0373937_0037708 3300036401 Unclassified 4405
391 Ga0373937_0090805 3300036401 Unclassified 2829
392 Ga0373937_0120640 3300036401 Unclassified 2443
393 Ga0373937_0150474 3300036401 Bacteria 2180
394 Ga0373937_0261091 3300036401 Unclassified 1633
395 Ga0373925_0098498 3300037068 Bacteria 2244
396 Ga0373925_0169926 3300037068 Bacteria 1721
397 Ga0436364_1151733 3300037853 Bacteria 9284
398 Ga0436365_0073611 3300039437 Bacteria 2889
399 Ga0451576_0004185 3300045051 Bacteria 18985
400 Ga0451576_0015184 3300045051 Bacteria 8544
401 Ga0451576_0179531 3300045051 Bacteria 2210
402 Ga0451576_0194301 3300045051 Bacteria 2120
403 Ga0495592_0003715 3300046454 Bacteria 10998
404 Ga0495592_0094399 3300046454 Unclassified 2141
405 Ga0495592_0094406 3300046454 Unclassified 2141
406 Ga0495629_0144485 3300046459 Bacteria 1655
407 Ga0495651_0000099 3300046462 Bacteria 63083
408 Ga0495653_0047222 3300046463 Unclassified 3331
409 Ga0495653_0135213 3300046463 Unclassified 1740
410 Ga0495580_0019731 3300046472 Bacteria 5005
411 Ga0495580_0031378 3300046472 Bacteria 3840
412 Ga0495580_0036527 3300046472 Unclassified 3527
413 Ga0495580_0084019 3300046472 Bacteria 2218
414 Ga0495580_0176746 3300046472 Unclassified 1475
415 Ga0495582_0195970 3300046473 Unclassified 1153
416 Ga0495664_0087611 3300046477 Unclassified 1871
417 Ga0495664_0191029 3300046477 Unclassified 1241
418 Ga0495664_0259425 3300046477 Bacteria 1051
419 Ga0495584_0012293 3300046491 Bacteria 4371
420 Ga0495594_0014378 3300046499 Bacteria 4146
421 Ga0495608_0003405 3300046511 Bacteria 11392
422 Ga0495618_0053368 3300046514 Unclassified 2556
423 Ga0495618_0243495 3300046514 Bacteria 1130
424 Ga0495628_0018658 3300046516 Bacteria 5742
425 Ga0495628_0029183 3300046516 Unclassified 4475
426 Ga0495630_0295191 3300046517 Unclassified 1238
427 Ga0495637_0124550 3300046520 Bacteria 989
428 Ga0495663_0014911 3300046525 Unclassified 2184
429 Ga0495663_0057310 3300046525 Bacteria 1219
430 Ga0495663_0065558 3300046525 Bacteria 1148
431 Ga0495666_0049909 3300046526 Unclassified 2012
432 Ga0495666_0093307 3300046526 Bacteria 1420
433 Ga0495642_0033604 3300046528 Bacteria 2062
434 Ga0495652_0029334 3300046529 Unclassified 4834
435 Ga0495665_0001199 3300046531 Bacteria 13813
436 Ga0495665_0024575 3300046531 Bacteria 3237
437 Ga0495586_0001550 3300046535 Bacteria 12688
438 Ga0495586_0012789 3300046535 Bacteria 4447
439 Ga0495587_0005988 3300046536 Bacteria 7928
440 Ga0495587_0037679 3300046536 Unclassified 2902
441 Ga0495598_0015437 3300046537 Bacteria 1929
442 Ga0495598_0017050 3300046537 Bacteria 1866
443 Ga0495609_0048595 3300046538 Bacteria 1896
444 Ga0495621_0000429 3300046539 Bacteria 10385
445 Ga0495621_0002084 3300046539 Bacteria 5297
446 Ga0495621_0062588 3300046539 Unclassified 1354
447 Ga0495667_0000705 3300046559 Bacteria 21415
448 Ga0495667_0008081 3300046559 Bacteria 7140
449 Ga0495667_0009592 3300046559 Unclassified 6564
450 Ga0495667_0059700 3300046559 Unclassified 2503
451 Ga0495634_0027068 3300046642 Bacteria 3994
452 Ga0495635_0039812 3300046663 Bacteria 3250
453 Ga0495659_0001322 3300046664 Bacteria 8513
454 Ga0495659_0003521 3300046664 Bacteria 4990
455 Ga0495659_0008775 3300046664 Unclassified 3217
456 Ga0495659_0020768 3300046664 Bacteria 2209
457 Ga0495588_0147157 3300046674 Bacteria 1245
458 Ga0495657_0004299 3300046675 Bacteria 11373
459 Ga0495599_0054465 3300046678 Bacteria 2506
460 Ga0495623_0001231 3300046679 Bacteria 17390
461 Ga0495646_0011931 3300046680 Bacteria 5526
462 Ga0495647_0063381 3300046681 Unclassified 1464
463 Ga0495658_0017651 3300046683 Unclassified 3692
464 Ga0495669_0030327 3300046684 Bacteria 2374
465 Ga0495613_0004436 3300046689 Bacteria 10513
466 Ga0495613_0006942 3300046689 Bacteria 8446
467 Ga0495624_0005543 3300046690 Bacteria 9083
468 Ga0495600_0097353 3300046809 Unclassified 1918
469 Ga0495600_0175801 3300046809 Unclassified 1380
470 Ga0495581_0042882 3300047315 Bacteria 2618
471 Ga0495581_0071745 3300047315 Bacteria 2004
472 Ga0495604_0002659 3300047317 Bacteria 14344
473 Ga0495604_0009300 3300047317 Bacteria 7781
474 Ga0495636_0019599 3300047318 Bacteria 2721
475 Ga0495636_0048807 3300047318 Bacteria 1769
476 Ga0495636_0061467 3300047318 Unclassified 1588
477 Ga0495674_0178883 3300047319 Unclassified 1767
478 Ga0495674_0478434 3300047319 Unclassified 998
479 Ga0495675_0001150 3300047444 Bacteria 16078
480 Ga0495675_0018604 3300047444 Bacteria 4410
481 Ga0495675_0066709 3300047444 Bacteria 2275
482 Ga0495675_0092029 3300047444 Unclassified 1903
483 Ga0495684_0009268 3300047471 Bacteria 7599
484 Ga0495602_0012048 3300048088 Bacteria 8913
485 Ga0495602_0047647 3300048088 Unclassified 3860
486 Ga0495614_0022632 3300048089 Unclassified 2711
487 Ga0496102_0312366 3300048905 Unclassified 1481
488 Ga0496115_0227613 3300048918 Bacteria 1538
489 Ga0501077_0029151 3300049593 Unclassified 3509
490 nmdc:mga05p37_18938_c1 3300050507 Bacteria 8324
491 nmdc:mga05p37_2143_c1 3300050507 Bacteria 23051
492 nmdc:mga05p37_268666_c1 3300050507 Bacteria 2039
493 nmdc:mga05p37_269950_c1 3300050507 Bacteria 2033
