F460131
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 281 | 531 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10210981|Ga0157372_102109812 |
| Length | 235 |
| Sequence | MHSTSSARAWLLDSVRTGLCRLRGPVRPLGLIVAGALLSSAAAAQGQRDPELKEVVQRAISQAECFTDHYDSAVWYTLMEPRLRKIVKEHDERMEILKQVYCETHRSGETRLPPGLVMAVMDIESRFNRWAVSSAGAVGLMQVMPFWPEKLGIKRYELIHTGPNIHMGCAILRFYLRYERNDVRKALARYNGSVGQRGYPDMVISRWTRWNGADDLGFPSATPRKPSRPPAASAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 201 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 202 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 203 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 204 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 273 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 274 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 276 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 277 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 278 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 279 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 280 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 281 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.07 |
| Nodule | 0 |
| Rhizoplane | 6.21 |
| Rhizosphere | 85.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10085634 | 3300003320 | Unclassified | 2628 |
| 2 | rootL2_10184575 | 3300003322 | Bacteria | 2697 |
| 3 | rootH1_10176202 | 3300003323 | Bacteria | 4834 |
| 4 | Ga0065715_10536340 | 3300005293 | Bacteria | 751 |
| 5 | Ga0070676_10070758 | 3300005328 | Bacteria | 2094 |
| 6 | Ga0070683_100003293 | 3300005329 | Bacteria | 13051 |
| 7 | Ga0070683_100202970 | 3300005329 | Bacteria | 1883 |
| 8 | Ga0070690_100005087 | 3300005330 | Bacteria | 7369 |
| 9 | Ga0070690_100015419 | 3300005330 | Bacteria | 4557 |
| 10 | Ga0070670_100051719 | 3300005331 | Bacteria | 3528 |
| 11 | Ga0068869_100297601 | 3300005334 | Bacteria | 1302 |
| 12 | Ga0068869_100575855 | 3300005334 | Bacteria | 949 |
| 13 | Ga0070666_10009264 | 3300005335 | Bacteria | 6137 |
| 14 | Ga0070666_10025349 | 3300005335 | Bacteria | 3865 |
| 15 | Ga0070680_100018473 | 3300005336 | Bacteria | 5508 |
| 16 | Ga0068868_100075978 | 3300005338 | Bacteria | 2685 |
| 17 | Ga0068868_100161301 | 3300005338 | Bacteria | 1852 |
| 18 | Ga0070689_100004646 | 3300005340 | Bacteria | 9302 |
| 19 | Ga0070661_100048418 | 3300005344 | Bacteria | 3111 |
| 20 | Ga0070661_100240481 | 3300005344 | Bacteria | 1394 |
| 21 | Ga0070668_100032662 | 3300005347 | Bacteria | 3961 |
| 22 | Ga0070668_100277099 | 3300005347 | Bacteria | 1400 |
| 23 | Ga0070669_100007716 | 3300005353 | Bacteria | 7691 |
| 24 | Ga0070675_100001313 | 3300005354 | Bacteria | 18153 |
| 25 | Ga0070671_100000556 | 3300005355 | Bacteria | 26454 |
| 26 | Ga0070671_100007614 | 3300005355 | Bacteria | 8661 |
| 27 | Ga0070671_100156719 | 3300005355 | Bacteria | 1924 |
| 28 | Ga0070673_100003052 | 3300005364 | Bacteria | 10362 |
| 29 | Ga0070688_100001473 | 3300005365 | Bacteria | 11696 |
| 30 | Ga0070659_100595272 | 3300005366 | Bacteria | 950 |
| 31 | Ga0070667_100017869 | 3300005367 | Bacteria | 5878 |
| 32 | Ga0070667_100045902 | 3300005367 | Bacteria | 3675 |
| 33 | Ga0070667_100056977 | 3300005367 | Bacteria | 3301 |
| 34 | Ga0070667_100130789 | 3300005367 | Bacteria | 2190 |
| 35 | Ga0070667_100336653 | 3300005367 | Bacteria | 1364 |
| 36 | Ga0070709_10006956 | 3300005434 | Bacteria | 6175 |
| 37 | Ga0070709_10010051 | 3300005434 | Bacteria | 5231 |
| 38 | Ga0070709_10010637 | 3300005434 | Bacteria | 5102 |
| 39 | Ga0070714_100007187 | 3300005435 | Bacteria | 8642 |
| 40 | Ga0070714_100063291 | 3300005435 | Bacteria | 3181 |
| 41 | Ga0070713_100004623 | 3300005436 | Bacteria | 9282 |
| 42 | Ga0070713_100101260 | 3300005436 | Bacteria | 2495 |
| 43 | Ga0070713_100192289 | 3300005436 | Bacteria | 1839 |
| 44 | Ga0070710_10003168 | 3300005437 | Bacteria | 7797 |
| 45 | Ga0070701_10021666 | 3300005438 | Bacteria | 3071 |
| 46 | Ga0070711_100002611 | 3300005439 | Bacteria | 10316 |
| 47 | Ga0070711_100257644 | 3300005439 | Bacteria | 1371 |
| 48 | Ga0070705_100051614 | 3300005440 | Bacteria | 2399 |
| 49 | Ga0070700_100025522 | 3300005441 | Bacteria | 3480 |
| 50 | Ga0070694_100680856 | 3300005444 | Bacteria | 835 |
| 51 | Ga0070663_100098183 | 3300005455 | Bacteria | 2181 |
| 52 | Ga0070663_100500728 | 3300005455 | Bacteria | 1009 |
| 53 | Ga0070678_100092629 | 3300005456 | Bacteria | 2322 |
| 54 | Ga0070678_100354927 | 3300005456 | Bacteria | 1262 |
| 55 | Ga0070662_100066377 | 3300005457 | Bacteria | 2647 |
| 56 | Ga0070662_100559275 | 3300005457 | Bacteria | 959 |
| 57 | Ga0070681_10020717 | 3300005458 | Bacteria | 6587 |
| 58 | Ga0070681_10206642 | 3300005458 | Bacteria | 1881 |
| 59 | Ga0070681_10444084 | 3300005458 | Bacteria | 1209 |
| 60 | Ga0068867_100014153 | 3300005459 | Bacteria | 5651 |
| 61 | Ga0068867_100038622 | 3300005459 | Bacteria | 3476 |
| 62 | Ga0070685_10092761 | 3300005466 | Bacteria | 1830 |
| 63 | Ga0070699_100052569 | 3300005518 | Bacteria | 3525 |
| 64 | Ga0070679_100001720 | 3300005530 | Bacteria | 19738 |
| 65 | Ga0070679_100197625 | 3300005530 | Bacteria | 1978 |
| 66 | Ga0070679_100252584 | 3300005530 | Bacteria | 1719 |
| 67 | Ga0070679_100645925 | 3300005530 | Unclassified | 1001 |
| 68 | Ga0070684_100191908 | 3300005535 | Bacteria | 1859 |
| 69 | Ga0068853_100282550 | 3300005539 | Bacteria | 1530 |
| 70 | Ga0070672_100013830 | 3300005543 | Bacteria | 5707 |
| 71 | Ga0070686_100001603 | 3300005544 | Bacteria | 12722 |
| 72 | Ga0070686_100042370 | 3300005544 | Bacteria | 2851 |
| 73 | Ga0070686_100069512 | 3300005544 | Bacteria | 2300 |
| 74 | Ga0070695_100027921 | 3300005545 | Bacteria | 3499 |
| 75 | Ga0070696_100161689 | 3300005546 | Bacteria | 1650 |
| 76 | Ga0070665_100001206 | 3300005548 | Bacteria | 31498 |
| 77 | Ga0070665_100030247 | 3300005548 | Bacteria | 5450 |
| 78 | Ga0070665_100035528 | 3300005548 | Bacteria | 5012 |
| 79 | Ga0070665_100057979 | 3300005548 | Bacteria | 3882 |
| 80 | Ga0070665_100186702 | 3300005548 | Bacteria | 2074 |
| 81 | Ga0070665_100249416 | 3300005548 | Bacteria | 1776 |
| 82 | Ga0070665_100718760 | 3300005548 | Bacteria | 1012 |
| 83 | Ga0068855_100000430 | 3300005563 | Bacteria | 51996 |
| 84 | Ga0068855_100044104 | 3300005563 | Bacteria | 5279 |
| 85 | Ga0070664_100006418 | 3300005564 | Bacteria | 9488 |
| 86 | Ga0070664_101121887 | 3300005564 | Bacteria | 741 |
| 87 | Ga0068857_100083909 | 3300005577 | Bacteria | 2847 |
| 88 | Ga0068857_100328600 | 3300005577 | Bacteria | 1413 |
| 89 | Ga0068854_100054600 | 3300005578 | Bacteria | 2874 |
| 90 | Ga0068856_100012687 | 3300005614 | Bacteria | 8158 |
| 91 | Ga0068856_100188281 | 3300005614 | Bacteria | 2077 |
| 92 | Ga0068856_100208500 | 3300005614 | Bacteria | 1969 |
| 93 | Ga0070702_100026125 | 3300005615 | Bacteria | 3134 |
| 94 | Ga0068852_100469505 | 3300005616 | Bacteria | 1249 |
| 95 | Ga0068859_100000406 | 3300005617 | Bacteria | 42822 |
| 96 | Ga0068859_100018574 | 3300005617 | Bacteria | 6989 |
| 97 | Ga0068859_100034061 | 3300005617 | Bacteria | 5113 |
| 98 | Ga0068864_100005920 | 3300005618 | Bacteria | 10023 |
| 99 | Ga0068866_10028329 | 3300005718 | Bacteria | 2668 |
| 100 | Ga0068861_100028504 | 3300005719 | Bacteria | 4074 |
| 101 | Ga0068861_100043462 | 3300005719 | Bacteria | 3373 |
| 102 | Ga0068861_100078218 | 3300005719 | Bacteria | 2582 |
| 103 | Ga0068851_10327548 | 3300005834 | Bacteria | 886 |
| 104 | Ga0068863_100006160 | 3300005841 | Bacteria | 11763 |
| 105 | Ga0068863_100012172 | 3300005841 | Bacteria | 8308 |
| 106 | Ga0068863_100013032 | 3300005841 | Bacteria | 8017 |
| 107 | Ga0068858_100000330 | 3300005842 | Bacteria | 50101 |
| 108 | Ga0068858_100022020 | 3300005842 | Bacteria | 5951 |
| 109 | Ga0068858_100304891 | 3300005842 | Bacteria | 1520 |
| 110 | Ga0068858_100371314 | 3300005842 | Bacteria | 1372 |
| 111 | Ga0068860_100006077 | 3300005843 | Bacteria | 12153 |
| 112 | Ga0068860_100013007 | 3300005843 | Bacteria | 8172 |
| 113 | Ga0068860_100041273 | 3300005843 | Bacteria | 4407 |
| 114 | Ga0068862_100000964 | 3300005844 | Bacteria | 27678 |
| 115 | Ga0068862_100002992 | 3300005844 | Bacteria | 14738 |
| 116 | Ga0068862_100087841 | 3300005844 | Bacteria | 2704 |
| 117 | Ga0081455_10162484 | 3300005937 | Bacteria | 1710 |
| 118 | Ga0070717_10198236 | 3300006028 | Bacteria | 1757 |
| 119 | Ga0070715_10061214 | 3300006163 | Bacteria | 1652 |
| 120 | Ga0070715_10063584 | 3300006163 | Bacteria | 1627 |
| 121 | Ga0070716_100011523 | 3300006173 | Bacteria | 4452 |
| 122 | Ga0070716_100039090 | 3300006173 | Bacteria | 2631 |
| 123 | Ga0070712_100002067 | 3300006175 | Bacteria | 12312 |
| 124 | Ga0070712_100032697 | 3300006175 | Bacteria | 3514 |
| 125 | Ga0097621_100054799 | 3300006237 | Bacteria | 3254 |
| 126 | Ga0097621_100089156 | 3300006237 | Bacteria | 2578 |
| 127 | Ga0097621_100117028 | 3300006237 | Bacteria | 2257 |
| 128 | Ga0068871_100086254 | 3300006358 | Bacteria | 2608 |
| 129 | Ga0068871_100353334 | 3300006358 | Bacteria | 1300 |
| 130 | Ga0075428_100004599 | 3300006844 | Bacteria | 15255 |
| 131 | Ga0075428_100034146 | 3300006844 | Bacteria | 5612 |
