F460125

General Info

Members Datasets Scaffolds Average Seq Length
531 413 313 258

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10409575|Ga0157374_104095752
Length 292
Sequence VCKPIEKERFLNFAVQSCDVTEIQLVLLQFLSAMKVVIFAGGLGTRIAEETGTRPKPMVEIGGKPILWHIMKIYSHYGFDDFIVCLGYKGFLIKEYFMQYYLHNSDITIELGSNKLDVHYTNAESFKVTLVDTGLSTKTAGRLKRIQKYIGNEDFMLTYGDGVADINLPELVKFHQSHGKIATVTGVQPEARFGGMEIGDGGVVETFKEKPKGDGKWVNGGFFVLRPEVFKYLEGDMDNTMWEDDPMEQLSKDHQLMAYKHYGFWKPMDAIRDKQELESLWLNNQAKWKIWQ

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
8 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
13 2516143018 Ensifer sp. BR816 Isolate Nodule
14 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
15 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
16 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
17 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
18 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
19 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
20 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
21 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
22 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
23 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
24 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
25 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
26 2643221557 Ensifer sp. Root558 Isolate Unclassified
27 2643221610 Ensifer sp. Root74 Isolate Unclassified
28 2643221618 Ensifer sp. Root231 Isolate Unclassified
29 2643221626 Ensifer sp. Root31 Isolate Unclassified
30 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
31 2643221655 Ensifer sp. Root1252 Isolate Unclassified
32 2643221659 Ensifer sp. Root127 Isolate Unclassified
33 2643221668 Ensifer sp. Root423 Isolate Unclassified
34 2643221675 Ensifer sp. Root1298 Isolate Unclassified
35 2643221680 Ensifer sp. Root1312 Isolate Unclassified
36 2643221698 Ensifer sp. Root142 Isolate Unclassified
37 2643221712 Ensifer sp. Root258 Isolate Unclassified
38 2643221723 Ensifer sp. Root278 Isolate Unclassified
39 2643221726 Ensifer sp. Root954 Isolate Unclassified
40 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
41 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
42 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
43 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
44 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
45 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
46 2844163670 Ensifer sp. 1H6 Isolate Unclassified
47 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
48 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
49 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
50 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
51 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
52 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
53 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
54 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
55 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
56 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
57 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
58 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
59 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
60 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
61 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
62 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
63 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
64 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
65 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
66 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
67 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
68 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
69 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
70 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
71 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
72 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
73 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
74 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
75 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
76 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
77 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
78 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
79 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
80 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
81 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
82 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
83 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
84 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
85 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
86 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
87 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
88 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
89 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
90 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
91 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
92 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
93 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
94 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
95 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
96 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
97 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
98 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
99 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
100 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
101 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
102 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
103 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
104 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
105 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
106 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
107 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
108 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
109 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
110 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
111 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
112 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
113 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
114 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
115 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
116 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
117 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
118 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
119 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
120 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
121 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
122 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
123 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
124 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
125 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
126 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
127 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
128 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
129 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
130 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
131 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
132 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
133 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
134 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
135 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
136 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
137 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
138 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
139 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
140 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
141 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
142 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
143 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
144 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
145 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