494 nmdc:mga05p37_32072_c1 3300050507 Bacteria 6424
495 nmdc:mga05p37_36701_c1 3300050507 Bacteria 6011
496 nmdc:mga05p37_503404_c1 3300050507 Bacteria 1389
497 nmdc:mga09592_413285_c1 3300050508 Unclassified 1166
498 nmdc:mga09592_70083_c1 3300050508 Bacteria 2975
499 nmdc:mga0qj67_132157_c1 3300050509 Bacteria 2022
500 nmdc:mga0qj67_72990_c1 3300050509 Bacteria 2741
501 nmdc:mga06r32_123043_c1 3300050510 Unclassified 2560
502 nmdc:mga06r32_183841_c1 3300050510 Bacteria 2077
503 nmdc:mga06r32_252332_c1 3300050510 Unclassified 1752
504 nmdc:mga08y16_38437_c1 3300050511 Bacteria 5025
505 nmdc:mga08y16_52674_c1 3300050511 Bacteria 4258
506 nmdc:mga0n895_136636_c1 3300050512 Bacteria 2478
507 nmdc:mga0n895_145840_c1 3300050512 Unclassified 2397
508 nmdc:mga0n895_192762_c1 3300050512 Unclassified 2069
509 nmdc:mga0n895_61724_c1 3300050512 Bacteria 3702
510 nmdc:mga0n895_98621_c1 3300050512 Bacteria 2929
511 nmdc:mga0rr50_223192_c1 3300050513 Bacteria 1557
512 nmdc:mga0rr50_28895_c1 3300050513 Bacteria 3903
513 nmdc:mga0rr50_7224_c2 3300050513 Bacteria 5220
514 nmdc:mga0a205_120939_c1 3300050515 Unclassified 2518
515 nmdc:mga0a205_155815_c1 3300050515 Bacteria 2183
516 nmdc:mga0a205_312738_c1 3300050515 Unclassified 1443
517 nmdc:mga0a205_67287_c1 3300050515 Bacteria 3461
518 nmdc:mga0a205_70659_c1 3300050515 Bacteria 3371
519 Ga0495612_0008870 3300053078 Unclassified 4073
520 Ga0495619_0094393 3300053085 Unclassified 2029
521 Ga0500568_0000749 3300053139 Bacteria 23216
522 Ga0500568_0032043 3300053139 Bacteria 2163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0231124 Ga0373927_0231124_436_1188 246
2 3300009094 Ga0111539_10139687 Ga0111539_101396873 248
3 3300009545 Ga0105237_10119281 Ga0105237_101192811 250
4 3300005563 Ga0068855_100202062 Ga0068855_1002020623 252
5 3300005616 Ga0068852_100431126 Ga0068852_1004311262 252
6 3300025949 Ga0207667_10509284 Ga0207667_105092842 252
7 3300026142 Ga0207698_10274444 Ga0207698_102744442 252
8 3300005435 Ga0070714_100006277 Ga0070714_1000062774 255
9 3300005436 Ga0070713_100001089 Ga0070713_10000108911 255
10 3300025906 Ga0207699_10070363 Ga0207699_100703633 255
11 3300025928 Ga0207700_10003418 Ga0207700_1000341811 255
12 3300025929 Ga0207664_10037330 Ga0207664_100373304 255
13 3300035724 Ga0373933_0270901 Ga0373933_0270901_26_811 255
14 3300036401 Ga0373937_0009455 Ga0373937_0009455_1204_1989 255
15 3300005545 Ga0070695_100016127 Ga0070695_1000161275 257
16 3300005546 Ga0070696_100050702 Ga0070696_1000507022 257
17 3300005456 Ga0070678_100027943 Ga0070678_1000279432 260
18 3300005535 Ga0070684_100137399 Ga0070684_1001373991 260
19 3300031711 Ga0265314_10022469 Ga0265314_100224696 262
20 3300031712 Ga0265342_10013118 Ga0265342_100131185 262
21 3300005334 Ga0068869_100437950 Ga0068869_1004379502 263
22 3300005340 Ga0070689_100056515 Ga0070689_1000565153 263
23 3300005354 Ga0070675_100000173 Ga0070675_10000017310 263
24 3300005364 Ga0070673_100016284 Ga0070673_1000162844 263
25 3300005367 Ga0070667_100008750 Ga0070667_1000087504 263
26 3300005456 Ga0070678_100067807 Ga0070678_1000678072 263
27 3300005466 Ga0070685_10036649 Ga0070685_100366492 263
28 3300005543 Ga0070672_100070414 Ga0070672_1000704142 263
29 3300005564 Ga0070664_100054501 Ga0070664_1000545014 263
30 3300005617 Ga0068859_100069643 Ga0068859_1000696434 263
31 3300005618 Ga0068864_100069903 Ga0068864_1000699033 263
32 3300005841 Ga0068863_100001626 Ga0068863_1000016263 263
33 3300005842 Ga0068858_100056308 Ga0068858_1000563084 263
34 3300005843 Ga0068860_100004829 Ga0068860_1000048298 263
35 3300006237 Ga0097621_100005805 Ga0097621_1000058056 263
36 3300006931 Ga0097620_100069643 Ga0097620_1000696432 263
37 3300009177 Ga0105248_10000511 Ga0105248_1000051118 263
38 3300013296 Ga0157374_10021545 Ga0157374_100215453 263
39 3300013306 Ga0163162_10010902 Ga0163162_100109024 263
40 3300013308 Ga0157375_10010347 Ga0157375_100103474 263
41 3300014968 Ga0157379_10000414 Ga0157379_1000041419 263
42 3300025926 Ga0207659_10001425 Ga0207659_1000142510 263
43 3300025940 Ga0207691_10123847 Ga0207691_101238472 263
44 3300025942 Ga0207689_10419871 Ga0207689_104198711 263
45 3300025945 Ga0207679_10047128 Ga0207679_100471282 263
46 3300025960 Ga0207651_10011821 Ga0207651_100118214 263
47 3300025986 Ga0207658_10049997 Ga0207658_100499971 263
48 3300026035 Ga0207703_10455892 Ga0207703_104558922 263
49 3300026088 Ga0207641_10006123 Ga0207641_100061235 263
50 3300028381 Ga0268264_10021928 Ga0268264_100219283 263
51 3300031250 Ga0265331_10038562 Ga0265331_100385623 263
52 3300013308 Ga0157375_10304518 Ga0157375_103045182 264
53 3300035724 Ga0373933_0298677 Ga0373933_0298677_50_913 266
54 3300037068 Ga0373925_0169926 Ga0373925_0169926_532_1395 266
55 3300046472 Ga0495580_0031378 Ga0495580_0031378_198_1061 266
56 3300005330 Ga0070690_100153375 Ga0070690_1001533752 267
57 3300005335 Ga0070666_10171588 Ga0070666_101715882 267
58 3300005340 Ga0070689_100042658 Ga0070689_1000426585 267
59 3300005354 Ga0070675_100000413 Ga0070675_10000041324 267
60 3300005364 Ga0070673_100208615 Ga0070673_1002086152 267