| 132 | Ga0075430_100003571 | 3300006846 | Bacteria | 13034 |
| 133 | Ga0075430_100010773 | 3300006846 | Bacteria | 7749 |
| 134 | Ga0075430_100224110 | 3300006846 | Bacteria | 1560 |
| 135 | Ga0075431_100001502 | 3300006847 | Bacteria | 21609 |
| 136 | Ga0075431_100064187 | 3300006847 | Bacteria | 3791 |
| 137 | Ga0075431_100115456 | 3300006847 | Bacteria | 2771 |
| 138 | Ga0075431_100151389 | 3300006847 | Bacteria | 2389 |
| 139 | Ga0075429_100004004 | 3300006880 | Bacteria | 12617 |
| 140 | Ga0075429_100012088 | 3300006880 | Bacteria | 7482 |
| 141 | Ga0075429_100367433 | 3300006880 | Bacteria | 1260 |
| 142 | Ga0068865_100095333 | 3300006881 | Bacteria | 2167 |
| 143 | Ga0097620_100000406 | 3300006931 | Bacteria | 42822 |
| 144 | Ga0097620_100018574 | 3300006931 | Bacteria | 6989 |
| 145 | Ga0097620_100034060 | 3300006931 | Bacteria | 5113 |
| 146 | Ga0099794_10029540 | 3300007265 | Bacteria | 2555 |
| 147 | Ga0099795_10038906 | 3300007788 | Bacteria | 1681 |
| 148 | Ga0105250_10021891 | 3300009092 | Bacteria | 2579 |
| 149 | Ga0105240_10021690 | 3300009093 | Bacteria | 8539 |
| 150 | Ga0105240_10028854 | 3300009093 | Bacteria | 7238 |
| 151 | Ga0105240_10031390 | 3300009093 | Bacteria | 6890 |
| 152 | Ga0105240_10040582 | 3300009093 | Bacteria | 5950 |
| 153 | Ga0105240_10132598 | 3300009093 | Bacteria | 2987 |
| 154 | Ga0105240_10155844 | 3300009093 | Bacteria | 2716 |
| 155 | Ga0105240_10269937 | 3300009093 | Bacteria | 1959 |
| 156 | Ga0111539_10008393 | 3300009094 | Bacteria | 13144 |
| 157 | Ga0111539_10009119 | 3300009094 | Bacteria | 12552 |
| 158 | Ga0111539_10053499 | 3300009094 | Bacteria | 4805 |
| 159 | Ga0111539_10139930 | 3300009094 | Bacteria | 2834 |
| 160 | Ga0111539_10208141 | 3300009094 | Bacteria | 2279 |
| 161 | Ga0105245_10006627 | 3300009098 | Bacteria | 10170 |
| 162 | Ga0105245_10512446 | 3300009098 | Bacteria | 1217 |
| 163 | Ga0105247_10000121 | 3300009101 | Bacteria | 75837 |
| 164 | Ga0105247_10017369 | 3300009101 | Bacteria | 4320 |
| 165 | Ga0105247_10427191 | 3300009101 | Bacteria | 950 |
| 166 | Ga0114129_10003320 | 3300009147 | Bacteria | 22605 |
| 167 | Ga0114129_10199810 | 3300009147 | Bacteria | 2709 |
| 168 | Ga0105243_10335975 | 3300009148 | Bacteria | 1382 |
| 169 | Ga0105241_10011336 | 3300009174 | Bacteria | 6535 |
| 170 | Ga0105241_10133809 | 3300009174 | Bacteria | 2010 |
| 171 | Ga0105242_10007452 | 3300009176 | Bacteria | 8425 |
| 172 | Ga0105248_10003310 | 3300009177 | Bacteria | 17884 |
| 173 | Ga0105248_10015452 | 3300009177 | Bacteria | 8413 |
| 174 | Ga0105248_10037449 | 3300009177 | Bacteria | 5426 |
| 175 | Ga0105248_10104018 | 3300009177 | Bacteria | 3201 |
| 176 | Ga0105237_10007569 | 3300009545 | Bacteria | 11873 |
| 177 | Ga0105237_10059289 | 3300009545 | Bacteria | 3829 |
| 178 | Ga0105237_10071121 | 3300009545 | Bacteria | 3474 |
| 179 | Ga0105237_10331235 | 3300009545 | Bacteria | 1527 |
| 180 | Ga0105237_10586216 | 3300009545 | Bacteria | 1122 |
| 181 | Ga0105238_10416397 | 3300009551 | Bacteria | 1338 |
| 182 | Ga0105238_10417492 | 3300009551 | Bacteria | 1336 |
| 183 | Ga0105238_10421831 | 3300009551 | Bacteria | 1329 |
| 184 | Ga0105249_10005346 | 3300009553 | Bacteria | 11078 |
| 185 | Ga0105249_10010397 | 3300009553 | Bacteria | 8177 |
| 186 | Ga0105249_10019072 | 3300009553 | Bacteria | 6117 |
| 187 | Ga0105249_10039328 | 3300009553 | Bacteria | 4294 |
| 188 | Ga0105249_10190707 | 3300009553 | Bacteria | 2000 |
| 189 | Ga0105239_10025114 | 3300010375 | Bacteria | 6563 |
| 190 | Ga0105239_10259052 | 3300010375 | Bacteria | 1954 |
| 191 | Ga0105246_10030856 | 3300011119 | Bacteria | 3543 |
| 192 | Ga0157369_10063138 | 3300013105 | Bacteria | 3991 |
| 193 | Ga0157374_10004235 | 3300013296 | Bacteria | 12058 |
| 194 | Ga0157374_10113725 | 3300013296 | Bacteria | 2605 |
| 195 | Ga0157378_10018225 | 3300013297 | Bacteria | 6163 |
| 196 | Ga0163162_10042988 | 3300013306 | Bacteria | 4523 |
| 197 | Ga0163162_10151572 | 3300013306 | Bacteria | 2437 |
| 198 | Ga0163162_10270258 | 3300013306 | Bacteria | 1832 |
| 199 | Ga0163162_10559184 | 3300013306 | Bacteria | 1272 |
| 200 | Ga0157372_10133548 | 3300013307 | Bacteria | 2857 |
| 201 | Ga0157372_10210981 | 3300013307 | Bacteria | 2251 |
| 202 | Ga0157375_10093432 | 3300013308 | Bacteria | 3074 |
| 203 | Ga0157375_10156116 | 3300013308 | Bacteria | 2421 |
| 204 | Ga0163163_10000224 | 3300014325 | Bacteria | 58364 |
| 205 | Ga0163163_10095289 | 3300014325 | Bacteria | 2996 |
| 206 | Ga0163163_10098889 | 3300014325 | Bacteria | 2939 |
| 207 | Ga0163163_10170415 | 3300014325 | Bacteria | 2223 |
| 208 | Ga0163163_10600005 | 3300014325 | Bacteria | 1164 |
| 209 | Ga0157377_10004582 | 3300014745 | Bacteria | 6385 |
| 210 | Ga0157379_10018255 | 3300014968 | Bacteria | 6182 |
| 211 | Ga0157379_10018378 | 3300014968 | Bacteria | 6163 |
| 212 | Ga0157379_10096304 | 3300014968 | Bacteria | 2656 |
| 213 | Ga0157379_10312959 | 3300014968 | Bacteria | 1432 |
| 214 | Ga0157379_10432862 | 3300014968 | Bacteria | 1212 |
| 215 | Ga0157376_10297088 | 3300014969 | Bacteria | 1527 |
| 216 | Ga0157376_10331552 | 3300014969 | Bacteria | 1450 |
| 217 | Ga0163161_10051924 | 3300017792 | Bacteria | 2972 |
| 218 | Ga0213872_10111046 | 3300021361 | Bacteria | 1218 |
| 219 | Ga0213874_10053720 | 3300021377 | Bacteria | 1243 |
| 220 | Ga0213874_10069458 | 3300021377 | Bacteria | 1120 |
| 221 | Ga0213871_10062904 | 3300021441 | Bacteria | 1036 |
| 222 | Ga0207692_10062106 | 3300025898 | Bacteria | 1938 |
| 223 | Ga0207642_10046387 | 3300025899 | Bacteria | 1936 |
| 224 | Ga0207710_10000156 | 3300025900 | Bacteria | 73078 |
| 225 | Ga0207710_10013173 | 3300025900 | Bacteria | 3484 |
| 226 | Ga0207710_10048974 | 3300025900 | Bacteria | 1892 |
| 227 | Ga0207688_10035285 | 3300025901 | Bacteria | 2771 |
| 228 | Ga0207688_10320913 | 3300025901 | Bacteria | 950 |
| 229 | Ga0207680_10005027 | 3300025903 | Bacteria | 6303 |
| 230 | Ga0207680_10019582 | 3300025903 | Bacteria | 3622 |
| 231 | Ga0207680_10037509 | 3300025903 | Bacteria | 2798 |
| 232 | Ga0207680_10105811 | 3300025903 | Bacteria | 1816 |
| 233 | Ga0207685_10057621 | 3300025905 | Bacteria | 1525 |
| 234 | Ga0207699_10004337 | 3300025906 | Bacteria | 6784 |
| 235 | Ga0207699_10019985 | 3300025906 | Bacteria | 3581 |
| 236 | Ga0207645_10080607 | 3300025907 | Bacteria | 2086 |
| 237 | Ga0207645_10170043 | 3300025907 | Bacteria | 1428 |
| 238 | Ga0207654_10612632 | 3300025911 | Bacteria | 778 |
| 239 | Ga0207707_10035001 | 3300025912 | Bacteria | 4392 |
| 240 | Ga0207707_10187897 | 3300025912 | Bacteria | 1803 |
| 241 | Ga0207707_10265105 | 3300025912 | Unclassified | 1490 |
| 242 | Ga0207695_10012860 | 3300025913 | Bacteria | 10019 |
| 243 | Ga0207695_10017655 | 3300025913 | Bacteria | 8290 |
| 244 | Ga0207695_10110248 | 3300025913 | Bacteria | 2732 |
| 245 | Ga0207695_10125113 | 3300025913 | Bacteria | 2534 |
| 246 | Ga0207695_10161072 | 3300025913 | Bacteria | 2175 |
| 247 | Ga0207671_10135856 | 3300025914 | Bacteria | 1891 |
| 248 | Ga0207671_10390523 | 3300025914 | Bacteria | 1106 |
| 249 | Ga0207671_10528168 | 3300025914 | Unclassified | 941 |
| 250 | Ga0207693_10003470 | 3300025915 | Bacteria | 13451 |
| 251 | Ga0207663_10029268 | 3300025916 | Bacteria | 3233 |
| 252 | Ga0207663_10071005 | 3300025916 | Bacteria | 2245 |
| 253 | Ga0207663_10268686 | 3300025916 | Bacteria | 1262 |
| 254 | Ga0207660_10010562 | 3300025917 | Bacteria | 5996 |
| 255 | Ga0207662_10004422 | 3300025918 | Bacteria | 7391 |
| 256 | Ga0207657_10402287 | 3300025919 | Bacteria | 1077 |
| 257 | Ga0207649_10064865 | 3300025920 | Bacteria | 2310 |
| 258 | Ga0207652_10018298 | 3300025921 | Bacteria | 5746 |
| 259 | Ga0207681_10041775 | 3300025923 | Bacteria | 3059 |
| 260 | Ga0207694_10095602 | 3300025924 | Bacteria | 2349 |
| 261 | Ga0207694_10374751 | 3300025924 | Bacteria | 1181 |
| 262 | Ga0207659_10001804 | 3300025926 | Bacteria | 12667 |
| 263 | Ga0207687_10334965 | 3300025927 | Bacteria | 1229 |
| 264 | Ga0207700_10010282 | 3300025928 | Bacteria | 5893 |
| 265 | Ga0207700_10049162 | 3300025928 | Bacteria | 3136 |
| 266 | Ga0207700_10330715 | 3300025928 | Bacteria | 1322 |
| 267 | Ga0207700_10471811 | 3300025928 | Bacteria | 1108 |
| 268 | Ga0207664_10052313 | 3300025929 | Bacteria | 3230 |
| 269 | Ga0207664_10137571 | 3300025929 | Bacteria | 2062 |
| 270 | Ga0207644_10001074 | 3300025931 | Bacteria | 17501 |
| 271 | Ga0207644_10040757 | 3300025931 | Bacteria | 3282 |
| 272 | Ga0207644_10602885 | 3300025931 | Bacteria | 912 |
| 273 | Ga0207706_10079481 | 3300025933 | Bacteria | 2884 |
| 274 | Ga0207709_10057906 | 3300025935 | Bacteria | 2405 |
| 275 | Ga0207670_10008874 | 3300025936 | Bacteria | 5698 |
| 276 | Ga0207704_10006319 | 3300025938 | Bacteria | 5517 |
| 277 | Ga0207704_11094631 | 3300025938 | Bacteria | 677 |
| 278 | Ga0207665_10103157 | 3300025939 | Bacteria | 1994 |
| 279 | Ga0207691_10004479 | 3300025940 | Bacteria | 13536 |
| 280 | Ga0207711_10020470 | 3300025941 | Bacteria | 5516 |
| 281 | Ga0207711_10115545 | 3300025941 | Bacteria | 2391 |
| 282 | Ga0207711_10218530 | 3300025941 | Bacteria | 1742 |
| 283 | Ga0207689_10005177 | 3300025942 | Bacteria | 11713 |
| 284 | Ga0207689_10290643 | 3300025942 | Bacteria | 1354 |