146 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
147 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
148 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
149 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
150 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
151 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
152 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
153 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
154 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
155 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
156 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
157 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
158 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
159 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
160 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
161 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
162 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
163 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
164 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
165 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
166 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
167 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
168 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
169 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
170 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
171 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
172 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
173 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
174 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
175 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
176 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
177 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
178 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
179 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
180 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
181 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
182 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
183 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
184 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
185 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
186 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
187 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
188 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
189 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
190 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
191 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
192 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
193 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
194 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
195 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
196 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
197 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
198 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
199 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
200 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
201 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
202 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
203 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
204 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
205 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
206 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
207 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
208 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
209 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
210 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
211 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
212 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
213 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
214 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
215 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
216 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
217 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
218 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
219 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
220 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
221 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
222 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
223 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
224 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
225 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
226 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
227 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
228 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
229 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
230 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
231 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
232 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
233 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
234 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
235 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
236 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
237 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
238 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
239 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
240 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
241 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
242 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
243 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
244 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
245 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
246 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
247 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
248 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
249 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
250 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
251 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
252 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
253 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
254 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
255 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
256 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
257 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
258 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
259 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
260 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
261 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
262 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
263 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
264 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
265 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
266 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
267 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
268 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
269 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
270 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
271 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
272 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
273 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
274 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
275 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
276 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
277 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
278 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
279 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
280 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
281 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
282 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
283 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
284 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
285 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
286 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