61 3300005617 Ga0068859_100000161 Ga0068859_10000016118 267
62 3300006931 Ga0097620_100000161 Ga0097620_10000016118 267
63 3300009177 Ga0105248_10050139 Ga0105248_100501393 267
64 3300014326 Ga0157380_10020746 Ga0157380_100207467 267
65 3300025926 Ga0207659_10006021 Ga0207659_100060218 267
66 3300025936 Ga0207670_10011610 Ga0207670_100116103 267
67 3300025941 Ga0207711_10217607 Ga0207711_102176072 267
68 3300053139 Ga0500568_0000749 Ga0500568_0000749_3703_4617 267
69 3300046477 Ga0495664_0191029 Ga0495664_0191029_41_859 268
70 3300050512 nmdc:mga0n895_61724_c1 nmdc:mga0n895_61724_c1_718_1698 279
71 3300005445 Ga0070708_100173867 Ga0070708_1001738672 280
72 3300037068 Ga0373925_0098498 Ga0373925_0098498_566_1513 286
73 3300050507 nmdc:mga05p37_32072_c1 nmdc:mga05p37_32072_c1_5105_6097 286
74 3300050515 nmdc:mga0a205_312738_c1 nmdc:mga0a205_312738_c1_141_1004 286
75 3300005440 Ga0070705_100009312 Ga0070705_1000093123 290
76 3300005444 Ga0070694_100000733 Ga0070694_10000073315 290
77 3300005471 Ga0070698_100005682 Ga0070698_1000056822 290
78 3300005518 Ga0070699_100001609 Ga0070699_1000016093 290
79 3300005546 Ga0070696_100002056 Ga0070696_1000020562 290
80 3300005549 Ga0070704_100001156 Ga0070704_1000011563 290
81 3300014325 Ga0163163_10084724 Ga0163163_100847243 290
82 3300005518 Ga0070699_100167805 Ga0070699_1001678052 291
83 3300005546 Ga0070696_100034651 Ga0070696_1000346511 291
84 3300007076 Ga0075435_100245108 Ga0075435_1002451082 291
85 3300009147 Ga0114129_10012911 Ga0114129_1001291114 291
86 3300050515 nmdc:mga0a205_67287_c1 nmdc:mga0a205_67287_c1_1295_2275 291
87 3300005440 Ga0070705_100026527 Ga0070705_1000265273 292
88 3300005471 Ga0070698_100007846 Ga0070698_1000078462 292
89 3300007076 Ga0075435_100188587 Ga0075435_1001885872 292
90 3300045051 Ga0451576_0015184 Ga0451576_0015184_5488_6444 292
91 3300006871 Ga0075434_100003262 Ga0075434_1000032624 293
92 3300049593 Ga0501077_0029151 Ga0501077_0029151_103_1065 293
93 3300007265 Ga0099794_10035671 Ga0099794_100356712 294
94 3300009545 Ga0105237_10008797 Ga0105237_100087974 294
95 3300010375 Ga0105239_10015025 Ga0105239_100150256 295
96 3300013105 Ga0157369_10016546 Ga0157369_100165465 295
97 3300036401 Ga0373937_0261091 Ga0373937_0261091_21_941 295
98 3300046536 Ga0495587_0037679 Ga0495587_0037679_25_945 295
99 3300046679 Ga0495623_0001231 Ga0495623_0001231_35_955 295
100 3300009551 Ga0105238_10276606 Ga0105238_102766062 296
101 3300013296 Ga0157374_10300727 Ga0157374_103007271 296
102 3300013307 Ga0157372_10020183 Ga0157372_100201835 296
103 3300014325 Ga0163163_10219391 Ga0163163_102193912 296
104 3300046525 Ga0495663_0057310 Ga0495663_0057310_208_1119 296
105 3300009093 Ga0105240_10293034 Ga0105240_102930341 298
106 3300009174 Ga0105241_10091945 Ga0105241_100919452 298
107 3300005335 Ga0070666_10084797 Ga0070666_100847972 299
108 3300005338 Ga0068868_100452269 Ga0068868_1004522691 299
109 3300005340 Ga0070689_100086795 Ga0070689_1000867953 299
110 3300005343 Ga0070687_100085182 Ga0070687_1000851822 299
111 3300005353 Ga0070669_100115116 Ga0070669_1001151163 299
112 3300005354 Ga0070675_100000093 Ga0070675_10000009313 299
113 3300005355 Ga0070671_100007337 Ga0070671_1000073374 299
114 3300005364 Ga0070673_100003330 Ga0070673_1000033309 299
115 3300005367 Ga0070667_100026133 Ga0070667_1000261333 299
116 3300005440 Ga0070705_100178953 Ga0070705_1001789532 299
117 3300005468 Ga0070707_100207070 Ga0070707_1002070702 299
118 3300005518 Ga0070699_100063563 Ga0070699_1000635632 299
119 3300005536 Ga0070697_100058190 Ga0070697_1000581903 299
120 3300005543 Ga0070672_100008033 Ga0070672_1000080332 299
121 3300005546 Ga0070696_100190908 Ga0070696_1001909081 299
122 3300005549 Ga0070704_100098014 Ga0070704_1000980142 299
123 3300005617 Ga0068859_100001946 Ga0068859_10000194617 299
124 3300005618 Ga0068864_100120839 Ga0068864_1001208393 299
125 3300005841 Ga0068863_100001065 Ga0068863_1000010654 299
126 3300005842 Ga0068858_100061214 Ga0068858_1000612144 299
127 3300005843 Ga0068860_100001147 Ga0068860_1000011476 299
128 3300006237 Ga0097621_100116556 Ga0097621_1001165563 299
129 3300006358 Ga0068871_100027085 Ga0068871_1000270852 299
130 3300006852 Ga0075433_10138946 Ga0075433_101389462 299
131 3300006931 Ga0097620_100001946 Ga0097620_10000194617 299
132 3300007076 Ga0075435_100049738 Ga0075435_1000497382 299
133 3300009101 Ga0105247_10027869 Ga0105247_100278693 299
134 3300009177 Ga0105248_10000212 Ga0105248_1000021255 299
135 3300010375 Ga0105239_10106246 Ga0105239_101062462 299
136 3300013308 Ga0157375_10000265 Ga0157375_1000026538 299
137 3300014968 Ga0157379_10000041 Ga0157379_1000004121 299
138 3300017792 Ga0163161_10020341 Ga0163161_100203411 299
139 3300025900 Ga0207710_10019346 Ga0207710_100193463 299
140 3300025922 Ga0207646_10318615 Ga0207646_103186151 299
141 3300025923 Ga0207681_10171432 Ga0207681_101714322 299
142 3300025926 Ga0207659_10000149 Ga0207659_100001492 299
143 3300025926 Ga0207659_10516209 Ga0207659_105162091 299
144 3300025931 Ga0207644_10014016 Ga0207644_100140162 299