| 285 | Ga0207661_10095298 | 3300025944 | Bacteria | 2488 |
| 286 | Ga0207679_10029066 | 3300025945 | Bacteria | 3845 |
| 287 | Ga0207667_10001582 | 3300025949 | Bacteria | 28630 |
| 288 | Ga0207667_10103672 | 3300025949 | Bacteria | 2934 |
| 289 | Ga0207651_10007041 | 3300025960 | Bacteria | 5963 |
| 290 | Ga0207651_10539969 | 3300025960 | Bacteria | 1012 |
| 291 | Ga0207712_10092926 | 3300025961 | Bacteria | 2225 |
| 292 | Ga0207712_10112237 | 3300025961 | Bacteria | 2047 |
| 293 | Ga0207712_10306154 | 3300025961 | Bacteria | 1306 |
| 294 | Ga0207712_10339821 | 3300025961 | Bacteria | 1245 |
| 295 | Ga0207668_10016147 | 3300025972 | Bacteria | 4654 |
| 296 | Ga0207640_10063039 | 3300025981 | Bacteria | 2462 |
| 297 | Ga0207658_10004873 | 3300025986 | Bacteria | 9263 |
| 298 | Ga0207658_10133104 | 3300025986 | Bacteria | 2000 |
| 299 | Ga0207677_10172390 | 3300026023 | Bacteria | 1693 |
| 300 | Ga0207677_10917787 | 3300026023 | Bacteria | 790 |
| 301 | Ga0207703_10000366 | 3300026035 | Bacteria | 48363 |
| 302 | Ga0207703_10000934 | 3300026035 | Bacteria | 28340 |
| 303 | Ga0207703_10153953 | 3300026035 | Bacteria | 2007 |
| 304 | Ga0207703_10497357 | 3300026035 | Bacteria | 1144 |
| 305 | Ga0207703_10655985 | 3300026035 | Bacteria | 996 |
| 306 | Ga0207678_10158512 | 3300026067 | Bacteria | 1933 |
| 307 | Ga0207708_10160233 | 3300026075 | Bacteria | 1776 |
| 308 | Ga0207702_10168801 | 3300026078 | Bacteria | 2004 |
| 309 | Ga0207702_10631137 | 3300026078 | Bacteria | 1053 |
| 310 | Ga0207641_10000196 | 3300026088 | Bacteria | 81985 |
| 311 | Ga0207641_10026648 | 3300026088 | Bacteria | 4772 |
| 312 | Ga0207641_10150471 | 3300026088 | Bacteria | 2107 |
| 313 | Ga0207641_10155847 | 3300026088 | Bacteria | 2072 |
| 314 | Ga0207648_10017152 | 3300026089 | Bacteria | 6598 |
| 315 | Ga0207648_10054165 | 3300026089 | Bacteria | 3504 |
| 316 | Ga0207676_10057171 | 3300026095 | Bacteria | 3071 |
| 317 | Ga0207676_10150039 | 3300026095 | Bacteria | 2007 |
| 318 | Ga0207674_10048501 | 3300026116 | Bacteria | 4346 |
| 319 | Ga0207674_10129843 | 3300026116 | Bacteria | 2484 |
| 320 | Ga0207675_100048326 | 3300026118 | Bacteria | 3972 |
| 321 | Ga0207675_100115965 | 3300026118 | Bacteria | 2531 |
| 322 | Ga0207675_100623444 | 3300026118 | Bacteria | 1083 |
| 323 | Ga0207683_10005129 | 3300026121 | Bacteria | 11244 |
| 324 | Ga0207683_10085484 | 3300026121 | Bacteria | 2804 |
| 325 | Ga0207428_10005862 | 3300027907 | Bacteria | 11387 |
| 326 | Ga0207428_10031564 | 3300027907 | Bacteria | 4367 |
| 327 | Ga0207428_10081208 | 3300027907 | Bacteria | 2532 |
| 328 | Ga0268266_10000938 | 3300028379 | Bacteria | 37164 |
| 329 | Ga0268266_10002660 | 3300028379 | Bacteria | 18804 |
| 330 | Ga0268266_10081289 | 3300028379 | Bacteria | 2825 |
| 331 | Ga0268266_10122198 | 3300028379 | Bacteria | 2318 |
| 332 | Ga0268266_10134031 | 3300028379 | Bacteria | 2217 |
| 333 | Ga0268266_10196693 | 3300028379 | Bacteria | 1843 |
| 334 | Ga0268266_10758878 | 3300028379 | Bacteria | 936 |
| 335 | Ga0268265_10008201 | 3300028380 | Bacteria | 7058 |
| 336 | Ga0268265_10025509 | 3300028380 | Bacteria | 4197 |
| 337 | Ga0268264_10000182 | 3300028381 | Bacteria | 134007 |
| 338 | Ga0268264_10070440 | 3300028381 | Bacteria | 2960 |
| 339 | Ga0268264_10087115 | 3300028381 | Bacteria | 2684 |
| 340 | Ga0265334_10008041 | 3300028573 | Bacteria | 4502 |
| 341 | Ga0265338_10343473 | 3300028800 | Bacteria | 1075 |
| 342 | Ga0307511_10000008 | 3300030521 | Bacteria | 159928 |
| 343 | Ga0265328_10132286 | 3300031239 | Bacteria | 934 |
| 344 | Ga0265340_10035104 | 3300031247 | Bacteria | 2491 |
| 345 | Ga0265340_10043220 | 3300031247 | Bacteria | 2209 |
| 346 | Ga0265340_10193320 | 3300031247 | Bacteria | 917 |
| 347 | Ga0307513_10068953 | 3300031456 | Bacteria | 3702 |
| 348 | Ga0307509_10000154 | 3300031507 | Bacteria | 106459 |
| 349 | Ga0307509_10000162 | 3300031507 | Bacteria | 104449 |
| 350 | Ga0307408_100474905 | 3300031548 | Bacteria | 1090 |
| 351 | Ga0307408_100606754 | 3300031548 | Bacteria | 973 |
| 352 | Ga0265313_10026139 | 3300031595 | Bacteria | 3081 |
| 353 | Ga0307508_10245082 | 3300031616 | Bacteria | 1389 |
| 354 | Ga0307508_10302614 | 3300031616 | Bacteria | 1192 |
| 355 | Ga0307413_10036708 | 3300031824 | Bacteria | 2824 |
| 356 | Ga0307413_10119921 | 3300031824 | Bacteria | 1780 |
| 357 | Ga0307413_10844183 | 3300031824 | Bacteria | 773 |
| 358 | Ga0307406_10033435 | 3300031901 | Bacteria | 3148 |
| 359 | Ga0307407_10356036 | 3300031903 | Bacteria | 1038 |
| 360 | Ga0307409_100039376 | 3300031995 | Bacteria | 3507 |
| 361 | Ga0307409_101145149 | 3300031995 | Bacteria | 800 |
| 362 | Ga0307409_101444317 | 3300031995 | Bacteria | 715 |
| 363 | Ga0307416_100165328 | 3300032002 | Bacteria | 2051 |
| 364 | Ga0307416_100915629 | 3300032002 | Bacteria | 977 |
| 365 | Ga0307414_10277466 | 3300032004 | Unclassified | 1407 |
| 366 | Ga0307411_10792977 | 3300032005 | Unclassified | 833 |
| 367 | Ga0307415_100037822 | 3300032126 | Bacteria | 3175 |
| 368 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 369 | Ga0307510_10000959 | 3300033180 | Bacteria | 30502 |
| 370 | Ga0373958_0034278 | 3300034819 | Bacteria | 1011 |
| 371 | Ga0373936_0025191 | 3300035113 | Unclassified | 2325 |
| 372 | Ga0373936_0076094 | 3300035113 | Bacteria | 1390 |
| 373 | Ga0373945_0043753 | 3300035116 | Bacteria | 1626 |
| 374 | Ga0373956_0225224 | 3300035119 | Unclassified | 890 |
| 375 | Ga0373943_0027338 | 3300035170 | Bacteria | 2680 |
| 376 | Ga0373946_0039609 | 3300035171 | Bacteria | 1924 |
| 377 | Ga0373955_0083623 | 3300035172 | Bacteria | 1808 |
| 378 | Ga0373931_0219121 | 3300035691 | Bacteria | 1145 |
| 379 | Ga0373927_0019863 | 3300035695 | Bacteria | 4405 |
| 380 | Ga0373947_0096605 | 3300035725 | Bacteria | 1850 |
| 381 | Ga0373937_0063084 | 3300036401 | Bacteria | 3407 |
| 382 | Ga0373925_0119420 | 3300037068 | Bacteria | 2045 |
| 383 | Ga0373925_0284718 | 3300037068 | Bacteria | 1332 |
| 384 | Ga0436365_0509966 | 3300039437 | Bacteria | 3793 |
| 385 | Ga0436365_0981884 | 3300039437 | Bacteria | 3421 |
| 386 | Ga0436365_1338189 | 3300039437 | Bacteria | 806 |
| 387 | Ga0436360_0578160 | 3300039438 | Bacteria | 8826 |
| 388 | Ga0436360_0584636 | 3300039438 | Bacteria | 829 |
| 389 | Ga0436360_0732653 | 3300039438 | Bacteria | 1023 |
| 390 | Ga0436361_1047185 | 3300039447 | Bacteria | 1912 |
| 391 | Ga0436363_1033365 | 3300039450 | Bacteria | 15814 |
| 392 | Ga0436363_1305614 | 3300039450 | Bacteria | 8672 |
| 393 | Ga0436363_1490709 | 3300039450 | Bacteria | 2593 |
| 394 | Ga0436362_0021549 | 3300039453 | Bacteria | 1035 |
| 395 | Ga0436362_1178881 | 3300039453 | Bacteria | 2209 |
| 396 | Ga0436362_1277379 | 3300039453 | Bacteria | 1755 |
| 397 | Ga0451797_1206887 | 3300041453 | Bacteria | 885 |
| 398 | Ga0439448_0120213 | 3300042005 | Bacteria | 901 |
| 399 | Ga0450888_032563 | 3300042126 | Bacteria | 702 |
| 400 | Ga0439464_0034504 | 3300042439 | Bacteria | 1427 |
| 401 | Ga0439440_0034537 | 3300042993 | Bacteria | 1210 |
| 402 | Ga0466969_0000684 | 3300044656 | Bacteria | 18469 |
| 403 | Ga0466969_0006450 | 3300044656 | Bacteria | 6245 |
| 404 | Ga0466969_0013465 | 3300044656 | Bacteria | 4308 |
| 405 | Ga0466965_0072025 | 3300044683 | Bacteria | 1739 |
| 406 | Ga0466966_0001828 | 3300044684 | Bacteria | 13811 |
| 407 | Ga0466966_0043011 | 3300044684 | Bacteria | 2897 |
| 408 | Ga0466961_0000614 | 3300044693 | Bacteria | 22481 |
| 409 | Ga0466964_0000095 | 3300044706 | Bacteria | 21226 |
| 410 | Ga0466971_0003951 | 3300044719 | Bacteria | 6370 |
| 411 | Ga0466970_0020292 | 3300044765 | Bacteria | 3451 |
| 412 | Ga0466970_0401912 | 3300044765 | Bacteria | 782 |
| 413 | Ga0466959_0007718 | 3300045049 | Bacteria | 7560 |
| 414 | Ga0466959_0394123 | 3300045049 | Bacteria | 941 |
| 415 | Ga0451576_0111304 | 3300045051 | Bacteria | 2849 |
| 416 | Ga0466958_0028366 | 3300045836 | Bacteria | 3319 |
| 417 | Ga0466958_0398262 | 3300045836 | Bacteria | 889 |
| 418 | Ga0495638_0226812 | 3300046460 | Bacteria | 1041 |
| 419 | Ga0495650_0011741 | 3300046471 | Bacteria | 4766 |
| 420 | Ga0495580_0003185 | 3300046472 | Bacteria | 14055 |
| 421 | Ga0495580_0172968 | 3300046472 | Bacteria | 1492 |
| 422 | Ga0495580_0461737 | 3300046472 | Bacteria | 851 |
| 423 | Ga0495580_0520504 | 3300046472 | Bacteria | 793 |
| 424 | Ga0495639_0023259 | 3300046475 | Bacteria | 2723 |
| 425 | Ga0495606_0078058 | 3300046507 | Bacteria | 2066 |
| 426 | Ga0495606_0134806 | 3300046507 | Bacteria | 1464 |
| 427 | Ga0495628_0057204 | 3300046516 | Bacteria | 3068 |
| 428 | Ga0495630_0072304 | 3300046517 | Bacteria | 2596 |
| 429 | Ga0495632_0030263 | 3300046519 | Bacteria | 2812 |
| 430 | Ga0495586_0129488 | 3300046535 | Bacteria | 1413 |
| 431 | Ga0495645_0181220 | 3300046543 | Bacteria | 1443 |
| 432 | Ga0495634_0293825 | 3300046642 | Bacteria | 984 |
| 433 | Ga0495625_0183446 | 3300046660 | Bacteria | 1390 |
| 434 | Ga0495647_0042515 | 3300046681 | Bacteria | 1735 |
| 435 | Ga0495647_0126272 | 3300046681 | Unclassified | 1080 |
| 436 | Ga0495658_0008333 | 3300046683 | Bacteria | 5135 |
| 437 | Ga0495658_0079599 | 3300046683 | Bacteria | 1920 |