287 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
288 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
289 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
290 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
291 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
292 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
293 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
295 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
296 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
297 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
299 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
339 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
343 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
344 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
345 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
346 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
347 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
348 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
349 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
350 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
351 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
352 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
353 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
354 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
356 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
358 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
359 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
362 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
363 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
364 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
365 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
366 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
367 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
368 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
369 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
370 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
371 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
372 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
373 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
374 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
375 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
376 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
377 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
378 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
379 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
380 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
383 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
384 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
385 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
390 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
399 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
400 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
401 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
404 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
405 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
406 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
407 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
408 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
409 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
410 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
411 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
412 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
413 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 58.57
Metatranscriptomes 0.38
Isolates 41.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.17
Nodule 33.71
Rhizoplane 0.19
Rhizosphere 44.07
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002553 3300001989 Bacteria 7023
2 JGI25159J45721_1000008 3300002987 Bacteria 172667
3 JGI25151J46595_10008634 3300003187 Bacteria 4883
4 rootH1_10120272 3300003316 Bacteria 1690
5 rootH2_10001886 3300003320 Bacteria 115156
6 rootH2_10066609 3300003320 Bacteria 14446
7 rootL2_10060614 3300003322 Bacteria 16596
8 rootL2_10085508 3300003322 Bacteria 8931
9 rootL2_10231490 3300003322 Bacteria 2870
10 rootH1_10085513 3300003323 Unclassified 4067
11 rootH1_10162835 3300003323 Bacteria 1362
12 JGI25160J50197_1000033 3300003354 Bacteria 172667
13 JGI25160J50197_1002152 3300003354 Bacteria 9325
14 Ga0055538_1000258 3300003751 Bacteria 28031
15 Ga0055526_1000440 3300003771 Bacteria 33129
16 Ga0055526_1010181 3300003771 Bacteria 4408
17 Ga0055526_1040718 3300003771 Bacteria 1167
18 Ga0055524_1001377 3300003775 Bacteria 14116
19 Ga0055524_1003372 3300003775 Bacteria 7783
20 Ga0055528_1000281 3300003790 Bacteria 43508
21 Ga0055528_1001633 3300003790 Bacteria 13218
22 Ga0055528_1001646 3300003790 Bacteria 13151
23 Ga0055530_10003030 3300003791 Bacteria 10044
24 Ga0055530_10041531 3300003791 Bacteria 1122
25 Ga0055540_1018119 3300003792 Bacteria 1940
26 Ga0055531_10046033 3300003794 Bacteria 1204
27 Ga0058692_1000104 3300003856 Bacteria 56053
28 Ga0055543_1000026 3300004625 Bacteria 136177
29 Ga0065165_1000056 3300005262 Bacteria 186730
30 Ga0065165_1000178 3300005262 Bacteria 113319
31 Ga0070658_10036474 3300005327 Bacteria 3963
32 Ga0070658_10324177 3300005327 Bacteria 1316
33 Ga0070683_100004697 3300005329 Bacteria 11289
34 Ga0070670_100008152 3300005331 Bacteria 8920
35 Ga0068869_100003400 3300005334 Bacteria 9719
36 Ga0068869_100124454 3300005334 Bacteria 1976
37 Ga0068869_100357446 3300005334 Bacteria 1192
38 Ga0070666_10000077 3300005335 Bacteria 70693
39 Ga0070682_100000031 3300005337 Bacteria 156874
40 Ga0070682_100119623 3300005337 Unclassified 1766
41 Ga0068868_100009336 3300005338 Bacteria 7051
42 Ga0070660_100162491 3300005339 Unclassified 1800
43 Ga0070661_100001497 3300005344 Bacteria 16234
44 Ga0070668_100087355 3300005347 Bacteria 2453
45 Ga0070669_100025327 3300005353 Bacteria 4260
46 Ga0070671_100186006 3300005355 Unclassified 1760
47 Ga0070671_100323733 3300005355 Bacteria 1314
48 Ga0070659_100013050 3300005366 Bacteria 6179
49 Ga0070714_100120952 3300005435 Archaea 2329
50 Ga0070713_100131316 3300005436 Bacteria 2209
51 Ga0070706_100002076 3300005467 Bacteria 20431
52 Ga0070706_100107449 3300005467 Bacteria 2596
53 Ga0070698_100281981 3300005471 Bacteria 1593
54 Ga0070684_100000583 3300005535 Bacteria 25310
55 Ga0068853_100002378 3300005539 Bacteria 14065
56 Ga0068853_100096516 3300005539 Bacteria 2608
57 Ga0068855_100011767 3300005563 Bacteria 10579
58 Ga0070664_100000695 3300005564 Bacteria 25669
59 Ga0068857_100000997 3300005577 Bacteria 21768
60 Ga0068856_100098901 3300005614 Bacteria 2908
61 Ga0068856_100232656 3300005614 Bacteria 1858
62 Ga0068856_100354715 3300005614 Bacteria 1485
63 Ga0068852_100080366 3300005616 Bacteria 2890
64 Ga0068852_100562001 3300005616 Unclassified 1142
65 Ga0068852_100659191 3300005616 Bacteria 1055
66 Ga0068859_100000063 3300005617 Bacteria 106123
67 Ga0068859_100009540 3300005617 Bacteria 9799
68 Ga0068864_100027629 3300005618 Bacteria 4794
69 Ga0068864_100084256 3300005618 Bacteria 2793
70 Ga0068864_100181243 3300005618 Bacteria 1926
71 Ga0068864_100374855 3300005618 Bacteria 1347
72 Ga0068851_10070371 3300005834 Bacteria 1809
73 Ga0068863_100001548 3300005841 Bacteria 22706
74 Ga0068863_100010313 3300005841 Bacteria 9080
75 Ga0068863_100094765 3300005841 Bacteria 2833
76 Ga0068863_100116109 3300005841 Bacteria 2551
77 Ga0068863_100230540 3300005841 Bacteria 1786
78 Ga0068858_100001690 3300005842 Bacteria 22555
79 Ga0068860_100000033 3300005843 Bacteria 245461
80 Ga0068860_100007387 3300005843 Bacteria 10990
81 Ga0068860_100007445 3300005843 Bacteria 10945
82 Ga0068860_100022324 3300005843 Bacteria 6123
83 Ga0068860_100249644 3300005843 Bacteria 1727
84 Ga0068862_100074631 3300005844 Bacteria 2932
85 Ga0081540_1027833 3300005983 Bacteria 3191
86 Ga0081539_10009972 3300005985 Bacteria 7826
87 Ga0075367_10000167 3300006178 Bacteria 20901
88 Ga0075369_10003537 3300006186 Bacteria 5687
89 Ga0075366_10092816 3300006195 Bacteria 1809
90 Ga0097621_100275805 3300006237 Bacteria 1479
91 Ga0068871_100029477 3300006358 Bacteria 4311