145 3300025941 Ga0207711_10001894 Ga0207711_100018944 299
146 3300025945 Ga0207679_10020015 Ga0207679_100200152 299
147 3300025960 Ga0207651_10003501 Ga0207651_100035012 299
148 3300026035 Ga0207703_10032572 Ga0207703_100325721 299
149 3300026088 Ga0207641_10000819 Ga0207641_100008195 299
150 3300026095 Ga0207676_10272885 Ga0207676_102728851 299
151 3300028381 Ga0268264_10005613 Ga0268264_100056134 299
152 3300005468 Ga0070707_100010061 Ga0070707_1000100613 300
153 3300025922 Ga0207646_10023827 Ga0207646_100238273 300
154 3300045051 Ga0451576_0179531 Ga0451576_0179531_1273_2181 300
155 3300047319 Ga0495674_0478434 Ga0495674_0478434_67_981 300
156 3300005445 Ga0070708_100253660 Ga0070708_1002536602 301
157 3300005471 Ga0070698_100007072 Ga0070698_1000070722 301
158 3300005518 Ga0070699_100000583 Ga0070699_10000058313 301
159 3300005546 Ga0070696_100252782 Ga0070696_1002527822 301
160 3300005549 Ga0070704_100013795 Ga0070704_1000137954 301
161 3300005471 Ga0070698_100247410 Ga0070698_1002474102 303
162 3300005842 Ga0068858_100043953 Ga0068858_1000439532 303
163 3300014968 Ga0157379_10542578 Ga0157379_105425781 303
164 3300036401 Ga0373937_0150474 Ga0373937_0150474_1176_2087 303
165 3300005436 Ga0070713_100570711 Ga0070713_1005707111 304
166 3300026035 Ga0207703_10119141 Ga0207703_101191411 304
167 3300035724 Ga0373933_0139739 Ga0373933_0139739_250_1236 304
168 3300036401 Ga0373937_0025174 Ga0373937_0025174_2085_3005 305
169 3300045051 Ga0451576_0004185 Ga0451576_0004185_1236_2174 305
170 3300047444 Ga0495675_0018604 Ga0495675_0018604_146_1066 305
171 3300006844 Ga0075428_100017747 Ga0075428_1000177475 306
172 3300036401 Ga0373937_0120640 Ga0373937_0120640_801_1724 306
173 3300046454 Ga0495592_0094399 Ga0495592_0094399_325_1248 306
174 3300046536 Ga0495587_0005988 Ga0495587_0005988_3841_4764 306
175 3300048088 Ga0495602_0047647 Ga0495602_0047647_1906_2829 306
176 3300005329 Ga0070683_100068666 Ga0070683_1000686662 307
177 3300006237 Ga0097621_100096950 Ga0097621_1000969502 307
178 3300006358 Ga0068871_100022259 Ga0068871_1000222595 307
179 3300009093 Ga0105240_10481724 Ga0105240_104817242 307
180 3300009098 Ga0105245_10006558 Ga0105245_100065589 307
181 3300009098 Ga0105245_10042365 Ga0105245_100423651 307
182 3300009177 Ga0105248_10014685 Ga0105248_100146856 307
183 3300009551 Ga0105238_10008181 Ga0105238_100081817 307
184 3300011119 Ga0105246_10026373 Ga0105246_100263732 307
185 3300013297 Ga0157378_10007018 Ga0157378_100070189 307
186 3300013306 Ga0163162_10224699 Ga0163162_102246992 307
187 3300014969 Ga0157376_10049591 Ga0157376_100495914 307
188 3300025913 Ga0207695_10254613 Ga0207695_102546132 307
189 3300025914 Ga0207671_10029567 Ga0207671_100295672 307
190 3300025927 Ga0207687_10002463 Ga0207687_100024633 307
191 3300025927 Ga0207687_10016738 Ga0207687_100167385 307
192 3300025941 Ga0207711_10005536 Ga0207711_100055367 307
193 3300025944 Ga0207661_10025917 Ga0207661_100259173 307
194 3300025944 Ga0207661_10054908 Ga0207661_100549084 307
195 3300031711 Ga0265314_10004161 Ga0265314_100041612 307
196 3300035089 Ga0373944_0012165 Ga0373944_0012165_52_1017 307
197 3300046477 Ga0495664_0259425 Ga0495664_0259425_24_989 307
198 3300046499 Ga0495594_0014378 Ga0495594_0014378_2860_3825 307
199 3300046526 Ga0495666_0093307 Ga0495666_0093307_139_1104 307
200 3300046531 Ga0495665_0024575 Ga0495665_0024575_2166_3131 307
201 3300046535 Ga0495586_0012789 Ga0495586_0012789_2615_3580 307
202 3300046642 Ga0495634_0027068 Ga0495634_0027068_1765_2730 307
203 3300046674 Ga0495588_0147157 Ga0495588_0147157_17_952 307
204 3300047315 Ga0495581_0071745 Ga0495581_0071745_701_1666 307
205 3300048905 Ga0496102_0312366 Ga0496102_0312366_105_1028 307
206 3300005518 Ga0070699_100014311 Ga0070699_1000143112 308
207 3300005546 Ga0070696_100062388 Ga0070696_1000623882 308
208 3300005549 Ga0070704_100163511 Ga0070704_1001635112 308
209 3300005563 Ga0068855_100012187 Ga0068855_10001218710 308
210 3300006852 Ga0075433_10197243 Ga0075433_101972432 308
211 3300007076 Ga0075435_100011219 Ga0075435_1000112194 308
212 3300009093 Ga0105240_10001609 Ga0105240_100016094 308
213 3300009147 Ga0114129_10077282 Ga0114129_100772823 308
214 3300013104 Ga0157370_10000946 Ga0157370_1000094624 308
215 3300013105 Ga0157369_10020523 Ga0157369_100205236 308
216 3300013307 Ga0157372_10020539 Ga0157372_100205392 308
217 3300014326 Ga0157380_10220326 Ga0157380_102203263 308
218 3300025913 Ga0207695_10008926 Ga0207695_100089269 308
219 3300025922 Ga0207646_10042633 Ga0207646_100426332 308
220 3300025949 Ga0207667_10015941 Ga0207667_100159414 308
221 3300046472 Ga0495580_0019731 Ga0495580_0019731_3544_4524 308
222 3300050507 nmdc:mga05p37_18938_c1 nmdc:mga05p37_18938_c1_463_1395 308
223 3300050513 nmdc:mga0rr50_223192_c1 nmdc:mga0rr50_223192_c1_221_1153 308
224 3300050515 nmdc:mga0a205_155815_c1 nmdc:mga0a205_155815_c1_943_1875 308
225 3300005355 Ga0070671_100009227 Ga0070671_1000092272 309
226 3300005355 Ga0070671_100131888 Ga0070671_1001318881 309
227 3300005364 Ga0070673_100069866 Ga0070673_1000698664 309