| 438 | Ga0495624_0305940 | 3300046690 | Bacteria | 958 |
| 439 | Ga0495674_0105299 | 3300047319 | Bacteria | 2397 |
| 440 | Ga0495672_0134952 | 3300047320 | Bacteria | 1295 |
| 441 | Ga0495680_0338544 | 3300047322 | Bacteria | 1050 |
| 442 | Ga0495687_056788 | 3300047443 | Bacteria | 1631 |
| 443 | Ga0495687_118435 | 3300047443 | Bacteria | 960 |
| 444 | Ga0495686_0068866 | 3300047472 | Bacteria | 2183 |
| 445 | Ga0496100_0062048 | 3300048903 | Bacteria | 2465 |
| 446 | Ga0496101_0016954 | 3300048904 | Bacteria | 4931 |
| 447 | Ga0496101_0614928 | 3300048904 | Bacteria | 859 |
| 448 | Ga0496102_0005754 | 3300048905 | Bacteria | 10535 |
| 449 | Ga0496102_0009171 | 3300048905 | Bacteria | 8488 |
| 450 | Ga0496102_0019614 | 3300048905 | Bacteria | 5957 |
| 451 | Ga0496102_0135186 | 3300048905 | Bacteria | 2310 |
| 452 | Ga0496103_0052221 | 3300048906 | Bacteria | 2532 |
| 453 | Ga0496104_0034341 | 3300048907 | Bacteria | 4729 |
| 454 | Ga0496104_0140401 | 3300048907 | Bacteria | 2321 |
| 455 | Ga0496104_0153842 | 3300048907 | Bacteria | 2207 |
| 456 | Ga0496104_0345594 | 3300048907 | Bacteria | 1400 |
| 457 | Ga0496105_0148357 | 3300048908 | Bacteria | 1928 |
| 458 | Ga0496106_0007946 | 3300048909 | Bacteria | 7837 |
| 459 | Ga0496106_0047111 | 3300048909 | Bacteria | 3243 |
| 460 | Ga0496106_0391070 | 3300048909 | Bacteria | 1117 |
| 461 | Ga0496106_0449786 | 3300048909 | Bacteria | 1035 |
| 462 | Ga0496106_0715968 | 3300048909 | Bacteria | 797 |
| 463 | Ga0496107_0079291 | 3300048910 | Bacteria | 2393 |
| 464 | Ga0496108_0008197 | 3300048911 | Bacteria | 8480 |
| 465 | Ga0496108_0067260 | 3300048911 | Bacteria | 3022 |
| 466 | Ga0496109_0029076 | 3300048912 | Bacteria | 4947 |
| 467 | Ga0496109_0495577 | 3300048912 | Bacteria | 1153 |
| 468 | Ga0496110_0107308 | 3300048913 | Bacteria | 2506 |
| 469 | Ga0496110_0112707 | 3300048913 | Bacteria | 2445 |
| 470 | Ga0496111_0000810 | 3300048914 | Bacteria | 16784 |
| 471 | Ga0496111_0124432 | 3300048914 | Bacteria | 1906 |
| 472 | Ga0496112_0020539 | 3300048915 | Bacteria | 6263 |
| 473 | Ga0496112_0033730 | 3300048915 | Bacteria | 4977 |
| 474 | Ga0496113_0076939 | 3300048916 | Bacteria | 2550 |
| 475 | Ga0496114_0147574 | 3300048917 | Bacteria | 2039 |
| 476 | Ga0496115_0037648 | 3300048918 | Bacteria | 3834 |
| 477 | Ga0496116_0273968 | 3300048919 | Bacteria | 822 |
| 478 | Ga0496117_0000095 | 3300048920 | Bacteria | 198731 |
| 479 | Ga0496117_0076827 | 3300048920 | Bacteria | 2212 |
| 480 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 481 | Ga0496118_0081800 | 3300048921 | Bacteria | 2266 |
| 482 | Ga0496119_0003983 | 3300048922 | Bacteria | 14949 |
| 483 | Ga0496119_0012799 | 3300048922 | Bacteria | 6768 |
| 484 | Ga0496120_0000842 | 3300048923 | Bacteria | 43622 |
| 485 | Ga0496121_0000547 | 3300048924 | Bacteria | 70979 |
| 486 | Ga0496121_0251154 | 3300048924 | Bacteria | 1226 |
| 487 | Ga0496125_0000112 | 3300048928 | Bacteria | 188192 |
| 488 | Ga0496125_0002321 | 3300048928 | Bacteria | 25054 |
| 489 | Ga0496125_0006226 | 3300048928 | Bacteria | 12987 |
| 490 | Ga0496126_0001774 | 3300048929 | Bacteria | 31913 |
| 491 | Ga0496126_0585245 | 3300048929 | Bacteria | 881 |
| 492 | Ga0501297_019143 | 3300049520 | Unclassified | 845 |
| 493 | Ga0501299_113966 | 3300049522 | Bacteria | 643 |
| 494 | Ga0501034_0161459 | 3300049571 | Bacteria | 2212 |
| 495 | Ga0501046_0153975 | 3300049580 | Unclassified | 1733 |
| 496 | Ga0501047_0069767 | 3300049581 | Bacteria | 3384 |
| 497 | Ga0501067_0147069 | 3300049583 | Bacteria | 1313 |
| 498 | nmdc:mga05p37_37913_c1 | 3300050507 | Bacteria | 5912 |
| 499 | nmdc:mga05p37_51358_c1 | 3300050507 | Bacteria | 3037 |
| 500 | nmdc:mga09592_200742_c1 | 3300050508 | Bacteria | 1727 |
| 501 | nmdc:mga09592_32024_c1 | 3300050508 | Bacteria | 4383 |
| 502 | nmdc:mga09592_7589_c1 | 3300050508 | Bacteria | 8822 |
| 503 | nmdc:mga0qj67_14359_c1 | 3300050509 | Bacteria | 5988 |
| 504 | nmdc:mga0qj67_22091_c1 | 3300050509 | Bacteria | 4884 |
| 505 | nmdc:mga0qj67_316727_c1 | 3300050509 | Bacteria | 1263 |
| 506 | nmdc:mga0qj67_32398_c1 | 3300050509 | Unclassified | 4075 |
| 507 | nmdc:mga0qj67_49041_c1 | 3300050509 | Bacteria | 3337 |
| 508 | nmdc:mga0qj67_841683_c1 | 3300050509 | Bacteria | 725 |
| 509 | nmdc:mga06r32_1290_c1 | 3300050510 | Bacteria | 22556 |
| 510 | nmdc:mga06r32_1456893_c1 | 3300050510 | Bacteria | 626 |
| 511 | nmdc:mga06r32_336_c1 | 3300050510 | Bacteria | 39160 |
| 512 | nmdc:mga06r32_410620_c1 | 3300050510 | Bacteria | 1335 |
| 513 | nmdc:mga06r32_4764_c1 | 3300050510 | Bacteria | 12199 |
| 514 | nmdc:mga08y16_333127_c1 | 3300050511 | Bacteria | 1561 |
| 515 | nmdc:mga08y16_350053_c1 | 3300050511 | Bacteria | 1518 |
| 516 | nmdc:mga08y16_4878_c1 | 3300050511 | Bacteria | 14012 |
| 517 | nmdc:mga08y16_6554_c1 | 3300050511 | Bacteria | 12205 |
| 518 | nmdc:mga08x19_181679_c1 | 3300050514 | Bacteria | 1436 |
| 519 | Ga0495619_0389184 | 3300053085 | Unclassified | 963 |
| 520 | Ga0500614_123138 | 3300053123 | Unclassified | 765 |
| 521 | Ga0500617_029067 | 3300053124 | Bacteria | 2466 |
| 522 | Ga0500658_0079160 | 3300053134 | Bacteria | 1402 |
| 523 | Ga0500568_0075629 | 3300053139 | Bacteria | 1283 |
| 524 | Ga0500588_0003915 | 3300053146 | Bacteria | 3185 |
| 525 | Ga0500616_0203559 | 3300053153 | Bacteria | 875 |
| 526 | Ga0500622_0002144 | 3300053156 | Bacteria | 14664 |
| 527 | Ga0500622_0007193 | 3300053156 | Bacteria | 6342 |
| 528 | Ga0500630_133595 | 3300053159 | Bacteria | 1080 |
| 529 | Ga0500637_0022394 | 3300053178 | Bacteria | 3443 |
| 530 | Ga0500637_0059240 | 3300053178 | Bacteria | 2191 |
| 531 | Ga0466962_0000111 | 3300061719 | Bacteria | 33174 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_100066377 | Ga0070662_1000663772 | 167 |
| 2 | 3300009094 | Ga0111539_10208141 | Ga0111539_102081413 | 167 |
| 3 | 3300050511 | nmdc:mga08y16_333127_c1 | nmdc:mga08y16_333127_c1_250_795 | 167 |
| 4 | 3300053134 | Ga0500658_0079160 | Ga0500658_0079160_553_1080 | 173 |
| 5 | 3300049522 | Ga0501299_113966 | Ga0501299_113966_62_628 | 175 |
| 6 | 3300049581 | Ga0501047_0069767 | Ga0501047_0069767_1677_2210 | 175 |
| 7 | 3300005293 | Ga0065715_10536340 | Ga0065715_105363401 | 176 |
| 8 | 3300005329 | Ga0070683_100202970 | Ga0070683_1002029702 | 176 |
| 9 | 3300005330 | Ga0070690_100005087 | Ga0070690_1000050879 | 176 |
| 10 | 3300005334 | Ga0068869_100297601 | Ga0068869_1002976012 | 176 |
| 11 | 3300005335 | Ga0070666_10025349 | Ga0070666_100253493 | 176 |
| 12 | 3300005338 | Ga0068868_100161301 | Ga0068868_1001613013 | 176 |
| 13 | 3300005340 | Ga0070689_100004646 | Ga0070689_1000046464 | 176 |
| 14 | 3300005344 | Ga0070661_100048418 | Ga0070661_1000484182 | 176 |
| 15 | 3300005347 | Ga0070668_100277099 | Ga0070668_1002770991 | 176 |
| 16 | 3300005354 | Ga0070675_100001313 | Ga0070675_10000131314 | 176 |
| 17 | 3300005364 | Ga0070673_100003052 | Ga0070673_10000305213 | 176 |
| 18 | 3300005365 | Ga0070688_100001473 | Ga0070688_10000147314 | 176 |
| 19 | 3300005366 | Ga0070659_100595272 | Ga0070659_1005952722 | 176 |
| 20 | 3300005367 | Ga0070667_100017869 | Ga0070667_1000178696 | 176 |
| 21 | 3300005438 | Ga0070701_10021666 | Ga0070701_100216663 | 176 |
| 22 | 3300005440 | Ga0070705_100051614 | Ga0070705_1000516142 | 176 |
| 23 | 3300005441 | Ga0070700_100025522 | Ga0070700_1000255224 | 176 |
| 24 | 3300005444 | Ga0070694_100680856 | Ga0070694_1006808562 | 176 |
| 25 | 3300005456 | Ga0070678_100092629 | Ga0070678_1000926293 | 176 |
| 26 | 3300005459 | Ga0068867_100014153 | Ga0068867_1000141533 | 176 |
| 27 | 3300005466 | Ga0070685_10092761 | Ga0070685_100927613 | 176 |
| 28 | 3300005539 | Ga0068853_100282550 | Ga0068853_1002825502 | 176 |
| 29 | 3300005543 | Ga0070672_100013830 | Ga0070672_1000138304 | 176 |
| 30 | 3300005544 | Ga0070686_100001603 | Ga0070686_10000160313 | 176 |
| 31 | 3300005548 | Ga0070665_100030247 | Ga0070665_1000302476 | 176 |
| 32 | 3300005564 | Ga0070664_100006418 | Ga0070664_10000641810 | 176 |
| 33 | 3300005577 | Ga0068857_100083909 | Ga0068857_1000839095 | 176 |
| 34 | 3300005578 | Ga0068854_100054600 | Ga0068854_1000546004 | 176 |
| 35 | 3300005615 | Ga0070702_100026125 | Ga0070702_1000261255 | 176 |
| 36 | 3300005617 | Ga0068859_100034061 | Ga0068859_1000340614 | 176 |
| 37 | 3300005618 | Ga0068864_100005920 | Ga0068864_1000059205 | 176 |
| 38 | 3300005718 | Ga0068866_10028329 | Ga0068866_100283294 | 176 |
| 39 | 3300005719 | Ga0068861_100028504 | Ga0068861_1000285045 | 176 |
| 40 | 3300005834 | Ga0068851_10327548 | Ga0068851_103275481 | 176 |
| 41 | 3300005841 | Ga0068863_100006160 | Ga0068863_1000061609 | 176 |
| 42 | 3300005844 | Ga0068862_100002992 | Ga0068862_10000299215 | 176 |
| 43 | 3300006237 | Ga0097621_100054799 | Ga0097621_1000547993 | 176 |
| 44 | 3300006931 | Ga0097620_100034060 | Ga0097620_1000340607 | 176 |
| 45 | 3300009098 | Ga0105245_10512446 | Ga0105245_105124462 | 176 |
| 46 | 3300009177 | Ga0105248_10003310 | Ga0105248_100033105 | 176 |
| 47 | 3300009553 | Ga0105249_10039328 | Ga0105249_100393284 | 176 |
| 48 | 3300013308 | Ga0157375_10093432 | Ga0157375_100934323 | 176 |
| 49 | 3300014325 | Ga0163163_10000224 | Ga0163163_100002248 | 176 |