92 Ga0068871_100235634 3300006358 Bacteria 1590
93 Ga0068871_100325691 3300006358 Bacteria 1354
94 Ga0075428_100039959 3300006844 Bacteria 5163
95 Ga0075430_100023147 3300006846 Bacteria 5283
96 Ga0075429_100022769 3300006880 Bacteria 5431
97 Ga0097620_100000063 3300006931 Bacteria 106123
98 Ga0097620_100009540 3300006931 Bacteria 9799
99 Ga0079104_1000961 3300006946 Bacteria 22591
100 Ga0105240_10617302 3300009093 Bacteria 1192
101 Ga0111539_10987469 3300009094 Bacteria 979
102 Ga0105247_10005583 3300009101 Bacteria 7901
103 Ga0105247_10193323 3300009101 Bacteria 1363
104 Ga0114129_10001235 3300009147 Bacteria 34053
105 Ga0105241_10000841 3300009174 Bacteria 23285
106 Ga0105241_10301788 3300009174 Bacteria 1375
107 Ga0105242_10014857 3300009176 Bacteria 6032
108 Ga0105238_10046846 3300009551 Bacteria 4360
109 Ga0105249_10071647 3300009553 Bacteria 3202
110 Ga0105249_10362608 3300009553 Bacteria 1471
111 Ga0123342_1012423 3300009766 Bacteria 8908
112 Ga0105246_10006908 3300011119 Bacteria 6944
113 Ga0171463_1007 3300013249 Bacteria 301198
114 Ga0157374_10107009 3300013296 Bacteria 2687
115 Ga0157374_10409575 3300013296 Unclassified 1353
116 Ga0157378_10004575 3300013297 Bacteria 12131
117 Ga0157378_10180004 3300013297 Bacteria 1988
118 Ga0157378_10304700 3300013297 Bacteria 1543
119 Ga0157378_10342757 3300013297 Bacteria 1458
120 Ga0163162_10000098 3300013306 Bacteria 78708
121 Ga0163162_10006177 3300013306 Bacteria 11607
122 Ga0157372_10003402 3300013307 Bacteria 17170
123 Ga0157372_10012428 3300013307 Bacteria 9075
124 Ga0157372_10028175 3300013307 Bacteria 6129
125 Ga0157372_10505987 3300013307 Bacteria 1408
126 Ga0157375_10551349 3300013308 Bacteria 1314
127 Ga0163163_10466592 3300014325 Bacteria 1323
128 Ga0157380_10005343 3300014326 Bacteria 8975
129 Ga0157380_10009761 3300014326 Bacteria 6888
130 Ga0157379_10091080 3300014968 Bacteria 2735
131 Ga0157379_10203640 3300014968 Bacteria 1790
132 Ga0157379_11013352 3300014968 Unclassified 792
133 Ga0157376_10006508 3300014969 Bacteria 8257
134 Ga0183363_1138 3300015690 Bacteria 18553
135 Ga0163161_10284671 3300017792 Bacteria 1298
136 Ga0209436_100512 3300025208 Bacteria 16963
137 Ga0209784_100279 3300025224 Bacteria 29035
138 Ga0209646_1003454 3300025246 Bacteria 3121
139 Ga0209673_1000010 3300025273 Bacteria 596656
140 Ga0209673_1000130 3300025273 Bacteria 163870
141 Ga0209130_1000017 3300025284 Bacteria 388431
142 Ga0209676_1004193 3300025292 Bacteria 8182
143 Ga0209025_1000153 3300025294 Bacteria 170548
144 Ga0209564_1000013 3300025295 Bacteria 775755
145 Ga0209564_1002706 3300025295 Bacteria 13383
146 Ga0209564_1008507 3300025295 Bacteria 5050
147 Ga0209758_1002696 3300025297 Bacteria 17505
148 Ga0209050_1000427 3300025298 Bacteria 77517
149 Ga0209050_1003385 3300025298 Bacteria 11835
150 Ga0209256_1000211 3300025299 Bacteria 110131
151 Ga0209256_1000662 3300025299 Bacteria 46618
152 Ga0209256_1002290 3300025299 Bacteria 16100
153 Ga0207426_1000006 3300025302 Bacteria 1025969
154 Ga0207426_1003025 3300025302 Bacteria 9737
155 Ga0209051_1008264 3300025303 Bacteria 5537
156 Ga0209257_1010371 3300025304 Unclassified 4731
157 Ga0207656_10052631 3300025321 Bacteria 1764
158 Ga0207710_10003313 3300025900 Bacteria 7196
159 Ga0207710_10098190 3300025900 Bacteria 1378
160 Ga0207680_10000071 3300025903 Bacteria 44839
161 Ga0207647_10225899 3300025904 Unclassified 1078
162 Ga0207647_10246342 3300025904 Unclassified 1026
163 Ga0207645_10304106 3300025907 Bacteria 1062
164 Ga0207705_10028086 3300025909 Bacteria 4011
165 Ga0207684_10001928 3300025910 Bacteria 21508
166 Ga0207654_10009116 3300025911 Bacteria 5033
167 Ga0207671_10001308 3300025914 Bacteria 29190
168 Ga0207671_10002784 3300025914 Bacteria 18244
169 Ga0207649_10001491 3300025920 Bacteria 13747
170 Ga0207652_10021428 3300025921 Bacteria 5334
171 Ga0207681_10011466 3300025923 Bacteria 5448
172 Ga0207681_10225516 3300025923 Bacteria 1452
173 Ga0207650_10121578 3300025925 Bacteria 2034
174 Ga0207690_10002144 3300025932 Bacteria 12077
175 Ga0207706_10306887 3300025933 Bacteria 1382
176 Ga0207704_10344952 3300025938 Bacteria 1157
177 Ga0207689_10000472 3300025942 Bacteria 37804
178 Ga0207689_10103126 3300025942 Bacteria 2344
179 Ga0207689_10333283 3300025942 Bacteria 1260
180 Ga0207661_10000226 3300025944 Bacteria 36897
181 Ga0207679_10000159 3300025945 Bacteria 55990
182 Ga0207679_10484192 3300025945 Bacteria 1102
183 Ga0207667_10000151 3300025949 Bacteria 104054
184 Ga0207651_10370829 3300025960 Bacteria 1211
185 Ga0207712_10276687 3300025961 Bacteria 1368
186 Ga0207668_10021285 3300025972 Bacteria 4134
187 Ga0207658_10099550 3300025986 Bacteria 2274
188 Ga0207677_10023973 3300026023 Bacteria 3780
189 Ga0207677_10105484 3300026023 Bacteria 2085
190 Ga0207703_10001127 3300026035 Bacteria 25177
191 Ga0207702_10070495 3300026078 Bacteria 3006
192 Ga0207702_10302109 3300026078 Bacteria 1519
193 Ga0207641_10002177 3300026088 Bacteria 18447
194 Ga0207641_10005757 3300026088 Bacteria 10525
195 Ga0207641_10072785 3300026088 Bacteria 2960
196 Ga0207641_10175723 3300026088 Bacteria 1958
197 Ga0207648_10387331 3300026089 Bacteria 1265
198 Ga0207676_10015566 3300026095 Bacteria 5490
199 Ga0207676_10023653 3300026095 Bacteria 4537
200 Ga0207676_10236211 3300026095 Bacteria 1637
201 Ga0207674_10001689 3300026116 Bacteria 28340
202 Ga0207698_10096272 3300026142 Bacteria 2439
203 Ga0207698_10839821 3300026142 Bacteria 923
204 Ga0209281_1000375 3300027111 Bacteria 71407
205 Ga0209371_1000169 3300027312 Bacteria 97756
206 Ga0268265_10067962 3300028380 Bacteria 2761
207 Ga0268264_10000013 3300028381 Bacteria 513859
208 Ga0268264_10011698 3300028381 Bacteria 7237
209 Ga0268264_10014689 3300028381 Bacteria 6435
210 Ga0268264_10034021 3300028381 Bacteria 4190
211 Ga0268264_10641739 3300028381 Unclassified 1050
212 Ga0265334_10051150 3300028573 Bacteria 1585
213 Ga0265322_10007390 3300028654 Bacteria 3208
214 Ga0307517_10001806 3300028786 Bacteria 35156
215 Ga0307515_10000002 3300028794 Bacteria 1231751
216 Ga0307515_10000380 3300028794 Bacteria 108537
217 Ga0307515_10001093 3300028794 Bacteria 62142
218 Ga0307515_10284106 3300028794 Bacteria 1358
219 Ga0307515_10321551 3300028794 Bacteria 1213
220 Ga0268256_1000141 3300030500 Bacteria 97638
221 Ga0265330_10080281 3300031235 Bacteria 1406
222 Ga0265327_10004947 3300031251 Bacteria 11455
223 Ga0265316_10001294 3300031344 Bacteria 26929
224 Ga0265316_10043130 3300031344 Bacteria 3600
225 Ga0307509_10101110 3300031507 Bacteria 2919
226 Ga0307508_10001615 3300031616 Bacteria 25170
227 Ga0265342_10000007 3300031712 Bacteria 228257
228 Ga0265342_10047239 3300031712 Bacteria 2584
229 Ga0307516_10001865 3300031730 Bacteria 28896
230 Ga0316593_10011520 3300032168 Bacteria 2572
231 Ga0307510_10003188 3300033180 Bacteria 19039
232 Ga0307510_10118474 3300033180 Bacteria 2361
233 Ga0316592_1039297 3300033524 Unclassified 1045
234 Ga0373928_0000397 3300035084 Bacteria 8677
235 Ga0373935_0069646 3300035692 Bacteria 2266
236 Ga0373927_0238118 3300035695 Bacteria 1196
237 Ga0395905_0001472 3300037471 Bacteria 28219
238 Ga0395901_0068257 3300038443 Bacteria 3704
239 Ga0400490_21657 3300038726 Bacteria 7849
240 Ga0400483_074986 3300039062 Bacteria 1980
241 Ga0400483_095517 3300039062 Bacteria 3405
242 Ga0400489_26870 3300039093 Bacteria 1586
243 Ga0436365_0260290 3300039437 Bacteria 21096
244 Ga0436365_1174468 3300039437 Bacteria 56058
245 Ga0439436_0017644 3300041404 Bacteria 2136
246 Ga0439465_0023293 3300041413 Bacteria 1948
247 Ga0439449_0016065 3300042007 Bacteria 2815
248 Ga0451577_0000537 3300042876 Bacteria 62321
249 Ga0451577_0000725 3300042876 Bacteria 51071
250 Ga0451577_0000965 3300042876 Bacteria 42075
251 Ga0451577_0010409 3300042876 Bacteria 8895
252 Ga0466969_0000398 3300044656 Bacteria 23847
253 Ga0466972_0152458 3300044658 Bacteria 1086
254 Ga0453683_0000184 3300044673 Bacteria 86818
255 Ga0453683_0000954 3300044673 Bacteria 27505
256 Ga0453683_0013017 3300044673 Bacteria 5439
257 Ga0453683_0285594 3300044673 Bacteria 1054
258 Ga0466966_0000047 3300044684 Bacteria 91962
259 Ga0453684_0000008 3300044712 Bacteria 1200052
260 Ga0453684_0000135 3300044712 Bacteria 324341
261 Ga0453684_0000264 3300044712 Bacteria 225672