228 3300005364 Ga0070673_100463228 Ga0070673_1004632282 309
229 3300005438 Ga0070701_10148434 Ga0070701_101484341 309
230 3300005444 Ga0070694_100187585 Ga0070694_1001875852 309
231 3300005457 Ga0070662_100233894 Ga0070662_1002338942 309
232 3300005459 Ga0068867_100249477 Ga0068867_1002494772 309
233 3300005459 Ga0068867_100250579 Ga0068867_1002505792 309
234 3300005471 Ga0070698_100051432 Ga0070698_1000514322 309
235 3300005518 Ga0070699_100132767 Ga0070699_1001327672 309
236 3300005535 Ga0070684_100019645 Ga0070684_1000196456 309
237 3300005545 Ga0070695_100000219 Ga0070695_1000002199 309
238 3300005545 Ga0070695_100102067 Ga0070695_1001020671 309
239 3300005546 Ga0070696_100000188 Ga0070696_10000018825 309
240 3300005547 Ga0070693_100245459 Ga0070693_1002454591 309
241 3300005549 Ga0070704_100047069 Ga0070704_1000470692 309
242 3300005549 Ga0070704_100060078 Ga0070704_1000600782 309
243 3300005549 Ga0070704_100128331 Ga0070704_1001283312 309
244 3300005563 Ga0068855_100062315 Ga0068855_1000623155 309
245 3300005577 Ga0068857_100095280 Ga0068857_1000952802 309
246 3300005614 Ga0068856_100106576 Ga0068856_1001065762 309
247 3300005615 Ga0070702_100066804 Ga0070702_1000668042 309
248 3300005841 Ga0068863_100302376 Ga0068863_1003023762 309
249 3300006358 Ga0068871_100238356 Ga0068871_1002383562 309
250 3300006871 Ga0075434_100065012 Ga0075434_1000650125 309
251 3300006871 Ga0075434_100171562 Ga0075434_1001715622 309
252 3300009147 Ga0114129_10009049 Ga0114129_1000904911 309
253 3300009148 Ga0105243_10029290 Ga0105243_100292904 309
254 3300009551 Ga0105238_10052656 Ga0105238_100526566 309
255 3300010375 Ga0105239_10050596 Ga0105239_100505964 309
256 3300014969 Ga0157376_10480556 Ga0157376_104805562 309
257 3300025911 Ga0207654_10134131 Ga0207654_101341312 309
258 3300025924 Ga0207694_10063967 Ga0207694_100639672 309
259 3300025933 Ga0207706_10065367 Ga0207706_100653674 309
260 3300025935 Ga0207709_10018819 Ga0207709_100188192 309
261 3300025940 Ga0207691_10067645 Ga0207691_100676452 309
262 3300025944 Ga0207661_10087279 Ga0207661_100872794 309
263 3300026035 Ga0207703_10096301 Ga0207703_100963011 309
264 3300026089 Ga0207648_10113254 Ga0207648_101132541 309
265 3300026089 Ga0207648_10364060 Ga0207648_103640601 309
266 3300026095 Ga0207676_10117149 Ga0207676_101171492 309
267 3300026116 Ga0207674_10054819 Ga0207674_100548192 309
268 3300045051 Ga0451576_0194301 Ga0451576_0194301_496_1434 309
269 3300046520 Ga0495637_0124550 Ga0495637_0124550_18_953 309
270 3300046525 Ga0495663_0065558 Ga0495663_0065558_138_1073 309
271 3300046528 Ga0495642_0033604 Ga0495642_0033604_271_1206 309
272 3300046537 Ga0495598_0015437 Ga0495598_0015437_287_1225 309
273 3300046538 Ga0495609_0048595 Ga0495609_0048595_374_1312 309
274 3300046539 Ga0495621_0000429 Ga0495621_0000429_6295_7233 309
275 3300046664 Ga0495659_0001322 Ga0495659_0001322_1504_2442 309
276 3300046684 Ga0495669_0030327 Ga0495669_0030327_412_1350 309
277 3300046689 Ga0495613_0004436 Ga0495613_0004436_6524_7492 309
278 3300047315 Ga0495581_0042882 Ga0495581_0042882_1248_2216 309
279 3300047318 Ga0495636_0048807 Ga0495636_0048807_722_1657 309
280 3300050512 nmdc:mga0n895_192762_c1 nmdc:mga0n895_192762_c1_939_1877 309
281 3300050515 nmdc:mga0a205_70659_c1 nmdc:mga0a205_70659_c1_1296_2231 309
282 3300005331 Ga0070670_100076749 Ga0070670_1000767492 310
283 3300005338 Ga0068868_100241025 Ga0068868_1002410251 310
284 3300005438 Ga0070701_10184963 Ga0070701_101849631 310
285 3300005457 Ga0070662_100065442 Ga0070662_1000654422 310
286 3300005468 Ga0070707_100054382 Ga0070707_1000543824 310
287 3300005545 Ga0070695_100058796 Ga0070695_1000587963 310
288 3300005564 Ga0070664_100386820 Ga0070664_1003868201 310
289 3300006844 Ga0075428_100296256 Ga0075428_1002962562 310
290 3300006871 Ga0075434_100431223 Ga0075434_1004312231 310
291 3300006880 Ga0075429_100068947 Ga0075429_1000689472 310
292 3300006881 Ga0068865_100196496 Ga0068865_1001964962 310
293 3300006914 Ga0075436_100178131 Ga0075436_1001781312 310
294 3300007076 Ga0075435_100034374 Ga0075435_1000343744 310
295 3300009177 Ga0105248_10202656 Ga0105248_102026562 310
296 3300013308 Ga0157375_10014300 Ga0157375_100143005 310
297 3300025907 Ga0207645_10101219 Ga0207645_101012192 310
298 3300025911 Ga0207654_10050242 Ga0207654_100502422 310
299 3300025914 Ga0207671_10333469 Ga0207671_103334691 310
300 3300025916 Ga0207663_10117663 Ga0207663_101176632 310
301 3300025922 Ga0207646_10078815 Ga0207646_100788152 310
302 3300025925 Ga0207650_10035701 Ga0207650_100357012 310
303 3300025933 Ga0207706_10150863 Ga0207706_101508632 310
304 3300025945 Ga0207679_10396666 Ga0207679_103966662 310
305 3300026078 Ga0207702_10065943 Ga0207702_100659433 310
306 3300035083 Ga0373926_0003476 Ga0373926_0003476_1310_2278 310
307 3300035118 Ga0373954_0012682 Ga0373954_0012682_2407_3375 310
308 3300035692 Ga0373935_0013153 Ga0373935_0013153_1864_2832 310
309 3300046454 Ga0495592_0094406 Ga0495592_0094406_241_1209 310
310 3300046462 Ga0495651_0000099 Ga0495651_0000099_20608_21576 310
311 3300046463 Ga0495653_0047222 Ga0495653_0047222_2274_3242 310