| 50 | 3300014745 | Ga0157377_10004582 | Ga0157377_100045828 | 176 |
| 51 | 3300014968 | Ga0157379_10312959 | Ga0157379_103129592 | 176 |
| 52 | 3300017792 | Ga0163161_10051924 | Ga0163161_100519244 | 176 |
| 53 | 3300025899 | Ga0207642_10046387 | Ga0207642_100463872 | 176 |
| 54 | 3300025900 | Ga0207710_10048974 | Ga0207710_100489743 | 176 |
| 55 | 3300025901 | Ga0207688_10035285 | Ga0207688_100352855 | 176 |
| 56 | 3300025903 | Ga0207680_10005027 | Ga0207680_100050275 | 176 |
| 57 | 3300025907 | Ga0207645_10170043 | Ga0207645_101700432 | 176 |
| 58 | 3300025918 | Ga0207662_10004422 | Ga0207662_100044222 | 176 |
| 59 | 3300025919 | Ga0207657_10402287 | Ga0207657_104022872 | 176 |
| 60 | 3300025920 | Ga0207649_10064865 | Ga0207649_100648652 | 176 |
| 61 | 3300025923 | Ga0207681_10041775 | Ga0207681_100417752 | 176 |
| 62 | 3300025926 | Ga0207659_10001804 | Ga0207659_100018049 | 176 |
| 63 | 3300025927 | Ga0207687_10334965 | Ga0207687_103349652 | 176 |
| 64 | 3300025936 | Ga0207670_10008874 | Ga0207670_100088745 | 176 |
| 65 | 3300025940 | Ga0207691_10004479 | Ga0207691_1000447914 | 176 |
| 66 | 3300025941 | Ga0207711_10115545 | Ga0207711_101155453 | 176 |
| 67 | 3300025942 | Ga0207689_10005177 | Ga0207689_100051772 | 176 |
| 68 | 3300025945 | Ga0207679_10029066 | Ga0207679_100290666 | 176 |
| 69 | 3300025960 | Ga0207651_10007041 | Ga0207651_100070416 | 176 |
| 70 | 3300025961 | Ga0207712_10112237 | Ga0207712_101122372 | 176 |
| 71 | 3300025981 | Ga0207640_10063039 | Ga0207640_100630393 | 176 |
| 72 | 3300026023 | Ga0207677_10917787 | Ga0207677_109177871 | 176 |
| 73 | 3300026075 | Ga0207708_10160233 | Ga0207708_101602332 | 176 |
| 74 | 3300026088 | Ga0207641_10026648 | Ga0207641_100266485 | 176 |
| 75 | 3300026089 | Ga0207648_10017152 | Ga0207648_100171523 | 176 |
| 76 | 3300026116 | Ga0207674_10048501 | Ga0207674_100485016 | 176 |
| 77 | 3300026121 | Ga0207683_10085484 | Ga0207683_100854844 | 176 |
| 78 | 3300028379 | Ga0268266_10122198 | Ga0268266_101221982 | 176 |
| 79 | 3300028380 | Ga0268265_10025509 | Ga0268265_100255096 | 176 |
| 80 | 3300028381 | Ga0268264_10070440 | Ga0268264_100704405 | 176 |
| 81 | 3300031548 | Ga0307408_100606754 | Ga0307408_1006067542 | 176 |
| 82 | 3300031824 | Ga0307413_10036708 | Ga0307413_100367081 | 176 |
| 83 | 3300032002 | Ga0307416_100165328 | Ga0307416_1001653282 | 176 |
| 84 | 3300032004 | Ga0307414_10277466 | Ga0307414_102774661 | 176 |
| 85 | 3300032126 | Ga0307415_100037822 | Ga0307415_1000378224 | 176 |
| 86 | 3300034819 | Ga0373958_0034278 | Ga0373958_0034278_430_975 | 176 |
| 87 | 3300035691 | Ga0373931_0219121 | Ga0373931_0219121_171_716 | 176 |
| 88 | 3300042126 | Ga0450888_032563 | Ga0450888_032563_13_558 | 176 |
| 89 | 3300042993 | Ga0439440_0034537 | Ga0439440_0034537_311_856 | 176 |
| 90 | 3300045051 | Ga0451576_0111304 | Ga0451576_0111304_2273_2818 | 176 |
| 91 | 3300046660 | Ga0495625_0183446 | Ga0495625_0183446_244_789 | 176 |
| 92 | 3300048907 | Ga0496104_0140401 | Ga0496104_0140401_1232_1777 | 176 |
| 93 | 3300048909 | Ga0496106_0047111 | Ga0496106_0047111_2240_2785 | 176 |
| 94 | 3300048913 | Ga0496110_0112707 | Ga0496110_0112707_810_1355 | 176 |
| 95 | 3300048914 | Ga0496111_0124432 | Ga0496111_0124432_699_1244 | 176 |
| 96 | 3300049520 | Ga0501297_019143 | Ga0501297_019143_75_620 | 176 |
| 97 | 3300050510 | nmdc:mga06r32_1456893_c1 | nmdc:mga06r32_1456893_c1_38_583 | 176 |
| 98 | 3300050510 | nmdc:mga06r32_410620_c1 | nmdc:mga06r32_410620_c1_41_586 | 176 |
| 99 | 3300053156 | Ga0500622_0002144 | Ga0500622_0002144_13047_13583 | 176 |
| 100 | 3300006844 | Ga0075428_100004599 | Ga0075428_10000459916 | 177 |
| 101 | 3300006846 | Ga0075430_100003571 | Ga0075430_1000035715 | 177 |
| 102 | 3300006847 | Ga0075431_100115456 | Ga0075431_1001154562 | 177 |
| 103 | 3300006880 | Ga0075429_100004004 | Ga0075429_10000400413 | 177 |
| 104 | 3300031901 | Ga0307406_10033435 | Ga0307406_100334354 | 177 |
| 105 | 3300047320 | Ga0495672_0134952 | Ga0495672_0134952_488_1048 | 178 |
| 106 | 3300009094 | Ga0111539_10139930 | Ga0111539_101399303 | 179 |
| 107 | 3300009147 | Ga0114129_10003320 | Ga0114129_1000332011 | 179 |
| 108 | 3300031548 | Ga0307408_100474905 | Ga0307408_1004749051 | 179 |
| 109 | 3300031995 | Ga0307409_101444317 | Ga0307409_1014443171 | 179 |
| 110 | 3300032005 | Ga0307411_10792977 | Ga0307411_107929772 | 179 |
| 111 | 3300049580 | Ga0501046_0153975 | Ga0501046_0153975_912_1481 | 179 |
| 112 | 3300050507 | nmdc:mga05p37_37913_c1 | nmdc:mga05p37_37913_c1_3184_3750 | 179 |
| 113 | 3300050508 | nmdc:mga09592_32024_c1 | nmdc:mga09592_32024_c1_2559_3125 | 179 |
| 114 | 3300050509 | nmdc:mga0qj67_22091_c1 | nmdc:mga0qj67_22091_c1_2302_2868 | 179 |
| 115 | 3300050510 | nmdc:mga06r32_1290_c1 | nmdc:mga06r32_1290_c1_19272_19838 | 179 |
| 116 | 3300053156 | Ga0500622_0007193 | Ga0500622_0007193_3419_3985 | 179 |
| 117 | 3300014968 | Ga0157379_10432862 | Ga0157379_104328622 | 180 |
| 118 | 3300046471 | Ga0495650_0011741 | Ga0495650_0011741_1004_1573 | 180 |
| 119 | 3300049571 | Ga0501034_0161459 | Ga0501034_0161459_850_1416 | 180 |
| 120 | 3300053124 | Ga0500617_029067 | Ga0500617_029067_1330_1905 | 180 |
| 121 | 3300053146 | Ga0500588_0003915 | Ga0500588_0003915_606_1181 | 180 |
| 122 | 3300031824 | Ga0307413_10119921 | Ga0307413_101199213 | 181 |
| 123 | 3300047472 | Ga0495686_0068866 | Ga0495686_0068866_1181_1759 | 181 |
| 124 | 3300053139 | Ga0500568_0075629 | Ga0500568_0075629_579_1154 | 181 |
| 125 | 3300053153 | Ga0500616_0203559 | Ga0500616_0203559_176_751 | 181 |
| 126 | 3300031824 | Ga0307413_10844183 | Ga0307413_108441831 | 182 |
| 127 | 3300046460 | Ga0495638_0226812 | Ga0495638_0226812_64_651 | 182 |
| 128 | 3300050509 | nmdc:mga0qj67_32398_c1 | nmdc:mga0qj67_32398_c1_2216_2797 | 182 |
| 129 | 3300006237 | Ga0097621_100117028 | Ga0097621_1001170282 | 186 |
| 130 | 3300037068 | Ga0373925_0284718 | Ga0373925_0284718_740_1315 | 186 |
| 131 | 3300044656 | Ga0466969_0006450 | Ga0466969_0006450_5260_5838 | 186 |
| 132 | 3300044684 | Ga0466966_0043011 | Ga0466966_0043011_1469_2047 | 186 |
| 133 | 3300005458 | Ga0070681_10020717 | Ga0070681_100207172 | 188 |
| 134 | 3300005535 | Ga0070684_100191908 | Ga0070684_1001919082 | 188 |
| 135 | 3300005548 | Ga0070665_100718760 | Ga0070665_1007187602 | 188 |
| 136 | 3300005937 | Ga0081455_10162484 | Ga0081455_101624842 | 188 |
| 137 | 3300006846 | Ga0075430_100224110 | Ga0075430_1002241102 | 188 |
| 138 | 3300009094 | Ga0111539_10053499 | Ga0111539_100534995 | 188 |
| 139 | 3300013307 | Ga0157372_10133548 | Ga0157372_101335482 | 188 |
| 140 | 3300025901 | Ga0207688_10320913 | Ga0207688_103209132 | 188 |
| 141 | 3300026118 | Ga0207675_100623444 | Ga0207675_1006234442 | 188 |
| 142 | 3300027907 | Ga0207428_10031564 | Ga0207428_100315644 | 188 |
| 143 | 3300028379 | Ga0268266_10758878 | Ga0268266_107588782 | 188 |
| 144 | 3300031456 | Ga0307513_10068953 | Ga0307513_100689536 | 188 |
| 145 | 3300032002 | Ga0307416_100915629 | Ga0307416_1009156291 | 188 |
| 146 | 3300042005 | Ga0439448_0120213 | Ga0439448_0120213_33_641 | 188 |
| 147 | 3300042439 | Ga0439464_0034504 | Ga0439464_0034504_733_1347 | 188 |
| 148 | 3300050511 | nmdc:mga08y16_6554_c1 | nmdc:mga08y16_6554_c1_10918_11532 | 188 |
| 149 | 3300005328 | Ga0070676_10070758 | Ga0070676_100707582 | 189 |
| 150 | 3300005331 | Ga0070670_100051719 | Ga0070670_1000517194 | 189 |
| 151 | 3300005336 | Ga0070680_100018473 | Ga0070680_1000184732 | 189 |
| 152 | 3300005347 | Ga0070668_100032662 | Ga0070668_1000326625 | 189 |
| 153 | 3300005353 | Ga0070669_100007716 | Ga0070669_1000077164 | 189 |
| 154 | 3300005546 | Ga0070696_100161689 | Ga0070696_1001616893 | 189 |
| 155 | 3300005577 | Ga0068857_100328600 | Ga0068857_1003286002 | 189 |
| 156 | 3300005719 | Ga0068861_100078218 | Ga0068861_1000782183 | 189 |
| 157 | 3300005844 | Ga0068862_100000964 | Ga0068862_10000096416 | 189 |
| 158 | 3300006844 | Ga0075428_100034146 | Ga0075428_1000341466 | 189 |
| 159 | 3300006846 | Ga0075430_100010773 | Ga0075430_1000107735 | 189 |
| 160 | 3300006847 | Ga0075431_100064187 | Ga0075431_1000641875 | 189 |
| 161 | 3300006847 | Ga0075431_100151389 | Ga0075431_1001513892 | 189 |
| 162 | 3300006880 | Ga0075429_100367433 | Ga0075429_1003674332 | 189 |
| 163 | 3300009094 | Ga0111539_10009119 | Ga0111539_100091197 | 189 |
| 164 | 3300009147 | Ga0114129_10199810 | Ga0114129_101998103 | 189 |
| 165 | 3300009148 | Ga0105243_10335975 | Ga0105243_103359752 | 189 |
| 166 | 3300009553 | Ga0105249_10019072 | Ga0105249_100190723 | 189 |
| 167 | 3300013306 | Ga0163162_10151572 | Ga0163162_101515724 | 189 |
| 168 | 3300025907 | Ga0207645_10080607 | Ga0207645_100806072 | 189 |
| 169 | 3300025933 | Ga0207706_10079481 | Ga0207706_100794812 | 189 |
| 170 | 3300025935 | Ga0207709_10057906 | Ga0207709_100579063 | 189 |
| 171 | 3300025938 | Ga0207704_11094631 | Ga0207704_110946311 | 189 |
| 172 | 3300025942 | Ga0207689_10290643 | Ga0207689_102906431 | 189 |
| 173 | 3300025961 | Ga0207712_10306154 | Ga0207712_103061542 | 189 |
| 174 | 3300025972 | Ga0207668_10016147 | Ga0207668_100161475 | 189 |
| 175 | 3300026116 | Ga0207674_10129843 | Ga0207674_101298432 | 189 |
| 176 | 3300026118 | Ga0207675_100048326 | Ga0207675_1000483265 | 189 |