262 Ga0453684_0000756 3300044712 Bacteria 112323
263 Ga0453684_0001468 3300044712 Bacteria 66577
264 Ga0453684_0001593 3300044712 Bacteria 62319
265 Ga0453684_0002400 3300044712 Bacteria 45644
266 Ga0453684_0028760 3300044712 Bacteria 7914
267 Ga0453684_0041721 3300044712 Bacteria 6198
268 Ga0453684_0104627 3300044712 Bacteria 3455
269 Ga0453684_0131406 3300044712 Bacteria 3003
270 Ga0453684_0317867 3300044712 Bacteria 1764
271 Ga0466970_0129277 3300044765 Bacteria 1387
272 Ga0466970_0180816 3300044765 Bacteria 1170
273 Ga0466957_0041296 3300044842 Bacteria 2790
274 Ga0466959_0000065 3300045049 Bacteria 73931
275 Ga0466959_0001548 3300045049 Bacteria 14146
276 Ga0451576_0000154 3300045051 Bacteria 175525
277 Ga0451576_0000447 3300045051 Bacteria 93789
278 Ga0451576_0000691 3300045051 Bacteria 68432
279 Ga0451576_0001026 3300045051 Bacteria 51590
280 Ga0451576_0157292 3300045051 Bacteria 2371
281 Ga0451576_0180665 3300045051 Bacteria 2203
282 Ga0451576_0754449 3300045051 Unclassified 1022
283 Ga0466958_0171651 3300045836 Bacteria 1373
284 Ga0495606_0019281 3300046507 Bacteria 5081
285 Ga0495606_0285798 3300046507 Bacteria 900
286 Ga0495611_0000057 3300046648 Bacteria 80239
287 Ga0495672_0014735 3300047320 Bacteria 5337
288 Ga0495672_0018509 3300047320 Bacteria 4620
289 Ga0495672_0022419 3300047320 Bacteria 4105
290 Ga0496121_0049217 3300048924 Bacteria 3577
291 Ga0496124_0001427 3300048927 Bacteria 35336
292 Ga0496125_0212738 3300048928 Bacteria 1254
293 Ga0501034_0017335 3300049571 Bacteria 7388
294 Ga0501036_0155437 3300049572 Bacteria 1929
295 Ga0501047_0036265 3300049581 Bacteria 4766
296 Ga0501219_000069 3300049703 Bacteria 17436
297 Ga0501284_00022 3300050005 Bacteria 89450
298 nmdc:mga05p37_1207_c1 3300050507 Bacteria 29907
299 nmdc:mga09592_4328_c1 3300050508 Bacteria 11472
300 nmdc:mga0qj67_28727_c1 3300050509 Bacteria 4320
301 nmdc:mga06r32_194069_c1 3300050510 Bacteria 2018
302 nmdc:mga0rr50_298433_c1 3300050513 Bacteria 1347
303 Ga0500578_0028604 3300053086 Bacteria 3580
304 Ga0500644_0000167 3300053088 Bacteria 41835
305 Ga0500644_0014858 3300053088 Bacteria 2206
306 Ga0500583_0000015 3300053092 Bacteria 147804
307 Ga0500562_000085 3300053108 Bacteria 39648
308 Ga0500572_098991 3300053111 Bacteria 931
309 Ga0500618_006392 3300053125 Bacteria 3466
310 Ga0500616_0023922 3300053153 Bacteria 3399
311 Ga0500633_0005243 3300053160 Bacteria 3058
312 Ga0500634_0039596 3300053161 Bacteria 2562
313 Ga0500661_004196 3300055283 Bacteria 2697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0285798 Ga0495606_0285798_182_877 211
2 3300031235 Ga0265330_10080281 Ga0265330_100802812 213
3 3300014968 Ga0157379_11013352 Ga0157379_110133521 215
4 3300028381 Ga0268264_10641739 Ga0268264_106417391 215
5 3300028786 Ga0307517_10001806 Ga0307517_100018067 227
6 3300042876 Ga0451577_0010409 Ga0451577_0010409_7830_8603 230
7 3300044712 Ga0453684_0000264 Ga0453684_0000264_6042_6815 230
8 3300045051 Ga0451576_0000691 Ga0451576_0000691_61590_62363 230
9 iso_pu_bacteria 2508501122 2509108073 231
10 iso_pu_bacteria 2510917028 2511185551 231
11 iso_pu_bacteria 2512047086 2512528737 231
12 iso_pu_bacteria 2513237088 2513599559 231
13 iso_pu_bacteria 2513237138 2513868497 231
14 iso_pu_bacteria 2516143018 2516206102 231
15 iso_pu_bacteria 2524023207 2524452144 231
16 iso_pu_bacteria 2534681796 2535514437 231
17 iso_pu_bacteria 2551306085 2551683035 231
18 iso_pu_bacteria 2551306090 2551721227 231
19 iso_pu_bacteria 2551306090 2551722819 231
20 iso_pu_bacteria 2582581294 2585201433 231
21 iso_pu_bacteria 2582581867 2585405057 231
22 iso_pu_bacteria 2585427590 2585825136 231
23 iso_pu_bacteria 2599185352 2600196106 231
24 iso_pu_bacteria 2643221618 2644105419 231
25 iso_pu_bacteria 2643221626 2644145753 231
26 iso_pu_bacteria 2643221643 2644237862 231
27 iso_pu_bacteria 2643221655 2644311354 231
28 iso_pu_bacteria 2643221659 2644331247 231
29 iso_pu_bacteria 2643221698 2644544658 231
30 iso_pu_bacteria 2643221712 2644617028 231
31 iso_pu_bacteria 2643221723 2644672811 231
32 iso_pu_bacteria 2690316117 2692315210 231
33 iso_pu_bacteria 2751185821 2753463386 231
34 iso_pu_bacteria 2791355091 2792620510 231
35 iso_pu_bacteria 2791355092 2792625869 231
36 iso_pu_bacteria 2791355094 2792638810 231
37 iso_pu_bacteria 2838074704 2838079704 231
38 iso_pu_bacteria 2844163670 2844163925 231
39 iso_pu_bacteria 2847417321 2847419733 231
40 iso_pu_bacteria 2848992105 2848994749 231
41 iso_pu_bacteria 2855825444 2855828516 231
42 iso_pu_bacteria 2855839649 2855843640 231
43 iso_pu_bacteria 2855872281 2855877250 231
44 iso_pu_bacteria 2858800743 2858807100 231
45 iso_pu_bacteria 2896384573 2896391185 231
46 iso_pu_bacteria 2916000859 2916007363 231
47 iso_pu_bacteria 2916007675 2916009717 231
48 iso_pu_bacteria 2916068649 2916071577 231
49 iso_pu_bacteria 2920760137 2920761213 231
50 iso_pu_bacteria 2920822456 2920825593 231
51 iso_pu_bacteria 2921289301 2921290678 231
52 iso_pu_bacteria 2923556063 2923561719 231
53 iso_pu_bacteria 2924150972 2924154396 231
54 iso_pu_bacteria 2924179722 2924181997 231
55 iso_pu_bacteria 2924186466 2924188071 231
56 iso_pu_bacteria 2924207177 2924210558 231
57 iso_pu_bacteria 2924214083 2924215807 231
58 iso_pu_bacteria 2924221636 2924225073 231
59 iso_pu_bacteria 2937113482 2937116494 231
60 iso_pu_bacteria 2941499720 2941504640 231
61 iso_pu_bacteria 2970082768 2970083926 231
62 iso_pu_bacteria 2970095765 2970098283 231
63 iso_pu_bacteria 643692032 643826629 231
64 iso_pu_bacteria 8005542996 8005543073 231
65 iso_pu_bacteria 8024486573 8024490434 231
66 iso_pu_bacteria 8054460903 8054465162 231
67 3300014968 Ga0157379_10091080 Ga0157379_100910803 233
68 3300033524 Ga0316592_1039297 Ga0316592_10392972 233
69 3300039062 Ga0400483_074986 Ga0400483_074986_279_1049 233
70 3300042876 Ga0451577_0000725 Ga0451577_0000725_16063_16839 233
71 3300044673 Ga0453683_0000954 Ga0453683_0000954_12073_12849 233
72 3300044712 Ga0453684_0000008 Ga0453684_0000008_1116081_1116857 233
73 3300044712 Ga0453684_0000135 Ga0453684_0000135_84290_85066 233
74 3300045051 Ga0451576_0000154 Ga0451576_0000154_52609_53385 233
75 iso_pu_bacteria 2511231052 2511497694 233
76 iso_pu_bacteria 2513237086 2513584643 233
77 iso_pu_bacteria 2551306084 2551675607 233
78 iso_pu_bacteria 2551306086 2551695460 233
79 iso_pu_bacteria 2904113452 2904117882 233
80 iso_pu_bacteria 2904595352 2904596436 233
81 iso_pu_bacteria 2919160200 2919165100 233
82 iso_pu_bacteria 2937049772 2937053498 233
83 iso_pu_bacteria 2937056579 2937057270 233
84 iso_pu_bacteria 2937126314 2937128922 233
85 iso_pu_bacteria 2957388812 2957392735 233
86 iso_pu_bacteria 2957422303 2957426948 233
87 iso_pu_bacteria 2957430029 2957433241 233
88 iso_pu_bacteria 2957443900 2957443958 233
89 iso_pu_bacteria 2957457609 2957461337 233
90 iso_pu_bacteria 2957471148 2957475778 233
91 iso_pu_bacteria 2957484790 2957487108 233
92 iso_pu_bacteria 2957491536 2957494892 233
93 iso_pu_bacteria 2957498199 2957500497 233
94 iso_pu_bacteria 2957505466 2957510071 233
95 iso_pu_bacteria 2960617483 2960619644 233
96 iso_pu_bacteria 2960652885 2960655963 233
97 iso_pu_bacteria 2960660292 2960662722 233
98 iso_pu_bacteria 2964607997 2964612159 233
99 iso_pu_bacteria 2964628898 2964632886 233
100 iso_pu_bacteria 2964636051 2964637288 233
101 iso_pu_bacteria 2964643177 2964644511 233
102 iso_pu_bacteria 2964649959 2964654075 233
103 iso_pu_bacteria 2964663802 2964666592 233
104 iso_pu_bacteria 2964678106 2964682013 233
105 iso_pu_bacteria 2964691889 2964694839 233
106 iso_pu_bacteria 2964712639 2964714064 233
107 iso_pu_bacteria 2967693043 2967696890 233
108 iso_pu_bacteria 2967699805 2967706723 233
109 iso_pu_bacteria 2967706974 2967709310 233
110 iso_pu_bacteria 2967721400 2967723575 233
111 iso_pu_bacteria 2967735183 2967737849 233
112 iso_pu_bacteria 2967762386 2967765037 233
113 iso_pu_bacteria 2970040964 2970044469 233
114 iso_pu_bacteria 2970054988 2970061251 233
115 iso_pu_bacteria 2970061556 2970064198 233
116 iso_pu_bacteria 2970076120 2970078368 233
117 iso_pu_bacteria 2970088815 2970090210 233
118 iso_pu_bacteria 2970109326 2970109751 233
119 iso_pu_bacteria 2970116247 2970120007 233