312 3300046463 Ga0495653_0135213 Ga0495653_0135213_276_1244 310
313 3300046472 Ga0495580_0036527 Ga0495580_0036527_2255_3223 310
314 3300046472 Ga0495580_0084019 Ga0495580_0084019_178_1113 310
315 3300046514 Ga0495618_0243495 Ga0495618_0243495_75_1043 310
316 3300046516 Ga0495628_0018658 Ga0495628_0018658_1950_2918 310
317 3300046516 Ga0495628_0029183 Ga0495628_0029183_140_1108 310
318 3300046517 Ga0495630_0295191 Ga0495630_0295191_17_985 310
319 3300046526 Ga0495666_0049909 Ga0495666_0049909_635_1603 310
320 3300046529 Ga0495652_0029334 Ga0495652_0029334_1682_2650 310
321 3300046531 Ga0495665_0001199 Ga0495665_0001199_1141_2109 310
322 3300046535 Ga0495586_0001550 Ga0495586_0001550_11620_12588 310
323 3300046539 Ga0495621_0002084 Ga0495621_0002084_3796_4737 310
324 3300046559 Ga0495667_0008081 Ga0495667_0008081_4979_5947 310
325 3300046559 Ga0495667_0009592 Ga0495667_0009592_5489_6457 310
326 3300046663 Ga0495635_0039812 Ga0495635_0039812_975_1943 310
327 3300046664 Ga0495659_0003521 Ga0495659_0003521_1039_1980 310
328 3300046664 Ga0495659_0020768 Ga0495659_0020768_905_1846 310
329 3300046678 Ga0495599_0054465 Ga0495599_0054465_1429_2397 310
330 3300046680 Ga0495646_0011931 Ga0495646_0011931_639_1607 310
331 3300046690 Ga0495624_0005543 Ga0495624_0005543_7235_8203 310
332 3300046809 Ga0495600_0097353 Ga0495600_0097353_862_1830 310
333 3300046809 Ga0495600_0175801 Ga0495600_0175801_253_1221 310
334 3300047317 Ga0495604_0002659 Ga0495604_0002659_4232_5200 310
335 3300047317 Ga0495604_0009300 Ga0495604_0009300_4827_5795 310
336 3300047318 Ga0495636_0019599 Ga0495636_0019599_544_1485 310
337 3300047444 Ga0495675_0001150 Ga0495675_0001150_117_1085 310
338 3300047444 Ga0495675_0092029 Ga0495675_0092029_807_1775 310
339 3300047471 Ga0495684_0009268 Ga0495684_0009268_5343_6311 310
340 3300048088 Ga0495602_0012048 Ga0495602_0012048_2925_3893 310
341 3300048089 Ga0495614_0022632 Ga0495614_0022632_693_1661 310
342 3300050512 nmdc:mga0n895_136636_c1 nmdc:mga0n895_136636_c1_1162_2103 310
343 3300050513 nmdc:mga0rr50_7224_c2 nmdc:mga0rr50_7224_c2_2061_3002 310
344 3300053078 Ga0495612_0008870 Ga0495612_0008870_53_1021 310
345 3300005616 Ga0068852_100451375 Ga0068852_1004513752 311
346 3300031595 Ga0265313_10001870 Ga0265313_100018708 311
347 3300046459 Ga0495629_0144485 Ga0495629_0144485_415_1431 311
348 3300005345 Ga0070692_10043331 Ga0070692_100433312 312
349 3300005365 Ga0070688_100035372 Ga0070688_1000353723 312
350 3300005615 Ga0070702_100039637 Ga0070702_1000396372 312
351 3300009147 Ga0114129_10066410 Ga0114129_100664102 312
352 3300009177 Ga0105248_10547059 Ga0105248_105470591 312
353 3300013296 Ga0157374_10046687 Ga0157374_100466873 312
354 3300013308 Ga0157375_10412951 Ga0157375_104129511 312
355 3300025934 Ga0207686_10021366 Ga0207686_100213661 312
356 3300035086 Ga0373934_0013218 Ga0373934_0013218_2077_3018 312
357 3300035111 Ga0373923_0011213 Ga0373923_0011213_1360_2301 312
358 3300035118 Ga0373954_0006692 Ga0373954_0006692_1822_2763 312
359 3300036401 Ga0373937_0037708 Ga0373937_0037708_2771_3712 312
360 3300046537 Ga0495598_0017050 Ga0495598_0017050_358_1302 312
361 3300046559 Ga0495667_0059700 Ga0495667_0059700_995_1936 312
362 3300047444 Ga0495675_0066709 Ga0495675_0066709_735_1730 312
363 3300050508 nmdc:mga09592_413285_c1 nmdc:mga09592_413285_c1_84_1046 312
364 3300050509 nmdc:mga0qj67_132157_c1 nmdc:mga0qj67_132157_c1_130_1092 312
365 3300050510 nmdc:mga06r32_252332_c1 nmdc:mga06r32_252332_c1_723_1685 312
366 3300009098 Ga0105245_10100336 Ga0105245_101003363 313
367 3300009147 Ga0114129_10009049 Ga0114129_100090499 313
368 3300050507 nmdc:mga05p37_36701_c1 nmdc:mga05p37_36701_c1_2121_3080 313
369 3300006871 Ga0075434_100003262 Ga0075434_1000032626 314
370 3300005444 Ga0070694_100018041 Ga0070694_1000180413 315
371 3300005471 Ga0070698_100032318 Ga0070698_1000323182 315
372 3300005518 Ga0070699_100123113 Ga0070699_1001231132 315
373 3300005546 Ga0070696_100036776 Ga0070696_1000367763 315
374 3300005549 Ga0070704_100041241 Ga0070704_1000412412 315
375 3300006852 Ga0075433_10135805 Ga0075433_101358053 315
376 3300048918 Ga0496115_0227613 Ga0496115_0227613_238_1197 315
377 3300050507 nmdc:mga05p37_503404_c1 nmdc:mga05p37_503404_c1_20_1000 315
378 3300050512 nmdc:mga0n895_145840_c1 nmdc:mga0n895_145840_c1_435_1415 315
379 3300005440 Ga0070705_100002127 Ga0070705_1000021279 316
380 3300005444 Ga0070694_100003516 Ga0070694_1000035167 316
381 3300005444 Ga0070694_100139408 Ga0070694_1001394081 316
382 3300005468 Ga0070707_100047693 Ga0070707_1000476932 316
383 3300005518 Ga0070699_100014311 Ga0070699_1000143114 316
384 3300005536 Ga0070697_100056829 Ga0070697_1000568293 316
385 3300005545 Ga0070695_100000219 Ga0070695_1000002197 316
386 3300005546 Ga0070696_100000188 Ga0070696_10000018827 316
387 3300005615 Ga0070702_100034512 Ga0070702_1000345123 316
388 3300006844 Ga0075428_100027920 Ga0075428_1000279202 316
389 3300006846 Ga0075430_100455915 Ga0075430_1004559151 316
390 3300006852 Ga0075433_10102987 Ga0075433_101029872 316
391 3300006871 Ga0075434_100201768 Ga0075434_1002017682 316