| 177 | 3300027907 | Ga0207428_10081208 | Ga0207428_100812083 | 189 |
| 178 | 3300039437 | Ga0436365_0509966 | Ga0436365_0509966_2048_2620 | 189 |
| 179 | 3300039453 | Ga0436362_1178881 | Ga0436362_1178881_1120_1692 | 189 |
| 180 | 3300050508 | nmdc:mga09592_200742_c1 | nmdc:mga09592_200742_c1_1057_1683 | 189 |
| 181 | 3300050509 | nmdc:mga0qj67_14359_c1 | nmdc:mga0qj67_14359_c1_3099_3728 | 189 |
| 182 | 3300050509 | nmdc:mga0qj67_316727_c1 | nmdc:mga0qj67_316727_c1_153_785 | 189 |
| 183 | 3300050509 | nmdc:mga0qj67_49041_c1 | nmdc:mga0qj67_49041_c1_2310_2936 | 189 |
| 184 | 3300050509 | nmdc:mga0qj67_841683_c1 | nmdc:mga0qj67_841683_c1_64_690 | 189 |
| 185 | 3300050510 | nmdc:mga06r32_4764_c1 | nmdc:mga06r32_4764_c1_9096_9725 | 189 |
| 186 | 3300050511 | nmdc:mga08y16_350053_c1 | nmdc:mga08y16_350053_c1_412_1038 | 189 |
| 187 | 3300035113 | Ga0373936_0025191 | Ga0373936_0025191_272_844 | 190 |
| 188 | 3300053159 | Ga0500630_133595 | Ga0500630_133595_156_728 | 190 |
| 189 | 3300053178 | Ga0500637_0022394 | Ga0500637_0022394_2412_3008 | 190 |
| 190 | 3300006847 | Ga0075431_100001502 | Ga0075431_1000015027 | 191 |
| 191 | 3300006880 | Ga0075429_100012088 | Ga0075429_10001208811 | 191 |
| 192 | 3300009094 | Ga0111539_10008393 | Ga0111539_1000839313 | 191 |
| 193 | 3300009174 | Ga0105241_10133809 | Ga0105241_101338092 | 191 |
| 194 | 3300013306 | Ga0163162_10270258 | Ga0163162_102702582 | 191 |
| 195 | 3300014325 | Ga0163163_10600005 | Ga0163163_106000052 | 191 |
| 196 | 3300014969 | Ga0157376_10331552 | Ga0157376_103315522 | 191 |
| 197 | 3300026035 | Ga0207703_10655985 | Ga0207703_106559852 | 191 |
| 198 | 3300027907 | Ga0207428_10005862 | Ga0207428_100058622 | 191 |
| 199 | 3300031507 | Ga0307509_10000154 | Ga0307509_1000015474 | 191 |
| 200 | 3300039438 | Ga0436360_0732653 | Ga0436360_0732653_272_952 | 191 |
| 201 | 3300050507 | nmdc:mga05p37_51358_c1 | nmdc:mga05p37_51358_c1_244_873 | 191 |
| 202 | 3300050508 | nmdc:mga09592_7589_c1 | nmdc:mga09592_7589_c1_6820_7449 | 191 |
| 203 | 3300050510 | nmdc:mga06r32_336_c1 | nmdc:mga06r32_336_c1_21438_22067 | 191 |
| 204 | 3300050511 | nmdc:mga08y16_4878_c1 | nmdc:mga08y16_4878_c1_3591_4220 | 191 |
| 205 | 3300009093 | Ga0105240_10269937 | Ga0105240_102699372 | 192 |
| 206 | 3300045049 | Ga0466959_0394123 | Ga0466959_0394123_36_617 | 192 |
| 207 | 3300005434 | Ga0070709_10010637 | Ga0070709_100106373 | 193 |
| 208 | 3300005518 | Ga0070699_100052569 | Ga0070699_1000525692 | 193 |
| 209 | 3300005545 | Ga0070695_100027921 | Ga0070695_1000279213 | 193 |
| 210 | 3300006163 | Ga0070715_10063584 | Ga0070715_100635842 | 193 |
| 211 | 3300025906 | Ga0207699_10004337 | Ga0207699_100043372 | 193 |
| 212 | 3300039450 | Ga0436363_1490709 | Ga0436363_1490709_355_939 | 193 |
| 213 | 3300048905 | Ga0496102_0005754 | Ga0496102_0005754_7680_8282 | 193 |
| 214 | 3300048920 | Ga0496117_0076827 | Ga0496117_0076827_539_1141 | 193 |
| 215 | 3300025928 | Ga0207700_10471811 | Ga0207700_104718111 | 194 |
| 216 | 3300031239 | Ga0265328_10132286 | Ga0265328_101322862 | 194 |
| 217 | 3300039438 | Ga0436360_0584636 | Ga0436360_0584636_151_750 | 194 |
| 218 | 3300039450 | Ga0436363_1305614 | Ga0436363_1305614_6593_7204 | 194 |
| 219 | 3300046472 | Ga0495580_0461737 | Ga0495580_0461737_114_719 | 194 |
| 220 | 3300005330 | Ga0070690_100015419 | Ga0070690_1000154194 | 195 |
| 221 | 3300005334 | Ga0068869_100575855 | Ga0068869_1005758552 | 195 |
| 222 | 3300005338 | Ga0068868_100075978 | Ga0068868_1000759782 | 195 |
| 223 | 3300005355 | Ga0070671_100007614 | Ga0070671_1000076147 | 195 |
| 224 | 3300005367 | Ga0070667_100130789 | Ga0070667_1001307891 | 195 |
| 225 | 3300005434 | Ga0070709_10010051 | Ga0070709_100100515 | 195 |
| 226 | 3300005435 | Ga0070714_100063291 | Ga0070714_1000632912 | 195 |
| 227 | 3300005436 | Ga0070713_100004623 | Ga0070713_1000046234 | 195 |
| 228 | 3300005437 | Ga0070710_10003168 | Ga0070710_100031684 | 195 |
| 229 | 3300005439 | Ga0070711_100002611 | Ga0070711_1000026116 | 195 |
| 230 | 3300005456 | Ga0070678_100354927 | Ga0070678_1003549271 | 195 |
| 231 | 3300005459 | Ga0068867_100038622 | Ga0068867_1000386222 | 195 |
| 232 | 3300005544 | Ga0070686_100069512 | Ga0070686_1000695122 | 195 |
| 233 | 3300005614 | Ga0068856_100012687 | Ga0068856_1000126878 | 195 |
| 234 | 3300005841 | Ga0068863_100012172 | Ga0068863_1000121726 | 195 |
| 235 | 3300005842 | Ga0068858_100022020 | Ga0068858_1000220206 | 195 |
| 236 | 3300005843 | Ga0068860_100013007 | Ga0068860_1000130077 | 195 |
| 237 | 3300006173 | Ga0070716_100039090 | Ga0070716_1000390902 | 195 |
| 238 | 3300006175 | Ga0070712_100002067 | Ga0070712_10000206710 | 195 |
| 239 | 3300006237 | Ga0097621_100089156 | Ga0097621_1000891562 | 195 |
| 240 | 3300006358 | Ga0068871_100086254 | Ga0068871_1000862542 | 195 |
| 241 | 3300006881 | Ga0068865_100095333 | Ga0068865_1000953332 | 195 |
| 242 | 3300009098 | Ga0105245_10006627 | Ga0105245_1000662712 | 195 |
| 243 | 3300009101 | Ga0105247_10427191 | Ga0105247_104271911 | 195 |
| 244 | 3300009174 | Ga0105241_10011336 | Ga0105241_100113362 | 195 |
| 245 | 3300009176 | Ga0105242_10007452 | Ga0105242_100074527 | 195 |
| 246 | 3300009177 | Ga0105248_10037449 | Ga0105248_100374492 | 195 |
| 247 | 3300009545 | Ga0105237_10059289 | Ga0105237_100592894 | 195 |
| 248 | 3300010375 | Ga0105239_10025114 | Ga0105239_100251146 | 195 |
| 249 | 3300013296 | Ga0157374_10004235 | Ga0157374_100042356 | 195 |
| 250 | 3300013297 | Ga0157378_10018225 | Ga0157378_100182253 | 195 |
| 251 | 3300013306 | Ga0163162_10042988 | Ga0163162_100429884 | 195 |
| 252 | 3300014325 | Ga0163163_10098889 | Ga0163163_100988892 | 195 |
| 253 | 3300014968 | Ga0157379_10096304 | Ga0157379_100963042 | 195 |
| 254 | 3300014969 | Ga0157376_10297088 | Ga0157376_102970882 | 195 |
| 255 | 3300025898 | Ga0207692_10062106 | Ga0207692_100621062 | 195 |
| 256 | 3300025903 | Ga0207680_10019582 | Ga0207680_100195822 | 195 |
| 257 | 3300025905 | Ga0207685_10057621 | Ga0207685_100576211 | 195 |
| 258 | 3300025906 | Ga0207699_10019985 | Ga0207699_100199852 | 195 |
| 259 | 3300025914 | Ga0207671_10528168 | Ga0207671_105281682 | 195 |
| 260 | 3300025915 | Ga0207693_10003470 | Ga0207693_100034706 | 195 |
| 261 | 3300025916 | Ga0207663_10029268 | Ga0207663_100292682 | 195 |
| 262 | 3300025928 | Ga0207700_10010282 | Ga0207700_100102824 | 195 |
| 263 | 3300025929 | Ga0207664_10137571 | Ga0207664_101375712 | 195 |
| 264 | 3300025931 | Ga0207644_10040757 | Ga0207644_100407572 | 195 |
| 265 | 3300025938 | Ga0207704_10006319 | Ga0207704_100063192 | 195 |
| 266 | 3300025939 | Ga0207665_10103157 | Ga0207665_101031572 | 195 |
| 267 | 3300025941 | Ga0207711_10218530 | Ga0207711_102185302 | 195 |
| 268 | 3300025960 | Ga0207651_10539969 | Ga0207651_105399692 | 195 |
| 269 | 3300025986 | Ga0207658_10133104 | Ga0207658_101331042 | 195 |
| 270 | 3300026023 | Ga0207677_10172390 | Ga0207677_101723902 | 195 |
| 271 | 3300026035 | Ga0207703_10153953 | Ga0207703_101539532 | 195 |
| 272 | 3300026078 | Ga0207702_10168801 | Ga0207702_101688012 | 195 |
| 273 | 3300026088 | Ga0207641_10155847 | Ga0207641_101558472 | 195 |
| 274 | 3300026089 | Ga0207648_10054165 | Ga0207648_100541652 | 195 |
| 275 | 3300026095 | Ga0207676_10057171 | Ga0207676_100571713 | 195 |
| 276 | 3300026121 | Ga0207683_10005129 | Ga0207683_1000512913 | 195 |
| 277 | 3300028381 | Ga0268264_10087115 | Ga0268264_100871152 | 195 |
| 278 | 3300035116 | Ga0373945_0043753 | Ga0373945_0043753_658_1254 | 195 |
| 279 | 3300035119 | Ga0373956_0225224 | Ga0373956_0225224_116_712 | 195 |
| 280 | 3300035170 | Ga0373943_0027338 | Ga0373943_0027338_1801_2397 | 195 |
| 281 | 3300035171 | Ga0373946_0039609 | Ga0373946_0039609_864_1460 | 195 |
| 282 | 3300035172 | Ga0373955_0083623 | Ga0373955_0083623_738_1334 | 195 |
| 283 | 3300035695 | Ga0373927_0019863 | Ga0373927_0019863_3262_3858 | 195 |
| 284 | 3300035725 | Ga0373947_0096605 | Ga0373947_0096605_253_849 | 195 |
| 285 | 3300036401 | Ga0373937_0063084 | Ga0373937_0063084_2612_3208 | 195 |
| 286 | 3300037068 | Ga0373925_0119420 | Ga0373925_0119420_1216_1812 | 195 |
| 287 | 3300039437 | Ga0436365_1338189 | Ga0436365_1338189_101_691 | 195 |
| 288 | 3300046472 | Ga0495580_0003185 | Ga0495580_0003185_2065_2661 | 195 |
| 289 | 3300046472 | Ga0495580_0172968 | Ga0495580_0172968_283_879 | 195 |
| 290 | 3300046516 | Ga0495628_0057204 | Ga0495628_0057204_1121_1717 | 195 |
| 291 | 3300046517 | Ga0495630_0072304 | Ga0495630_0072304_551_1147 | 195 |
| 292 | 3300046535 | Ga0495586_0129488 | Ga0495586_0129488_391_987 | 195 |
| 293 | 3300046543 | Ga0495645_0181220 | Ga0495645_0181220_670_1266 | 195 |
| 294 | 3300046642 | Ga0495634_0293825 | Ga0495634_0293825_72_668 | 195 |
| 295 | 3300046681 | Ga0495647_0126272 | Ga0495647_0126272_99_695 | 195 |
| 296 | 3300046683 | Ga0495658_0079599 | Ga0495658_0079599_845_1441 | 195 |
| 297 | 3300046690 | Ga0495624_0305940 | Ga0495624_0305940_64_660 | 195 |
| 298 | 3300047319 | Ga0495674_0105299 | Ga0495674_0105299_673_1269 | 195 |
| 299 | 3300047322 | Ga0495680_0338544 | Ga0495680_0338544_215_811 | 195 |
| 300 | 3300048903 | Ga0496100_0062048 | Ga0496100_0062048_492_1088 | 195 |