120 iso_pu_bacteria 2970129317 2970133028 233
121 iso_pu_bacteria 2970136068 2970139398 233
122 iso_pu_bacteria 2970191845 2970195565 233
123 iso_pu_bacteria 2977254563 2977259570 233
124 iso_pu_bacteria 2977523885 2977523987 233
125 iso_pu_bacteria 2977523885 2977524106 233
126 iso_pu_bacteria 2977565890 2977569494 233
127 iso_pu_bacteria 2977572785 2977579151 233
128 iso_pu_bacteria 2977579622 2977583263 233
129 iso_pu_bacteria 3001892409 3001894503 233
130 iso_pu_bacteria 648276728 648740322 233
131 iso_pu_bacteria 8054465665 8054471380 233
132 iso_pu_bacteria 8057473075 8057477845 233
133 3300014326 Ga0157380_10009761 Ga0157380_100097614 234
134 3300050513 nmdc:mga0rr50_298433_c1 nmdc:mga0rr50_298433_c1_258_1022 234
135 3300002987 JGI25159J45721_1000008 JGI25159J45721_1000008144 235
136 3300003187 JGI25151J46595_10008634 JGI25151J46595_100086342 235
137 3300003354 JGI25160J50197_1000033 JGI25160J50197_100003331 235
138 3300003771 Ga0055526_1000440 Ga0055526_10004405 235
139 3300003771 Ga0055526_1010181 Ga0055526_10101812 235
140 3300003775 Ga0055524_1001377 Ga0055524_10013777 235
141 3300003775 Ga0055524_1003372 Ga0055524_10033723 235
142 3300003790 Ga0055528_1000281 Ga0055528_100028125 235
143 3300003791 Ga0055530_10041531 Ga0055530_100415312 235
144 3300003792 Ga0055540_1018119 Ga0055540_10181192 235
145 3300004625 Ga0055543_1000026 Ga0055543_1000026109 235
146 3300005262 Ga0065165_1000178 Ga0065165_100017831 235
147 3300005983 Ga0081540_1027833 Ga0081540_10278334 235
148 3300006178 Ga0075367_10000167 Ga0075367_1000016716 235
149 3300006186 Ga0075369_10003537 Ga0075369_100035377 235
150 3300006844 Ga0075428_100039959 Ga0075428_1000399598 235
151 3300006846 Ga0075430_100023147 Ga0075430_1000231478 235
152 3300006880 Ga0075429_100022769 Ga0075429_1000227692 235
153 3300006946 Ga0079104_1000961 Ga0079104_10009613 235
154 3300009766 Ga0123342_1012423 Ga0123342_10124233 235
155 3300013249 Ga0171463_1007 Ga0171463_1007155 235
156 3300015690 Ga0183363_1138 Ga0183363_11388 235
157 3300025208 Ga0209436_100512 Ga0209436_1005122 235
158 3300025273 Ga0209673_1000010 Ga0209673_1000010131 235
159 3300025284 Ga0209130_1000017 Ga0209130_1000017146 235
160 3300025292 Ga0209676_1004193 Ga0209676_10041932 235
161 3300025294 Ga0209025_1000153 Ga0209025_100015329 235
162 3300025295 Ga0209564_1000013 Ga0209564_1000013595 235
163 3300025295 Ga0209564_1008507 Ga0209564_10085072 235
164 3300025298 Ga0209050_1003385 Ga0209050_10033851 235
165 3300025299 Ga0209256_1000211 Ga0209256_100021186 235
166 3300025299 Ga0209256_1000662 Ga0209256_100066232 235
167 3300025299 Ga0209256_1002290 Ga0209256_100229011 235
168 3300025302 Ga0207426_1000006 Ga0207426_1000006145 235
169 3300025303 Ga0209051_1008264 Ga0209051_10082642 235
170 3300027111 Ga0209281_1000375 Ga0209281_100037539 235
171 3300041404 Ga0439436_0017644 Ga0439436_0017644_468_1235 235
172 3300042007 Ga0439449_0016065 Ga0439449_0016065_774_1580 235
173 3300048927 Ga0496124_0001427 Ga0496124_0001427_31447_32301 235
174 3300050508 nmdc:mga09592_4328_c1 nmdc:mga09592_4328_c1_10265_11047 235
175 3300050509 nmdc:mga0qj67_28727_c1 nmdc:mga0qj67_28727_c1_2873_3655 235
176 3300050510 nmdc:mga06r32_194069_c1 nmdc:mga06r32_194069_c1_667_1449 235
177 iso_pu_bacteria 2510065057 2510302661 235
178 iso_pu_bacteria 2513237091 2513618395 235
179 iso_pu_bacteria 2513237140 2513883821 235
180 iso_pu_bacteria 2513237143 2513902074 235
181 iso_pu_bacteria 2515154107 2515611980 235
182 iso_pu_bacteria 2516653046 2516896642 235
183 iso_pu_bacteria 2551306093 2551746362 235
184 iso_pu_bacteria 2643221557 2643804353 235
185 iso_pu_bacteria 2643221610 2644065124 235
186 iso_pu_bacteria 2643221668 2644377533 235
187 iso_pu_bacteria 2643221675 2644416796 235
188 iso_pu_bacteria 2643221680 2644449836 235
189 iso_pu_bacteria 2643221726 2644689970 235
190 iso_pu_bacteria 2915986958 2915988584 235
191 iso_pu_bacteria 2915993759 2915996624 235
192 iso_pu_bacteria 2916014648 2916020420 235
193 iso_pu_bacteria 2916021584 2916025482 235
194 iso_pu_bacteria 2916028427 2916031186 235
195 iso_pu_bacteria 2916035215 2916037785 235
196 iso_pu_bacteria 2916041962 2916043642 235
197 iso_pu_bacteria 2916048683 2916051788 235
198 iso_pu_bacteria 2916055098 2916057822 235
199 iso_pu_bacteria 2916076590 2916077000 235
200 iso_pu_bacteria 2921201388 2921204640 235
201 iso_pu_bacteria 2921208531 2921214108 235
202 iso_pu_bacteria 2921237296 2921241278 235
203 iso_pu_bacteria 2921244191 2921247268 235
204 iso_pu_bacteria 2921257292 2921259750 235
205 iso_pu_bacteria 2921263974 2921266593 235
206 iso_pu_bacteria 2921282425 2921285136 235
207 iso_pu_bacteria 2921296804 2921300626 235
208 iso_pu_bacteria 2924144063 2924149175 235
209 iso_pu_bacteria 2924158325 2924162212 235
210 iso_pu_bacteria 2924165586 2924168477 235
211 iso_pu_bacteria 2924172951 2924174799 235
212 iso_pu_bacteria 2924193448 2924195723 235
213 iso_pu_bacteria 2924200457 2924205016 235
214 iso_pu_bacteria 2924228884 2924231093 235
215 iso_pu_bacteria 2929154850 2929156421 235
216 iso_pu_bacteria 2936996657 2937001588 235
217 iso_pu_bacteria 2937002841 2937005531 235
218 iso_pu_bacteria 2937009748 2937014243 235
219 iso_pu_bacteria 2937016420 2937019167 235
220 iso_pu_bacteria 2937023124 2937026165 235
221 iso_pu_bacteria 2937042894 2937045349 235
222 iso_pu_bacteria 2937063883 2937067661 235
223 iso_pu_bacteria 2937071275 2937074956 235
224 iso_pu_bacteria 2937091812 2937098283 235
225 iso_pu_bacteria 2937098957 2937102819 235
226 iso_pu_bacteria 2937106411 2937111451 235
227 iso_pu_bacteria 2937119839 2937120673 235
228 iso_pu_bacteria 2957382221 2957382951 235
229 iso_pu_bacteria 2957395598 2957399016 235
230 iso_pu_bacteria 2957402308 2957402997 235
231 iso_pu_bacteria 2957408893 2957411355 235
232 iso_pu_bacteria 2957415311 2957418362 235
233 iso_pu_bacteria 2957450854 2957454843 235
234 iso_pu_bacteria 2957464669 2957467584 235
235 iso_pu_bacteria 2957478035 2957480530 235
236 iso_pu_bacteria 2960584000 2960591015 235
237 iso_pu_bacteria 2960597568 2960598397 235
238 iso_pu_bacteria 2960603979 2960608447 235
239 iso_pu_bacteria 2960610863 2960613610 235
240 iso_pu_bacteria 2960624210 2960625783 235
241 iso_pu_bacteria 2960637947 2960640746 235
242 iso_pu_bacteria 2960645483 2960646381 235
243 iso_pu_bacteria 2960667422 2960669707 235
244 iso_pu_bacteria 2960674078 2960680386 235
245 iso_pu_bacteria 2960687367 2960690740 235
246 iso_pu_bacteria 2964615318 2964618068 235
247 iso_pu_bacteria 2964621998 2964625110 235
248 iso_pu_bacteria 2964656573 2964660292 235
249 iso_pu_bacteria 2964670856 2964673414 235
250 iso_pu_bacteria 2964685014 2964685646 235
251 iso_pu_bacteria 2964698721 2964703285 235
252 iso_pu_bacteria 2964705432 2964710388 235
253 iso_pu_bacteria 2964719344 2964720731 235
254 iso_pu_bacteria 2967664464 2967669586 235
255 iso_pu_bacteria 2967671571 2967675526 235
256 iso_pu_bacteria 2967678726 2967685086 235
257 iso_pu_bacteria 2967714385 2967717014 235
258 iso_pu_bacteria 2967742019 2967748016 235
259 iso_pu_bacteria 2967748971 2967753510 235
260 iso_pu_bacteria 2967755722 2967759122 235
261 iso_pu_bacteria 2967769361 2967774756 235
262 iso_pu_bacteria 2967775926 2967781051 235
263 iso_pu_bacteria 2970019648 2970022363 235
264 iso_pu_bacteria 2970033650 2970037662 235
265 iso_pu_bacteria 2970047711 2970053794 235
266 iso_pu_bacteria 2970068827 2970072550 235
267 iso_pu_bacteria 2970102677 2970105617 235
268 iso_pu_bacteria 2970149975 2970156185 235
269 iso_pu_bacteria 2970156795 2970159839 235
270 iso_pu_bacteria 2970164137 2970167777 235
271 iso_pu_bacteria 2970170962 2970175626 235
272 iso_pu_bacteria 2970177841 2970179537 235
273 iso_pu_bacteria 2970184632 2970188429 235
274 iso_pu_bacteria 2977516862 2977522145 235
275 iso_pu_bacteria 2977537788 2977540125 235
276 iso_pu_bacteria 2977551784 2977555593 235
277 iso_pu_bacteria 2977558990 2977563437 235
278 iso_pu_bacteria 8003992118 8003996215 235
279 3300003856 Ga0058692_1000104 Ga0058692_100010413 236
280 3300009147 Ga0114129_10001235 Ga0114129_1000123513 236
281 3300027312 Ga0209371_1000169 Ga0209371_100016998 236
282 3300030500 Ga0268256_1000141 Ga0268256_100014112 236
283 3300048924 Ga0496121_0049217 Ga0496121_0049217_403_1176 236