392 3300007076 Ga0075435_100011219 Ga0075435_1000112196 316
393 3300009147 Ga0114129_10000796 Ga0114129_1000079620 316
394 3300009148 Ga0105243_10029290 Ga0105243_100292902 316
395 3300025922 Ga0207646_10042633 Ga0207646_100426334 316
396 3300025935 Ga0207709_10018819 Ga0207709_100188194 316
397 3300046491 Ga0495584_0012293 Ga0495584_0012293_272_1255 316
398 3300046525 Ga0495663_0014911 Ga0495663_0014911_475_1458 316
399 3300046539 Ga0495621_0062588 Ga0495621_0062588_112_1095 316
400 3300046664 Ga0495659_0008775 Ga0495659_0008775_574_1557 316
401 3300047318 Ga0495636_0061467 Ga0495636_0061467_498_1481 316
402 3300050507 nmdc:mga05p37_2143_c1 nmdc:mga05p37_2143_c1_11481_12467 316
403 3300050512 nmdc:mga0n895_98621_c1 nmdc:mga0n895_98621_c1_1102_2088 316
404 3300050513 nmdc:mga0rr50_28895_c1 nmdc:mga0rr50_28895_c1_1744_2721 316
405 3300050515 nmdc:mga0a205_120939_c1 nmdc:mga0a205_120939_c1_1289_2266 316
406 3300035115 Ga0373941_0024599 Ga0373941_0024599_682_1644 317
407 3300035691 Ga0373931_0068851 Ga0373931_0068851_836_1798 317
408 3300006847 Ga0075431_100007116 Ga0075431_1000071166 318
409 3300046683 Ga0495658_0017651 Ga0495658_0017651_2282_3265 318
410 3300050507 nmdc:mga05p37_269950_c1 nmdc:mga05p37_269950_c1_563_1552 318
411 3300053139 Ga0500568_0032043 Ga0500568_0032043_568_1530 318
412 3300009094 Ga0111539_10007902 Ga0111539_100079024 319
413 3300009551 Ga0105238_10027385 Ga0105238_100273855 319
414 3300025929 Ga0207664_10395219 Ga0207664_103952192 319
415 3300006871 Ga0075434_100190595 Ga0075434_1001905952 321
416 3300005331 Ga0070670_100000419 Ga0070670_10000041932 323
417 3300005335 Ga0070666_10083885 Ga0070666_100838852 323
418 3300005338 Ga0068868_100000775 Ga0068868_1000007757 323
419 3300005340 Ga0070689_100086462 Ga0070689_1000864623 323
420 3300005344 Ga0070661_100047111 Ga0070661_1000471112 323
421 3300005354 Ga0070675_100002006 Ga0070675_1000020065 323
422 3300005354 Ga0070675_100104700 Ga0070675_1001047002 323
423 3300005354 Ga0070675_100194198 Ga0070675_1001941982 323
424 3300005365 Ga0070688_100050349 Ga0070688_1000503491 323
425 3300005367 Ga0070667_100008037 Ga0070667_1000080378 323
426 3300005436 Ga0070713_100002372 Ga0070713_1000023727 323
427 3300005548 Ga0070665_100267482 Ga0070665_1002674821 323
428 3300005564 Ga0070664_100000131 Ga0070664_10000013128 323
429 3300005614 Ga0068856_100069252 Ga0068856_1000692523 323
430 3300005617 Ga0068859_100008877 Ga0068859_1000088773 323
431 3300005617 Ga0068859_100193541 Ga0068859_1001935412 323
432 3300005618 Ga0068864_100000280 Ga0068864_10000028041 323
433 3300005618 Ga0068864_100083081 Ga0068864_1000830813 323
434 3300005618 Ga0068864_100146670 Ga0068864_1001466701 323
435 3300005719 Ga0068861_100218651 Ga0068861_1002186512 323
436 3300005834 Ga0068851_10051145 Ga0068851_100511452 323
437 3300005841 Ga0068863_100038749 Ga0068863_1000387495 323
438 3300005841 Ga0068863_100560933 Ga0068863_1005609331 323
439 3300005844 Ga0068862_100123977 Ga0068862_1001239771 323
440 3300006358 Ga0068871_100024699 Ga0068871_1000246991 323
441 3300006931 Ga0097620_100008878 Ga0097620_1000088786 323
442 3300006931 Ga0097620_100193539 Ga0097620_1001935392 323
443 3300009094 Ga0111539_10142657 Ga0111539_101426573 323
444 3300009177 Ga0105248_10001915 Ga0105248_100019154 323
445 3300009553 Ga0105249_10245355 Ga0105249_102453552 323
446 3300013306 Ga0163162_10005106 Ga0163162_100051065 323
447 3300013308 Ga0157375_10001336 Ga0157375_1000133620 323
448 3300013308 Ga0157375_10262715 Ga0157375_102627152 323
449 3300014325 Ga0163163_10017826 Ga0163163_100178267 323
450 3300014325 Ga0163163_10036725 Ga0163163_100367254 323
451 3300014325 Ga0163163_10099654 Ga0163163_100996544 323
452 3300017792 Ga0163161_10264086 Ga0163161_102640862 323
453 3300025903 Ga0207680_10018986 Ga0207680_100189862 323
454 3300025925 Ga0207650_10007495 Ga0207650_100074952 323
455 3300025925 Ga0207650_10058640 Ga0207650_100586402 323
456 3300025928 Ga0207700_10002594 Ga0207700_100025944 323
457 3300025931 Ga0207644_10090011 Ga0207644_100900112 323
458 3300025941 Ga0207711_10008411 Ga0207711_100084114 323
459 3300025945 Ga0207679_10004811 Ga0207679_100048115 323
460 3300025986 Ga0207658_10047174 Ga0207658_100471742 323
461 3300026023 Ga0207677_10002810 Ga0207677_100028107 323
462 3300026088 Ga0207641_10055150 Ga0207641_100551502 323
463 3300026095 Ga0207676_10002761 Ga0207676_100027616 323
464 3300026116 Ga0207674_10167529 Ga0207674_101675292 323
465 3300026118 Ga0207675_100293670 Ga0207675_1002936702 323
466 3300028379 Ga0268266_10341914 Ga0268266_103419142 323
467 3300035117 Ga0373953_0002851 Ga0373953_0002851_3841_4824 323
468 3300036401 Ga0373937_0003261 Ga0373937_0003261_8361_9344 323
469 3300036401 Ga0373937_0090805 Ga0373937_0090805_471_1454 323
470 3300046454 Ga0495592_0003715 Ga0495592_0003715_172_1155 323
471 3300046472 Ga0495580_0176746 Ga0495580_0176746_157_1140 323
472 3300046473 Ga0495582_0195970 Ga0495582_0195970_34_1017 323
473 3300046477 Ga0495664_0087611 Ga0495664_0087611_333_1316 323
474 3300046511 Ga0495608_0003405 Ga0495608_0003405_7663_8646 323