| 301 | 3300048904 | Ga0496101_0016954 | Ga0496101_0016954_3632_4228 | 195 |
| 302 | 3300048905 | Ga0496102_0009171 | Ga0496102_0009171_5746_6342 | 195 |
| 303 | 3300048906 | Ga0496103_0052221 | Ga0496103_0052221_415_1011 | 195 |
| 304 | 3300048907 | Ga0496104_0153842 | Ga0496104_0153842_496_1092 | 195 |
| 305 | 3300048908 | Ga0496105_0148357 | Ga0496105_0148357_374_970 | 195 |
| 306 | 3300048909 | Ga0496106_0007946 | Ga0496106_0007946_3053_3649 | 195 |
| 307 | 3300048910 | Ga0496107_0079291 | Ga0496107_0079291_1008_1604 | 195 |
| 308 | 3300048911 | Ga0496108_0008197 | Ga0496108_0008197_986_1582 | 195 |
| 309 | 3300048912 | Ga0496109_0029076 | Ga0496109_0029076_2004_2600 | 195 |
| 310 | 3300048913 | Ga0496110_0107308 | Ga0496110_0107308_1721_2317 | 195 |
| 311 | 3300048914 | Ga0496111_0000810 | Ga0496111_0000810_2518_3114 | 195 |
| 312 | 3300048915 | Ga0496112_0033730 | Ga0496112_0033730_922_1518 | 195 |
| 313 | 3300048916 | Ga0496113_0076939 | Ga0496113_0076939_891_1487 | 195 |
| 314 | 3300048917 | Ga0496114_0147574 | Ga0496114_0147574_1053_1649 | 195 |
| 315 | 3300048918 | Ga0496115_0037648 | Ga0496115_0037648_3128_3724 | 195 |
| 316 | 3300053085 | Ga0495619_0389184 | Ga0495619_0389184_199_795 | 195 |
| 317 | 3300009545 | Ga0105237_10071121 | Ga0105237_100711213 | 196 |
| 318 | 3300053178 | Ga0500637_0059240 | Ga0500637_0059240_281_883 | 196 |
| 319 | 3300021361 | Ga0213872_10111046 | Ga0213872_101110462 | 197 |
| 320 | 3300039447 | Ga0436361_1047185 | Ga0436361_1047185_879_1553 | 197 |
| 321 | 3300045836 | Ga0466958_0028366 | Ga0466958_0028366_1632_2345 | 197 |
| 322 | 3300007265 | Ga0099794_10029540 | Ga0099794_100295402 | 198 |
| 323 | 3300007788 | Ga0099795_10038906 | Ga0099795_100389062 | 198 |
| 324 | 3300044656 | Ga0466969_0000684 | Ga0466969_0000684_36_749 | 198 |
| 325 | 3300044684 | Ga0466966_0001828 | Ga0466966_0001828_10292_11005 | 198 |
| 326 | 3300044693 | Ga0466961_0000614 | Ga0466961_0000614_18735_19448 | 198 |
| 327 | 3300044706 | Ga0466964_0000095 | Ga0466964_0000095_13063_13776 | 198 |
| 328 | 3300044719 | Ga0466971_0003951 | Ga0466971_0003951_1471_2184 | 198 |
| 329 | 3300044765 | Ga0466970_0020292 | Ga0466970_0020292_369_1082 | 198 |
| 330 | 3300061719 | Ga0466962_0000111 | Ga0466962_0000111_28224_28937 | 198 |
| 331 | 3300005329 | Ga0070683_100003293 | Ga0070683_1000032937 | 199 |
| 332 | 3300005458 | Ga0070681_10206642 | Ga0070681_102066422 | 199 |
| 333 | 3300005563 | Ga0068855_100000430 | Ga0068855_10000043033 | 199 |
| 334 | 3300009093 | Ga0105240_10021690 | Ga0105240_100216904 | 199 |
| 335 | 3300009545 | Ga0105237_10007569 | Ga0105237_100075694 | 199 |
| 336 | 3300025912 | Ga0207707_10265105 | Ga0207707_102651052 | 199 |
| 337 | 3300025913 | Ga0207695_10012860 | Ga0207695_100128607 | 199 |
| 338 | 3300025944 | Ga0207661_10095298 | Ga0207661_100952982 | 199 |
| 339 | 3300044765 | Ga0466970_0401912 | Ga0466970_0401912_34_666 | 199 |
| 340 | 3300045049 | Ga0466959_0007718 | Ga0466959_0007718_2222_2854 | 199 |
| 341 | 3300045836 | Ga0466958_0398262 | Ga0466958_0398262_45_677 | 199 |
| 342 | 3300046681 | Ga0495647_0042515 | Ga0495647_0042515_737_1426 | 199 |
| 343 | 3300046683 | Ga0495658_0008333 | Ga0495658_0008333_414_1103 | 199 |
| 344 | 3300031903 | Ga0307407_10356036 | Ga0307407_103560362 | 200 |
| 345 | 3300031995 | Ga0307409_101145149 | Ga0307409_1011451492 | 200 |
| 346 | 3300039453 | Ga0436362_1277379 | Ga0436362_1277379_194_817 | 200 |
| 347 | 3300005530 | Ga0070679_100001720 | Ga0070679_1000017206 | 202 |
| 348 | 3300005530 | Ga0070679_100252584 | Ga0070679_1002525842 | 202 |
| 349 | 3300025912 | Ga0207707_10187897 | Ga0207707_101878972 | 202 |
| 350 | 3300031995 | Ga0307409_100039376 | Ga0307409_1000393765 | 202 |
| 351 | 3300041453 | Ga0451797_1206887 | Ga0451797_1206887_36_671 | 203 |
| 352 | 3300005563 | Ga0068855_100044104 | Ga0068855_1000441042 | 204 |
| 353 | 3300009093 | Ga0105240_10040582 | Ga0105240_100405822 | 204 |
| 354 | 3300009545 | Ga0105237_10586216 | Ga0105237_105862162 | 204 |
| 355 | 3300009551 | Ga0105238_10416397 | Ga0105238_104163972 | 204 |
| 356 | 3300009551 | Ga0105238_10421831 | Ga0105238_104218312 | 204 |
| 357 | 3300013105 | Ga0157369_10063138 | Ga0157369_100631382 | 204 |
| 358 | 3300025912 | Ga0207707_10035001 | Ga0207707_100350013 | 204 |
| 359 | 3300025913 | Ga0207695_10017655 | Ga0207695_100176553 | 204 |
| 360 | 3300025914 | Ga0207671_10390523 | Ga0207671_103905232 | 204 |
| 361 | 3300025917 | Ga0207660_10010562 | Ga0207660_100105625 | 204 |
| 362 | 3300025924 | Ga0207694_10095602 | Ga0207694_100956022 | 204 |
| 363 | 3300025924 | Ga0207694_10374751 | Ga0207694_103747512 | 204 |
| 364 | 3300025949 | Ga0207667_10103672 | Ga0207667_101036722 | 204 |
| 365 | 3300026078 | Ga0207702_10631137 | Ga0207702_106311371 | 204 |
| 366 | 3300031247 | Ga0265340_10043220 | Ga0265340_100432202 | 204 |
| 367 | 3300044656 | Ga0466969_0013465 | Ga0466969_0013465_15_653 | 204 |
| 368 | 3300044683 | Ga0466965_0072025 | Ga0466965_0072025_1087_1707 | 204 |
| 369 | 3300005436 | Ga0070713_100192289 | Ga0070713_1001922892 | 205 |
| 370 | 3300005530 | Ga0070679_100645925 | Ga0070679_1006459251 | 205 |
| 371 | 3300005548 | Ga0070665_100001206 | Ga0070665_10000120615 | 205 |
| 372 | 3300005842 | Ga0068858_100371314 | Ga0068858_1003713142 | 205 |
| 373 | 3300009093 | Ga0105240_10132598 | Ga0105240_101325982 | 205 |
| 374 | 3300009093 | Ga0105240_10155844 | Ga0105240_101558442 | 205 |
| 375 | 3300014325 | Ga0163163_10170415 | Ga0163163_101704152 | 205 |
| 376 | 3300025913 | Ga0207695_10125113 | Ga0207695_101251132 | 205 |
| 377 | 3300025928 | Ga0207700_10049162 | Ga0207700_100491623 | 205 |
| 378 | 3300028379 | Ga0268266_10000938 | Ga0268266_1000093817 | 205 |
| 379 | 3300028573 | Ga0265334_10008041 | Ga0265334_100080413 | 205 |
| 380 | 3300048929 | Ga0496126_0001774 | Ga0496126_0001774_13117_13755 | 205 |
| 381 | 3300025913 | Ga0207695_10110248 | Ga0207695_101102482 | 206 |
| 382 | 3300028800 | Ga0265338_10343473 | Ga0265338_103434731 | 206 |
| 383 | 3300031595 | Ga0265313_10026139 | Ga0265313_100261392 | 206 |
| 384 | 3300031616 | Ga0307508_10245082 | Ga0307508_102450822 | 206 |
| 385 | 3300009093 | Ga0105240_10028854 | Ga0105240_100288544 | 207 |
| 386 | 3300010375 | Ga0105239_10259052 | Ga0105239_102590522 | 207 |
| 387 | 3300025913 | Ga0207695_10161072 | Ga0207695_101610722 | 207 |
| 388 | 3300046472 | Ga0495580_0520504 | Ga0495580_0520504_33_722 | 207 |
| 389 | 3300046475 | Ga0495639_0023259 | Ga0495639_0023259_1244_1933 | 207 |
| 390 | 3300005439 | Ga0070711_100257644 | Ga0070711_1002576442 | 208 |
| 391 | 3300006163 | Ga0070715_10061214 | Ga0070715_100612142 | 208 |
| 392 | 3300006173 | Ga0070716_100011523 | Ga0070716_1000115233 | 208 |
| 393 | 3300006175 | Ga0070712_100032697 | Ga0070712_1000326972 | 208 |
| 394 | 3300021377 | Ga0213874_10053720 | Ga0213874_100537202 | 208 |
| 395 | 3300021377 | Ga0213874_10069458 | Ga0213874_100694582 | 208 |
| 396 | 3300025916 | Ga0207663_10071005 | Ga0207663_100710052 | 208 |
| 397 | 3300025931 | Ga0207644_10602885 | Ga0207644_106028852 | 208 |
| 398 | 3300031247 | Ga0265340_10035104 | Ga0265340_100351042 | 208 |
| 399 | 3300039437 | Ga0436365_0981884 | Ga0436365_0981884_1478_2131 | 208 |
| 400 | 3300039450 | Ga0436363_1033365 | Ga0436363_1033365_787_1440 | 208 |
| 401 | 3300048907 | Ga0496104_0345594 | Ga0496104_0345594_67_735 | 208 |
| 402 | 3300048909 | Ga0496106_0449786 | Ga0496106_0449786_118_786 | 208 |
| 403 | 3300005367 | Ga0070667_100336653 | Ga0070667_1003366532 | 209 |
| 404 | 3300005548 | Ga0070665_100249416 | Ga0070665_1002494162 | 209 |
| 405 | 3300005842 | Ga0068858_100304891 | Ga0068858_1003048912 | 209 |
| 406 | 3300009545 | Ga0105237_10331235 | Ga0105237_103312352 | 209 |
| 407 | 3300014968 | Ga0157379_10018255 | Ga0157379_100182556 | 209 |
| 408 | 3300021441 | Ga0213871_10062904 | Ga0213871_100629042 | 209 |
| 409 | 3300025914 | Ga0207671_10135856 | Ga0207671_101358562 | 209 |
| 410 | 3300025949 | Ga0207667_10001582 | Ga0207667_1000158212 | 209 |
| 411 | 3300028379 | Ga0268266_10196693 | Ga0268266_101966932 | 209 |
| 412 | 3300031247 | Ga0265340_10193320 | Ga0265340_101933202 | 209 |
| 413 | 3300039438 | Ga0436360_0578160 | Ga0436360_0578160_6410_7087 | 209 |
| 414 | 3300047443 | Ga0495687_118435 | Ga0495687_118435_168_797 | 209 |
| 415 | 3300005530 | Ga0070679_100197625 | Ga0070679_1001976251 | 210 |
| 416 | 3300025921 | Ga0207652_10018298 | Ga0207652_100182984 | 210 |
| 417 | 3300039453 | Ga0436362_0021549 | Ga0436362_0021549_265_939 | 210 |
| 418 | 3300049583 | Ga0501067_0147069 | Ga0501067_0147069_618_1268 | 211 |
| 419 | 3300050514 | nmdc:mga08x19_181679_c1 | nmdc:mga08x19_181679_c1_208_885 | 211 |
| 420 | 3300005344 | Ga0070661_100240481 | Ga0070661_1002404812 | 213 |
| 421 | 3300005434 | Ga0070709_10006956 | Ga0070709_100069562 | 213 |
| 422 | 3300005435 | Ga0070714_100007187 | Ga0070714_1000071876 | 213 |
| 423 | 3300005436 | Ga0070713_100101260 | Ga0070713_1001012602 | 213 |
| 424 | 3300005455 | Ga0070663_100500728 | Ga0070663_1005007281 | 213 |
| 425 | 3300005548 | Ga0070665_100035528 | Ga0070665_1000355285 | 213 |
| 426 | 3300005614 | Ga0068856_100208500 | Ga0068856_1002085002 | 213 |