284 3300049571 Ga0501034_0017335 Ga0501034_0017335_1065_1838 236
285 3300049572 Ga0501036_0155437 Ga0501036_0155437_19_792 236
286 3300050507 nmdc:mga05p37_1207_c1 nmdc:mga05p37_1207_c1_15496_16275 236
287 3300003751 Ga0055538_1000258 Ga0055538_100025816 237
288 3300005355 Ga0070671_100323733 Ga0070671_1003237332 237
289 3300005467 Ga0070706_100002076 Ga0070706_1000020769 237
290 3300005467 Ga0070706_100107449 Ga0070706_1001074492 237
291 3300005618 Ga0068864_100181243 Ga0068864_1001812431 237
292 3300006358 Ga0068871_100325691 Ga0068871_1003256912 237
293 3300013297 Ga0157378_10180004 Ga0157378_101800042 237
294 3300025224 Ga0209784_100279 Ga0209784_10027915 237
295 3300025910 Ga0207684_10001928 Ga0207684_1000192812 237
296 3300028794 Ga0307515_10001093 Ga0307515_1000109330 237
297 3300028794 Ga0307515_10284106 Ga0307515_102841062 237
298 3300031344 Ga0265316_10043130 Ga0265316_100431303 237
299 3300035084 Ga0373928_0000397 Ga0373928_0000397_2053_2823 237
300 3300037471 Ga0395905_0001472 Ga0395905_0001472_18505_19278 237
301 3300038726 Ga0400490_21657 Ga0400490_21657_1324_2097 237
302 3300039093 Ga0400489_26870 Ga0400489_26870_332_1102 237
303 3300039437 Ga0436365_1174468 Ga0436365_1174468_15359_16129 237
304 3300041413 Ga0439465_0023293 Ga0439465_0023293_64_852 237
305 3300042876 Ga0451577_0000965 Ga0451577_0000965_18615_19385 237
306 3300044673 Ga0453683_0000184 Ga0453683_0000184_66801_67574 237
307 3300044673 Ga0453683_0013017 Ga0453683_0013017_165_947 237
308 3300044673 Ga0453683_0285594 Ga0453683_0285594_27_800 237
309 3300044712 Ga0453684_0000756 Ga0453684_0000756_63235_64005 237
310 3300044712 Ga0453684_0028760 Ga0453684_0028760_2823_3593 237
311 3300044712 Ga0453684_0317867 Ga0453684_0317867_426_1286 237
312 3300045051 Ga0451576_0000447 Ga0451576_0000447_49769_50539 237
313 3300045051 Ga0451576_0157292 Ga0451576_0157292_603_1376 237
314 3300045051 Ga0451576_0754449 Ga0451576_0754449_35_811 237
315 3300048928 Ga0496125_0212738 Ga0496125_0212738_431_1216 237
316 3300049581 Ga0501047_0036265 Ga0501047_0036265_3735_4508 237
317 3300053111 Ga0500572_098991 Ga0500572_098991_92_868 237
318 3300053125 Ga0500618_006392 Ga0500618_006392_1108_1884 237
319 3300028654 Ga0265322_10007390 Ga0265322_100073903 238
320 3300031344 Ga0265316_10001294 Ga0265316_1000129415 238
321 3300031712 Ga0265342_10000007 Ga0265342_1000000769 238
322 3300031712 Ga0265342_10047239 Ga0265342_100472392 238
323 3300039062 Ga0400483_095517 Ga0400483_095517_1070_1846 238
324 3300042876 Ga0451577_0000537 Ga0451577_0000537_44781_45554 238
325 3300044712 Ga0453684_0001468 Ga0453684_0001468_18859_19641 238
326 3300044712 Ga0453684_0001593 Ga0453684_0001593_16766_17539 238
327 3300044712 Ga0453684_0002400 Ga0453684_0002400_25973_26749 238
328 3300044712 Ga0453684_0104627 Ga0453684_0104627_912_1721 238
329 3300044712 Ga0453684_0131406 Ga0453684_0131406_434_1207 238
330 3300045051 Ga0451576_0001026 Ga0451576_0001026_16768_17541 238
331 3300001989 JGI24739J22299_10002553 JGI24739J22299_100025534 239
332 3300003316 rootH1_10120272 rootH1_101202721 239
333 3300003320 rootH2_10001886 rootH2_1000188680 239
334 3300003320 rootH2_10066609 rootH2_1006660911 239
335 3300003322 rootL2_10060614 rootL2_100606142 239
336 3300003322 rootL2_10085508 rootL2_100855089 239
337 3300003322 rootL2_10231490 rootL2_102314903 239
338 3300003323 rootH1_10085513 rootH1_100855132 239
339 3300003323 rootH1_10162835 rootH1_101628351 239
340 3300003354 JGI25160J50197_1002152 JGI25160J50197_10021529 239
341 3300003771 Ga0055526_1040718 Ga0055526_10407182 239
342 3300003790 Ga0055528_1001633 Ga0055528_10016336 239
343 3300003790 Ga0055528_1001646 Ga0055528_10016466 239
344 3300003791 Ga0055530_10003030 Ga0055530_100030306 239
345 3300003794 Ga0055531_10046033 Ga0055531_100460332 239
346 3300005262 Ga0065165_1000056 Ga0065165_100005611 239
347 3300005327 Ga0070658_10036474 Ga0070658_100364744 239
348 3300005327 Ga0070658_10324177 Ga0070658_103241772 239
349 3300005329 Ga0070683_100004697 Ga0070683_1000046979 239
350 3300005331 Ga0070670_100008152 Ga0070670_1000081522 239
351 3300005334 Ga0068869_100003400 Ga0068869_1000034005 239
352 3300005334 Ga0068869_100124454 Ga0068869_1001244542 239
353 3300005334 Ga0068869_100357446 Ga0068869_1003574461 239
354 3300005335 Ga0070666_10000077 Ga0070666_1000007736 239
355 3300005337 Ga0070682_100000031 Ga0070682_10000003132 239
356 3300005337 Ga0070682_100119623 Ga0070682_1001196232 239
357 3300005338 Ga0068868_100009336 Ga0068868_1000093364 239
358 3300005339 Ga0070660_100162491 Ga0070660_1001624912 239
359 3300005344 Ga0070661_100001497 Ga0070661_1000014977 239
360 3300005347 Ga0070668_100087355 Ga0070668_1000873553 239
361 3300005353 Ga0070669_100025327 Ga0070669_1000253273 239
362 3300005355 Ga0070671_100186006 Ga0070671_1001860062 239
363 3300005366 Ga0070659_100013050 Ga0070659_1000130505 239
364 3300005435 Ga0070714_100120952 Ga0070714_1001209522 239
365 3300005436 Ga0070713_100131316 Ga0070713_1001313161 239
366 3300005471 Ga0070698_100281981 Ga0070698_1002819812 239
367 3300005535 Ga0070684_100000583 Ga0070684_1000005837 239
368 3300005539 Ga0068853_100002378 Ga0068853_10000237810 239
369 3300005539 Ga0068853_100096516 Ga0068853_1000965163 239
370 3300005563 Ga0068855_100011767 Ga0068855_1000117673 239
371 3300005564 Ga0070664_100000695 Ga0070664_1000006957 239
372 3300005577 Ga0068857_100000997 Ga0068857_10000099721 239
373 3300005614 Ga0068856_100098901 Ga0068856_1000989012 239
374 3300005614 Ga0068856_100232656 Ga0068856_1002326562 239
375 3300005614 Ga0068856_100354715 Ga0068856_1003547152 239
376 3300005616 Ga0068852_100080366 Ga0068852_1000803662 239
377 3300005616 Ga0068852_100562001 Ga0068852_1005620012 239
378 3300005616 Ga0068852_100659191 Ga0068852_1006591911 239
379 3300005617 Ga0068859_100000063 Ga0068859_10000006350 239
380 3300005617 Ga0068859_100009540 Ga0068859_1000095408 239
381 3300005618 Ga0068864_100027629 Ga0068864_1000276294 239
382 3300005618 Ga0068864_100084256 Ga0068864_1000842562 239
383 3300005618 Ga0068864_100374855 Ga0068864_1003748552 239
384 3300005834 Ga0068851_10070371 Ga0068851_100703712 239
385 3300005841 Ga0068863_100001548 Ga0068863_1000015489 239
386 3300005841 Ga0068863_100010313 Ga0068863_1000103132 239
387 3300005841 Ga0068863_100094765 Ga0068863_1000947652 239
388 3300005841 Ga0068863_100116109 Ga0068863_1001161092 239
389 3300005841 Ga0068863_100230540 Ga0068863_1002305402 239
390 3300005842 Ga0068858_100001690 Ga0068858_1000016908 239
391 3300005843 Ga0068860_100000033 Ga0068860_100000033137 239
392 3300005843 Ga0068860_100007387 Ga0068860_10000738711 239
393 3300005843 Ga0068860_100007445 Ga0068860_1000074459 239
394 3300005843 Ga0068860_100022324 Ga0068860_1000223244 239
395 3300005843 Ga0068860_100249644 Ga0068860_1002496442 239
396 3300005844 Ga0068862_100074631 Ga0068862_1000746312 239
397 3300005985 Ga0081539_10009972 Ga0081539_100099727 239
398 3300006195 Ga0075366_10092816 Ga0075366_100928162 239
399 3300006237 Ga0097621_100275805 Ga0097621_1002758051 239
400 3300006358 Ga0068871_100029477 Ga0068871_1000294775 239
401 3300006358 Ga0068871_100235634 Ga0068871_1002356342 239
402 3300006931 Ga0097620_100000063 Ga0097620_10000006350 239
403 3300006931 Ga0097620_100009540 Ga0097620_1000095408 239
404 3300009093 Ga0105240_10617302 Ga0105240_106173022 239
405 3300009094 Ga0111539_10987469 Ga0111539_109874692 239
406 3300009101 Ga0105247_10005583 Ga0105247_100055833 239
407 3300009101 Ga0105247_10193323 Ga0105247_101933232 239
408 3300009174 Ga0105241_10000841 Ga0105241_1000084118 239
409 3300009174 Ga0105241_10301788 Ga0105241_103017882 239
410 3300009176 Ga0105242_10014857 Ga0105242_100148574 239
411 3300009551 Ga0105238_10046846 Ga0105238_100468462 239
412 3300009553 Ga0105249_10071647 Ga0105249_100716473 239
413 3300009553 Ga0105249_10362608 Ga0105249_103626082 239
414 3300011119 Ga0105246_10006908 Ga0105246_100069089 239
415 3300013296 Ga0157374_10107009 Ga0157374_101070092 239
416 3300013296 Ga0157374_10409575 Ga0157374_104095752 239
417 3300013297 Ga0157378_10004575 Ga0157378_100045753 239
418 3300013297 Ga0157378_10304700 Ga0157378_103047002 239
419 3300013297 Ga0157378_10342757 Ga0157378_103427572 239
420 3300013306 Ga0163162_10000098 Ga0163162_1000009818 239
421 3300013306 Ga0163162_10006177 Ga0163162_100061776 239
422 3300013307 Ga0157372_10003402 Ga0157372_100034024 239
423 3300013307 Ga0157372_10012428 Ga0157372_100124284 239
424 3300013307 Ga0157372_10028175 Ga0157372_100281757 239
425 3300013307 Ga0157372_10505987 Ga0157372_105059872 239
426 3300013308 Ga0157375_10551349 Ga0157375_105513492 239
427 3300014325 Ga0163163_10466592 Ga0163163_104665921 239
428 3300014326 Ga0157380_10005343 Ga0157380_100053433 239
429 3300014968 Ga0157379_10203640 Ga0157379_102036402 239
430 3300014969 Ga0157376_10006508 Ga0157376_100065084 239
431 3300017792 Ga0163161_10284671 Ga0163161_102846712 239
432 3300025246 Ga0209646_1003454 Ga0209646_10034543 239
433 3300025273 Ga0209673_1000130 Ga0209673_1000130134 239
434 3300025295 Ga0209564_1002706 Ga0209564_100270611 239
435 3300025297 Ga0209758_1002696 Ga0209758_10026967 239
436 3300025298 Ga0209050_1000427 Ga0209050_100042717 239
437 3300025302 Ga0207426_1003025 Ga0207426_10030257 239
438 3300025304 Ga0209257_1010371 Ga0209257_10103714 239
439 3300025321 Ga0207656_10052631 Ga0207656_100526312 239
440 3300025900 Ga0207710_10003313 Ga0207710_100033136 239
441 3300025900 Ga0207710_10098190 Ga0207710_100981902 239
442 3300025903 Ga0207680_10000071 Ga0207680_1000007138 239
443 3300025904 Ga0207647_10225899 Ga0207647_102258992 239
444 3300025904 Ga0207647_10246342 Ga0207647_102463422 239
445 3300025907 Ga0207645_10304106 Ga0207645_103041061 239
446 3300025909 Ga0207705_10028086 Ga0207705_100280863 239
447 3300025911 Ga0207654_10009116 Ga0207654_100091162 239
448 3300025914 Ga0207671_10001308 Ga0207671_1000130815 239
449 3300025914 Ga0207671_10002784 Ga0207671_100027848 239
450 3300025920 Ga0207649_10001491 Ga0207649_100014915 239
451 3300025921 Ga0207652_10021428 Ga0207652_100214282 239
452 3300025923 Ga0207681_10011466 Ga0207681_100114664 239
453 3300025923 Ga0207681_10225516 Ga0207681_102255162 239
454 3300025925 Ga0207650_10121578 Ga0207650_101215782 239
455 3300025932 Ga0207690_10002144 Ga0207690_100021449 239
456 3300025933 Ga0207706_10306887 Ga0207706_103068872 239
457 3300025938 Ga0207704_10344952 Ga0207704_103449522 239
458 3300025942 Ga0207689_10000472 Ga0207689_1000047226 239
459 3300025942 Ga0207689_10103126 Ga0207689_101031263 239
460 3300025942 Ga0207689_10333283 Ga0207689_103332832 239
461 3300025944 Ga0207661_10000226 Ga0207661_1000022615 239
462 3300025945 Ga0207679_10000159 Ga0207679_1000015925 239
463 3300025945 Ga0207679_10484192 Ga0207679_104841922 239
464 3300025949 Ga0207667_10000151 Ga0207667_1000015111 239
465 3300025960 Ga0207651_10370829 Ga0207651_103708292 239
466 3300025961 Ga0207712_10276687 Ga0207712_102766872 239
467 3300025972 Ga0207668_10021285 Ga0207668_100212853 239
468 3300025986 Ga0207658_10099550 Ga0207658_100995502 239
469 3300026023 Ga0207677_10023973 Ga0207677_100239734 239
470 3300026023 Ga0207677_10105484 Ga0207677_101054843 239
471 3300026035 Ga0207703_10001127 Ga0207703_1000112711 239
472 3300026078 Ga0207702_10070495 Ga0207702_100704953 239
473 3300026078 Ga0207702_10302109 Ga0207702_103021092 239
474 3300026088 Ga0207641_10002177 Ga0207641_100021775 239
475 3300026088 Ga0207641_10005757 Ga0207641_100057578 239
476 3300026088 Ga0207641_10072785 Ga0207641_100727852 239
477 3300026088 Ga0207641_10175723 Ga0207641_101757232 239
478 3300026089 Ga0207648_10387331 Ga0207648_103873312 239
479 3300026095 Ga0207676_10015566 Ga0207676_100155666 239
480 3300026095 Ga0207676_10023653 Ga0207676_100236534 239
481 3300026095 Ga0207676_10236211 Ga0207676_102362112 239
482 3300026116 Ga0207674_10001689 Ga0207674_1000168913 239
483 3300026142 Ga0207698_10096272 Ga0207698_100962722 239
484 3300026142 Ga0207698_10839821 Ga0207698_108398211 239
485 3300028380 Ga0268265_10067962 Ga0268265_100679623 239
486 3300028381 Ga0268264_10000013 Ga0268264_10000013136 239
487 3300028381 Ga0268264_10011698 Ga0268264_100116982 239
488 3300028381 Ga0268264_10014689 Ga0268264_100146894 239
489 3300028381 Ga0268264_10034021 Ga0268264_100340212 239
490 3300028573 Ga0265334_10051150 Ga0265334_100511502 239
491 3300028794 Ga0307515_10000002 Ga0307515_10000002586 239
492 3300028794 Ga0307515_10000380 Ga0307515_1000038088 239
493 3300028794 Ga0307515_10321551 Ga0307515_103215512 239
494 3300031251 Ga0265327_10004947 Ga0265327_100049471 239
495 3300031507 Ga0307509_10101110 Ga0307509_101011103 239
496 3300031616 Ga0307508_10001615 Ga0307508_100016156 239
497 3300031730 Ga0307516_10001865 Ga0307516_1000186514 239
498 3300032168 Ga0316593_10011520 Ga0316593_100115203 239
499 3300033180 Ga0307510_10003188 Ga0307510_1000318812 239
500 3300033180 Ga0307510_10118474 Ga0307510_101184743 239
501 3300035692 Ga0373935_0069646 Ga0373935_0069646_512_1288 239
502 3300035695 Ga0373927_0238118 Ga0373927_0238118_232_1008 239
503 3300038443 Ga0395901_0068257 Ga0395901_0068257_2584_3360 239
504 3300039437 Ga0436365_0260290 Ga0436365_0260290_20255_21034 239
505 3300044656 Ga0466969_0000398 Ga0466969_0000398_2503_3279 239
506 3300044658 Ga0466972_0152458 Ga0466972_0152458_205_984 239
507 3300044684 Ga0466966_0000047 Ga0466966_0000047_21007_21783 239
508 3300044712 Ga0453684_0041721 Ga0453684_0041721_2492_3271 239
509 3300044765 Ga0466970_0129277 Ga0466970_0129277_208_984 239
510 3300044765 Ga0466970_0180816 Ga0466970_0180816_307_1083 239
511 3300044842 Ga0466957_0041296 Ga0466957_0041296_1701_2477 239
512 3300045049 Ga0466959_0000065 Ga0466959_0000065_12081_12857 239
513 3300045049 Ga0466959_0001548 Ga0466959_0001548_3687_4463 239
514 3300045051 Ga0451576_0180665 Ga0451576_0180665_1401_2180 239
515 3300045836 Ga0466958_0171651 Ga0466958_0171651_397_1173 239
516 3300046507 Ga0495606_0019281 Ga0495606_0019281_1459_2235 239
517 3300046648 Ga0495611_0000057 Ga0495611_0000057_49461_50237 239
518 3300047320 Ga0495672_0014735 Ga0495672_0014735_3038_3814 239
519 3300047320 Ga0495672_0018509 Ga0495672_0018509_2596_3375 239
520 3300047320 Ga0495672_0022419 Ga0495672_0022419_1920_2696 239
521 3300049703 Ga0501219_000069 Ga0501219_000069_7035_7811 239
522 3300050005 Ga0501284_00022 Ga0501284_00022_40621_41397 239
523 3300053086 Ga0500578_0028604 Ga0500578_0028604_2477_3256 239
524 3300053088 Ga0500644_0000167 Ga0500644_0000167_16151_16927 239
525 3300053088 Ga0500644_0014858 Ga0500644_0014858_457_1239 239
526 3300053092 Ga0500583_0000015 Ga0500583_0000015_69405_70184 239
527 3300053108 Ga0500562_000085 Ga0500562_000085_27842_28621 239
528 3300053153 Ga0500616_0023922 Ga0500616_0023922_2479_3258 239
529 3300053160 Ga0500633_0005243 Ga0500633_0005243_1006_1782 239
530 3300053161 Ga0500634_0039596 Ga0500634_0039596_228_1004 239
531 3300055283 Ga0500661_004196 Ga0500661_004196_1764_2543 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

36

161

0.85

PF00483

NTP_transferase

Nucleotidyl transferase

35

282

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8955 2 231
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8926 2 231
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8365 2 231
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.825 2 231
7d73-assembly1.cif.gz_F cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.8013 1 228
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8955 2 231 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.825 2 231 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.803 93 228 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7679 1 228 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7607 1 116 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A517T7C1-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9603 1 231 GO:0009243
GO:0047343
AF-A0A1U9NNG5-F1-model_v4 Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33) 0.9602 1 231 GO:0009243
GO:0047343
AF-A0A2E6H9Z4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9587 1 231 GO:0009243
GO:0047343
AF-A0A383BKH4-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9587 1 147 GO:0009058
GO:0047343
AF-A0A355C6C4-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9578 1 231 GO:0009243
GO:0047343

Feature Viewer

pLDDT pTM Quality
88.67 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map