475 3300046514 Ga0495618_0053368 Ga0495618_0053368_1239_2219 323
476 3300046559 Ga0495667_0000705 Ga0495667_0000705_8346_9329 323
477 3300046675 Ga0495657_0004299 Ga0495657_0004299_8432_9415 323
478 3300046681 Ga0495647_0063381 Ga0495647_0063381_169_1152 323
479 3300046689 Ga0495613_0006942 Ga0495613_0006942_4314_5294 323
480 3300047319 Ga0495674_0178883 Ga0495674_0178883_353_1333 323
481 3300050511 nmdc:mga08y16_38437_c1 nmdc:mga08y16_38437_c1_1595_2569 323
482 3300053085 Ga0495619_0094393 Ga0495619_0094393_544_1527 323
483 3300005617 Ga0068859_100199189 Ga0068859_1001991891 324
484 3300006931 Ga0097620_100199192 Ga0097620_1001991921 324
485 3300009177 Ga0105248_10013372 Ga0105248_100133727 324
486 3300005329 Ga0070683_100068226 Ga0070683_1000682263 325
487 3300005339 Ga0070660_100212972 Ga0070660_1002129721 325
488 3300005341 Ga0070691_10000667 Ga0070691_100006679 325
489 3300005354 Ga0070675_100116588 Ga0070675_1001165882 325
490 3300005458 Ga0070681_10021472 Ga0070681_100214723 325
491 3300005530 Ga0070679_100008841 Ga0070679_1000088413 325
492 3300005535 Ga0070684_100002037 Ga0070684_1000020373 325
493 3300005539 Ga0068853_100031857 Ga0068853_1000318572 325
494 3300005577 Ga0068857_100025506 Ga0068857_1000255063 325
495 3300005578 Ga0068854_100059834 Ga0068854_1000598343 325
496 3300005614 Ga0068856_100003282 Ga0068856_10000328211 325
497 3300005616 Ga0068852_100003962 Ga0068852_1000039622 325
498 3300005937 Ga0081455_10089287 Ga0081455_100892873 325
499 3300006844 Ga0075428_100055719 Ga0075428_1000557192 325
500 3300006846 Ga0075430_100028868 Ga0075430_1000288682 325
501 3300006847 Ga0075431_100141063 Ga0075431_1001410632 325
502 3300009093 Ga0105240_10010039 Ga0105240_1001003910 325
503 3300009094 Ga0111539_10029099 Ga0111539_100290996 325
504 3300009101 Ga0105247_10218174 Ga0105247_102181741 325
505 3300009545 Ga0105237_10006460 Ga0105237_100064603 325
506 3300009551 Ga0105238_10003466 Ga0105238_1000346610 325
507 3300010375 Ga0105239_10002868 Ga0105239_100028685 325
508 3300013102 Ga0157371_10016055 Ga0157371_100160555 325
509 3300013104 Ga0157370_10032571 Ga0157370_100325712 325
510 3300013105 Ga0157369_10002207 Ga0157369_1000220714 325
511 3300013307 Ga0157372_10040051 Ga0157372_100400511 325
512 3300025912 Ga0207707_10001181 Ga0207707_100011812 325
513 3300025913 Ga0207695_10014789 Ga0207695_100147895 325
514 3300025914 Ga0207671_10016000 Ga0207671_100160003 325
515 3300025919 Ga0207657_10021795 Ga0207657_100217955 325
516 3300025921 Ga0207652_10020563 Ga0207652_100205633 325
517 3300025924 Ga0207694_10001610 Ga0207694_100016105 325
518 3300025926 Ga0207659_10115754 Ga0207659_101157542 325
519 3300025949 Ga0207667_10000800 Ga0207667_100008003 325
520 3300025981 Ga0207640_10051399 Ga0207640_100513993 325
521 3300026078 Ga0207702_10047426 Ga0207702_100474262 325
522 3300026116 Ga0207674_10002433 Ga0207674_100024333 325
523 3300027907 Ga0207428_10010373 Ga0207428_100103736 325
524 3300037853 Ga0436364_1151733 Ga0436364_1151733_345_1331 325
525 3300039437 Ga0436365_0073611 Ga0436365_0073611_358_1344 325
526 3300050507 nmdc:mga05p37_268666_c1 nmdc:mga05p37_268666_c1_206_1237 325
527 3300050508 nmdc:mga09592_70083_c1 nmdc:mga09592_70083_c1_1333_2364 325
528 3300050509 nmdc:mga0qj67_72990_c1 nmdc:mga0qj67_72990_c1_453_1526 325
529 3300050510 nmdc:mga06r32_123043_c1 nmdc:mga06r32_123043_c1_443_1423 325
530 3300050510 nmdc:mga06r32_183841_c1 nmdc:mga06r32_183841_c1_344_1375 325
531 3300050511 nmdc:mga08y16_52674_c1 nmdc:mga08y16_52674_c1_1268_2344 325

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fp6-assembly11.cif.gz_V complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7884 222 243
5tz5-assembly1.cif.gz_B crystal structure of curk dehydratase h996f inactive mutant 0.7097 222 262
3kg9-assembly3.cif.gz_B dehydratase domain from curk module of curacin polyketide synthase 0.7069 222 262
5tz7-assembly1.cif.gz_B crystal structure of curk dehydratase d1169n inactive mutant 0.7052 222 262
7wkk-assembly1.cif.gz_f cryo-em structure of the ir subunit from x. laevis npc 0.6957 217 259
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7358 217 244 2.60.40.200
af_Q2FZ56_72_189_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7152 222 261 3.10.129.10
af_P0ADU7_21_135_2.30.31.10 Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Transcriptional Coactivator Pc4; Chain A 0.7017 221 259 2.30.31.10
3nwzD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6992 222 259 3.10.129.10
af_Q12028_718_826_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.6959 217 263 2.60.40.1230
ID Description Score Start End GO Terms
AF-A0A3D1IJC1-F1-model_v4 Uncharacterized protein 0.9374 158 276
AF-A0A1F2S872-F1-model_v4 Uncharacterized protein 0.9202 140 273
AF-A0A3D1IJC1-F1-model_v4 Uncharacterized protein 0.908 158 276
AF-A0A2V8I5A8-F1-model_v4 Uncharacterized protein 0.9064 160 270
AF-A0A2V8EJY4-F1-model_v4 Uncharacterized protein 0.9006 98 277

Feature Viewer

pLDDT pTM Quality
74.47 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map