| 427 | 3300005844 | Ga0068862_100087841 | Ga0068862_1000878412 | 213 |
| 428 | 3300006028 | Ga0070717_10198236 | Ga0070717_101982362 | 213 |
| 429 | 3300009093 | Ga0105240_10031390 | Ga0105240_100313908 | 213 |
| 430 | 3300009551 | Ga0105238_10417492 | Ga0105238_104174922 | 213 |
| 431 | 3300009553 | Ga0105249_10010397 | Ga0105249_100103977 | 213 |
| 432 | 3300025916 | Ga0207663_10268686 | Ga0207663_102686862 | 213 |
| 433 | 3300025928 | Ga0207700_10330715 | Ga0207700_103307152 | 213 |
| 434 | 3300025929 | Ga0207664_10052313 | Ga0207664_100523132 | 213 |
| 435 | 3300025961 | Ga0207712_10092926 | Ga0207712_100929262 | 213 |
| 436 | 3300028379 | Ga0268266_10002660 | Ga0268266_100026602 | 213 |
| 437 | 3300028380 | Ga0268265_10008201 | Ga0268265_100082012 | 213 |
| 438 | 3300048904 | Ga0496101_0614928 | Ga0496101_0614928_13_684 | 213 |
| 439 | 3300048907 | Ga0496104_0034341 | Ga0496104_0034341_202_873 | 213 |
| 440 | 3300048909 | Ga0496106_0715968 | Ga0496106_0715968_33_725 | 213 |
| 441 | 3300048929 | Ga0496126_0585245 | Ga0496126_0585245_18_692 | 213 |
| 442 | 3300005335 | Ga0070666_10009264 | Ga0070666_100092643 | 214 |
| 443 | 3300005355 | Ga0070671_100000556 | Ga0070671_10000055616 | 214 |
| 444 | 3300005367 | Ga0070667_100045902 | Ga0070667_1000459022 | 214 |
| 445 | 3300005544 | Ga0070686_100042370 | Ga0070686_1000423702 | 214 |
| 446 | 3300005548 | Ga0070665_100057979 | Ga0070665_1000579794 | 214 |
| 447 | 3300005617 | Ga0068859_100000406 | Ga0068859_10000040637 | 214 |
| 448 | 3300005719 | Ga0068861_100043462 | Ga0068861_1000434623 | 214 |
| 449 | 3300005841 | Ga0068863_100013032 | Ga0068863_1000130322 | 214 |
| 450 | 3300005842 | Ga0068858_100000330 | Ga0068858_1000003307 | 214 |
| 451 | 3300005843 | Ga0068860_100041273 | Ga0068860_1000412732 | 214 |
| 452 | 3300006931 | Ga0097620_100000406 | Ga0097620_1000004062 | 214 |
| 453 | 3300009092 | Ga0105250_10021891 | Ga0105250_100218913 | 214 |
| 454 | 3300009101 | Ga0105247_10000121 | Ga0105247_1000012159 | 214 |
| 455 | 3300009177 | Ga0105248_10015452 | Ga0105248_100154522 | 214 |
| 456 | 3300009553 | Ga0105249_10005346 | Ga0105249_100053466 | 214 |
| 457 | 3300013306 | Ga0163162_10559184 | Ga0163162_105591842 | 214 |
| 458 | 3300014968 | Ga0157379_10018378 | Ga0157379_100183784 | 214 |
| 459 | 3300025900 | Ga0207710_10000156 | Ga0207710_100001567 | 214 |
| 460 | 3300025903 | Ga0207680_10105811 | Ga0207680_101058112 | 214 |
| 461 | 3300025931 | Ga0207644_10001074 | Ga0207644_100010747 | 214 |
| 462 | 3300025941 | Ga0207711_10020470 | Ga0207711_100204702 | 214 |
| 463 | 3300025986 | Ga0207658_10004873 | Ga0207658_100048736 | 214 |
| 464 | 3300026035 | Ga0207703_10000934 | Ga0207703_100009346 | 214 |
| 465 | 3300026035 | Ga0207703_10497357 | Ga0207703_104973572 | 214 |
| 466 | 3300026088 | Ga0207641_10150471 | Ga0207641_101504712 | 214 |
| 467 | 3300026118 | Ga0207675_100115965 | Ga0207675_1001159652 | 214 |
| 468 | 3300028379 | Ga0268266_10134031 | Ga0268266_101340312 | 214 |
| 469 | 3300035113 | Ga0373936_0076094 | Ga0373936_0076094_681_1325 | 214 |
| 470 | 3300048905 | Ga0496102_0019614 | Ga0496102_0019614_3757_4401 | 214 |
| 471 | 3300048909 | Ga0496106_0391070 | Ga0496106_0391070_196_840 | 214 |
| 472 | 3300048911 | Ga0496108_0067260 | Ga0496108_0067260_1037_1681 | 214 |
| 473 | 3300048915 | Ga0496112_0020539 | Ga0496112_0020539_2914_3558 | 214 |
| 474 | 3300048924 | Ga0496121_0000547 | Ga0496121_0000547_3637_4281 | 214 |
| 475 | 3300048928 | Ga0496125_0002321 | Ga0496125_0002321_6492_7136 | 214 |
| 476 | 3300003320 | rootH2_10085634 | rootH2_100856342 | 215 |
| 477 | 3300003322 | rootL2_10184575 | rootL2_101845752 | 215 |
| 478 | 3300003323 | rootH1_10176202 | rootH1_101762022 | 215 |
| 479 | 3300005355 | Ga0070671_100156719 | Ga0070671_1001567192 | 215 |
| 480 | 3300005367 | Ga0070667_100056977 | Ga0070667_1000569772 | 215 |
| 481 | 3300005455 | Ga0070663_100098183 | Ga0070663_1000981831 | 215 |
| 482 | 3300005457 | Ga0070662_100559275 | Ga0070662_1005592752 | 215 |
| 483 | 3300005458 | Ga0070681_10444084 | Ga0070681_104440842 | 215 |
| 484 | 3300005548 | Ga0070665_100186702 | Ga0070665_1001867022 | 215 |
| 485 | 3300005564 | Ga0070664_101121887 | Ga0070664_1011218871 | 215 |
| 486 | 3300005614 | Ga0068856_100188281 | Ga0068856_1001882812 | 215 |
| 487 | 3300005616 | Ga0068852_100469505 | Ga0068852_1004695052 | 215 |
| 488 | 3300005617 | Ga0068859_100018574 | Ga0068859_1000185748 | 215 |
| 489 | 3300005843 | Ga0068860_100006077 | Ga0068860_10000607712 | 215 |
| 490 | 3300006358 | Ga0068871_100353334 | Ga0068871_1003533342 | 215 |
| 491 | 3300006931 | Ga0097620_100018574 | Ga0097620_1000185742 | 215 |
| 492 | 3300009101 | Ga0105247_10017369 | Ga0105247_100173692 | 215 |
| 493 | 3300009177 | Ga0105248_10104018 | Ga0105248_101040182 | 215 |
| 494 | 3300009553 | Ga0105249_10190707 | Ga0105249_101907072 | 215 |
| 495 | 3300011119 | Ga0105246_10030856 | Ga0105246_100308564 | 215 |
| 496 | 3300013296 | Ga0157374_10113725 | Ga0157374_101137252 | 215 |
| 497 | 3300013307 | Ga0157372_10210981 | Ga0157372_102109812 | 215 |
| 498 | 3300013308 | Ga0157375_10156116 | Ga0157375_101561161 | 215 |
| 499 | 3300014325 | Ga0163163_10095289 | Ga0163163_100952892 | 215 |
| 500 | 3300025900 | Ga0207710_10013173 | Ga0207710_100131732 | 215 |
| 501 | 3300025903 | Ga0207680_10037509 | Ga0207680_100375092 | 215 |
| 502 | 3300025911 | Ga0207654_10612632 | Ga0207654_106126321 | 215 |
| 503 | 3300025961 | Ga0207712_10339821 | Ga0207712_103398212 | 215 |
| 504 | 3300026035 | Ga0207703_10000366 | Ga0207703_100003662 | 215 |
| 505 | 3300026067 | Ga0207678_10158512 | Ga0207678_101585122 | 215 |
| 506 | 3300026088 | Ga0207641_10000196 | Ga0207641_1000019621 | 215 |
| 507 | 3300026095 | Ga0207676_10150039 | Ga0207676_101500392 | 215 |
| 508 | 3300028379 | Ga0268266_10081289 | Ga0268266_100812892 | 215 |
| 509 | 3300028381 | Ga0268264_10000182 | Ga0268264_10000182118 | 215 |
| 510 | 3300030521 | Ga0307511_10000008 | Ga0307511_1000000816 | 215 |
| 511 | 3300031507 | Ga0307509_10000162 | Ga0307509_1000016257 | 215 |
| 512 | 3300031616 | Ga0307508_10302614 | Ga0307508_103026142 | 215 |
| 513 | 3300033180 | Ga0307510_10000003 | Ga0307510_1000000318 | 215 |
| 514 | 3300033180 | Ga0307510_10000959 | Ga0307510_1000095923 | 215 |
| 515 | 3300046507 | Ga0495606_0078058 | Ga0495606_0078058_210_905 | 215 |
| 516 | 3300046507 | Ga0495606_0134806 | Ga0495606_0134806_19_729 | 215 |
| 517 | 3300046519 | Ga0495632_0030263 | Ga0495632_0030263_1265_1936 | 215 |
| 518 | 3300047443 | Ga0495687_056788 | Ga0495687_056788_863_1534 | 215 |
| 519 | 3300048905 | Ga0496102_0135186 | Ga0496102_0135186_1473_2183 | 215 |
| 520 | 3300048912 | Ga0496109_0495577 | Ga0496109_0495577_223_894 | 215 |
| 521 | 3300048919 | Ga0496116_0273968 | Ga0496116_0273968_90_800 | 215 |
| 522 | 3300048920 | Ga0496117_0000095 | Ga0496117_0000095_61520_62230 | 215 |
| 523 | 3300048921 | Ga0496118_0000003 | Ga0496118_0000003_21997_22707 | 215 |
| 524 | 3300048921 | Ga0496118_0081800 | Ga0496118_0081800_392_1063 | 215 |
| 525 | 3300048922 | Ga0496119_0003983 | Ga0496119_0003983_4974_5693 | 215 |
| 526 | 3300048922 | Ga0496119_0012799 | Ga0496119_0012799_5034_5744 | 215 |
| 527 | 3300048923 | Ga0496120_0000842 | Ga0496120_0000842_16103_16822 | 215 |
| 528 | 3300048924 | Ga0496121_0251154 | Ga0496121_0251154_133_843 | 215 |
| 529 | 3300048928 | Ga0496125_0000112 | Ga0496125_0000112_121442_122113 | 215 |
| 530 | 3300048928 | Ga0496125_0006226 | Ga0496125_0006226_2566_3276 | 215 |
| 531 | 3300053123 | Ga0500614_123138 | Ga0500614_123138_70_741 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o1j-assembly1.cif.gz_A | lytic transglycosylase in action | 0.6449 | 71 | 210 |
| 3w6e-assembly3.cif.gz_C | crystal structure of catalytic domain of chitinase from ralstonia sp. a-471 (e162q) | 0.6252 | 74 | 200 |
| 6h5f-assembly1.cif.gz_A | ltga disordered helix | 0.6106 | 71 | 207 |
| 4j31-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-396prot) | 0.6039 | 150 | 197 |
| 4j36-assembly1.cif.gz_A | cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) | 0.5777 | 149 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1slyA03 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.7067 | 86 | 210 | 1.10.530.10 |
| 1slyA03 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.5286 | 86 | 210 | 1.10.530.10 |
| af_P0AEZ7_97_250_1.10.530.10 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.5216 | 84 | 210 | 1.10.530.10 |
| 3fi7A01 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.4535 | 58 | 204 | 1.10.530.10 |
| 3fi7A01 | Mainly Alpha;Orthogonal Bundle;Lysozyme; | 0.4452 | 58 | 204 | 1.10.530.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4MDE8-F1-model_v4 | Transglycosylase SLT domain-containing protein | 0.9158 | 37 | 199 |
|
| AF-A0A534B9S3-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.9011 | 37 | 207 |
|
| AF-A0A829YMD2-F1-model_v4 | Transglycosylase SLT domain-containing protein | 0.8751 | 26 | 198 |
|
| AF-A0A534HEK6-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.8691 | 67 | 208 |
|
| AF-A0A7V1D5D2-F1-model_v4 | Lytic transglycosylase domain-containing protein | 0.8667 | 57 | 197 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar