F460131

General Info

Members Datasets Scaffolds Average Seq Length
531 281 531 203

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10210981|Ga0157372_102109812
Length 235
Sequence MHSTSSARAWLLDSVRTGLCRLRGPVRPLGLIVAGALLSSAAAAQGQRDPELKEVVQRAISQAECFTDHYDSAVWYTLMEPRLRKIVKEHDERMEILKQVYCETHRSGETRLPPGLVMAVMDIESRFNRWAVSSAGAVGLMQVMPFWPEKLGIKRYELIHTGPNIHMGCAILRFYLRYERNDVRKALARYNGSVGQRGYPDMVISRWTRWNGADDLGFPSATPRKPSRPPAASAR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
260 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
273 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
280 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
281 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 6.21
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10085634 3300003320 Unclassified 2628
2 rootL2_10184575 3300003322 Bacteria 2697
3 rootH1_10176202 3300003323 Bacteria 4834
4 Ga0065715_10536340 3300005293 Bacteria 751
5 Ga0070676_10070758 3300005328 Bacteria 2094
6 Ga0070683_100003293 3300005329 Bacteria 13051
7 Ga0070683_100202970 3300005329 Bacteria 1883
8 Ga0070690_100005087 3300005330 Bacteria 7369
9 Ga0070690_100015419 3300005330 Bacteria 4557
10 Ga0070670_100051719 3300005331 Bacteria 3528
11 Ga0068869_100297601 3300005334 Bacteria 1302
12 Ga0068869_100575855 3300005334 Bacteria 949
13 Ga0070666_10009264 3300005335 Bacteria 6137
14 Ga0070666_10025349 3300005335 Bacteria 3865
15 Ga0070680_100018473 3300005336 Bacteria 5508
16 Ga0068868_100075978 3300005338 Bacteria 2685
17 Ga0068868_100161301 3300005338 Bacteria 1852
18 Ga0070689_100004646 3300005340 Bacteria 9302
19 Ga0070661_100048418 3300005344 Bacteria 3111
20 Ga0070661_100240481 3300005344 Bacteria 1394
21 Ga0070668_100032662 3300005347 Bacteria 3961
22 Ga0070668_100277099 3300005347 Bacteria 1400
23 Ga0070669_100007716 3300005353 Bacteria 7691
24 Ga0070675_100001313 3300005354 Bacteria 18153
25 Ga0070671_100000556 3300005355 Bacteria 26454
26 Ga0070671_100007614 3300005355 Bacteria 8661
27 Ga0070671_100156719 3300005355 Bacteria 1924
28 Ga0070673_100003052 3300005364 Bacteria 10362
29 Ga0070688_100001473 3300005365 Bacteria 11696
30 Ga0070659_100595272 3300005366 Bacteria 950
31 Ga0070667_100017869 3300005367 Bacteria 5878
32 Ga0070667_100045902 3300005367 Bacteria 3675
33 Ga0070667_100056977 3300005367 Bacteria 3301
34 Ga0070667_100130789 3300005367 Bacteria 2190
35 Ga0070667_100336653 3300005367 Bacteria 1364
36 Ga0070709_10006956 3300005434 Bacteria 6175
37 Ga0070709_10010051 3300005434 Bacteria 5231
38 Ga0070709_10010637 3300005434 Bacteria 5102
39 Ga0070714_100007187 3300005435 Bacteria 8642
40 Ga0070714_100063291 3300005435 Bacteria 3181
41 Ga0070713_100004623 3300005436 Bacteria 9282
42 Ga0070713_100101260 3300005436 Bacteria 2495
43 Ga0070713_100192289 3300005436 Bacteria 1839
44 Ga0070710_10003168 3300005437 Bacteria 7797
45 Ga0070701_10021666 3300005438 Bacteria 3071
46 Ga0070711_100002611 3300005439 Bacteria 10316
47 Ga0070711_100257644 3300005439 Bacteria 1371
48 Ga0070705_100051614 3300005440 Bacteria 2399
49 Ga0070700_100025522 3300005441 Bacteria 3480
50 Ga0070694_100680856 3300005444 Bacteria 835
51 Ga0070663_100098183 3300005455 Bacteria 2181
52 Ga0070663_100500728 3300005455 Bacteria 1009
53 Ga0070678_100092629 3300005456 Bacteria 2322
54 Ga0070678_100354927 3300005456 Bacteria 1262
55 Ga0070662_100066377 3300005457 Bacteria 2647
56 Ga0070662_100559275 3300005457 Bacteria 959
57 Ga0070681_10020717 3300005458 Bacteria 6587
58 Ga0070681_10206642 3300005458 Bacteria 1881
59 Ga0070681_10444084 3300005458 Bacteria 1209
60 Ga0068867_100014153 3300005459 Bacteria 5651
61 Ga0068867_100038622 3300005459 Bacteria 3476
62 Ga0070685_10092761 3300005466 Bacteria 1830
63 Ga0070699_100052569 3300005518 Bacteria 3525
64 Ga0070679_100001720 3300005530 Bacteria 19738
65 Ga0070679_100197625 3300005530 Bacteria 1978
66 Ga0070679_100252584 3300005530 Bacteria 1719
67 Ga0070679_100645925 3300005530 Unclassified 1001
68 Ga0070684_100191908 3300005535 Bacteria 1859
69 Ga0068853_100282550 3300005539 Bacteria 1530
70 Ga0070672_100013830 3300005543 Bacteria 5707
71 Ga0070686_100001603 3300005544 Bacteria 12722
72 Ga0070686_100042370 3300005544 Bacteria 2851
73 Ga0070686_100069512 3300005544 Bacteria 2300
74 Ga0070695_100027921 3300005545 Bacteria 3499
75 Ga0070696_100161689 3300005546 Bacteria 1650
76 Ga0070665_100001206 3300005548 Bacteria 31498
77 Ga0070665_100030247 3300005548 Bacteria 5450
78 Ga0070665_100035528 3300005548 Bacteria 5012
79 Ga0070665_100057979 3300005548 Bacteria 3882
80 Ga0070665_100186702 3300005548 Bacteria 2074
81 Ga0070665_100249416 3300005548 Bacteria 1776
82 Ga0070665_100718760 3300005548 Bacteria 1012
83 Ga0068855_100000430 3300005563 Bacteria 51996
84 Ga0068855_100044104 3300005563 Bacteria 5279
85 Ga0070664_100006418 3300005564 Bacteria 9488
86 Ga0070664_101121887 3300005564 Bacteria 741
87 Ga0068857_100083909 3300005577 Bacteria 2847
88 Ga0068857_100328600 3300005577 Bacteria 1413
89 Ga0068854_100054600 3300005578 Bacteria 2874
90 Ga0068856_100012687 3300005614 Bacteria 8158
91 Ga0068856_100188281 3300005614 Bacteria 2077
92 Ga0068856_100208500 3300005614 Bacteria 1969
93 Ga0070702_100026125 3300005615 Bacteria 3134
94 Ga0068852_100469505 3300005616 Bacteria 1249
95 Ga0068859_100000406 3300005617 Bacteria 42822
96 Ga0068859_100018574 3300005617 Bacteria 6989
97 Ga0068859_100034061 3300005617 Bacteria 5113
98 Ga0068864_100005920 3300005618 Bacteria 10023
99 Ga0068866_10028329 3300005718 Bacteria 2668
100 Ga0068861_100028504 3300005719 Bacteria 4074
101 Ga0068861_100043462 3300005719 Bacteria 3373
102 Ga0068861_100078218 3300005719 Bacteria 2582
103 Ga0068851_10327548 3300005834 Bacteria 886
104 Ga0068863_100006160 3300005841 Bacteria 11763
105 Ga0068863_100012172 3300005841 Bacteria 8308
106 Ga0068863_100013032 3300005841 Bacteria 8017
107 Ga0068858_100000330 3300005842 Bacteria 50101
108 Ga0068858_100022020 3300005842 Bacteria 5951
109 Ga0068858_100304891 3300005842 Bacteria 1520
110 Ga0068858_100371314 3300005842 Bacteria 1372
111 Ga0068860_100006077 3300005843 Bacteria 12153
112 Ga0068860_100013007 3300005843 Bacteria 8172
113 Ga0068860_100041273 3300005843 Bacteria 4407
114 Ga0068862_100000964 3300005844 Bacteria 27678
115 Ga0068862_100002992 3300005844 Bacteria 14738
116 Ga0068862_100087841 3300005844 Bacteria 2704
117 Ga0081455_10162484 3300005937 Bacteria 1710
118 Ga0070717_10198236 3300006028 Bacteria 1757
119 Ga0070715_10061214 3300006163 Bacteria 1652
120 Ga0070715_10063584 3300006163 Bacteria 1627
121 Ga0070716_100011523 3300006173 Bacteria 4452
122 Ga0070716_100039090 3300006173 Bacteria 2631
123 Ga0070712_100002067 3300006175 Bacteria 12312
124 Ga0070712_100032697 3300006175 Bacteria 3514
125 Ga0097621_100054799 3300006237 Bacteria 3254
126 Ga0097621_100089156 3300006237 Bacteria 2578
127 Ga0097621_100117028 3300006237 Bacteria 2257
128 Ga0068871_100086254 3300006358 Bacteria 2608
129 Ga0068871_100353334 3300006358 Bacteria 1300
130 Ga0075428_100004599 3300006844 Bacteria 15255
131 Ga0075428_100034146 3300006844 Bacteria 5612
132 Ga0075430_100003571 3300006846 Bacteria 13034
133 Ga0075430_100010773 3300006846 Bacteria 7749
134 Ga0075430_100224110 3300006846 Bacteria 1560
135 Ga0075431_100001502 3300006847 Bacteria 21609
136 Ga0075431_100064187 3300006847 Bacteria 3791
137 Ga0075431_100115456 3300006847 Bacteria 2771
138 Ga0075431_100151389 3300006847 Bacteria 2389
139 Ga0075429_100004004 3300006880 Bacteria 12617
140 Ga0075429_100012088 3300006880 Bacteria 7482
141 Ga0075429_100367433 3300006880 Bacteria 1260
142 Ga0068865_100095333 3300006881 Bacteria 2167
143 Ga0097620_100000406 3300006931 Bacteria 42822
144 Ga0097620_100018574 3300006931 Bacteria 6989
145 Ga0097620_100034060 3300006931 Bacteria 5113
146 Ga0099794_10029540 3300007265 Bacteria 2555
147 Ga0099795_10038906 3300007788 Bacteria 1681
148 Ga0105250_10021891 3300009092 Bacteria 2579
149 Ga0105240_10021690 3300009093 Bacteria 8539
150 Ga0105240_10028854 3300009093 Bacteria 7238
151 Ga0105240_10031390 3300009093 Bacteria 6890
152 Ga0105240_10040582 3300009093 Bacteria 5950
153 Ga0105240_10132598 3300009093 Bacteria 2987
154 Ga0105240_10155844 3300009093 Bacteria 2716
155 Ga0105240_10269937 3300009093 Bacteria 1959
156 Ga0111539_10008393 3300009094 Bacteria 13144
157 Ga0111539_10009119 3300009094 Bacteria 12552
158 Ga0111539_10053499 3300009094 Bacteria 4805
159 Ga0111539_10139930 3300009094 Bacteria 2834
160 Ga0111539_10208141 3300009094 Bacteria 2279
161 Ga0105245_10006627 3300009098 Bacteria 10170
162 Ga0105245_10512446 3300009098 Bacteria 1217
163 Ga0105247_10000121 3300009101 Bacteria 75837
164 Ga0105247_10017369 3300009101 Bacteria 4320
165 Ga0105247_10427191 3300009101 Bacteria 950
166 Ga0114129_10003320 3300009147 Bacteria 22605
167 Ga0114129_10199810 3300009147 Bacteria 2709
168 Ga0105243_10335975 3300009148 Bacteria 1382
169 Ga0105241_10011336 3300009174 Bacteria 6535
170 Ga0105241_10133809 3300009174 Bacteria 2010
171 Ga0105242_10007452 3300009176 Bacteria 8425
172 Ga0105248_10003310 3300009177 Bacteria 17884
173 Ga0105248_10015452 3300009177 Bacteria 8413
174 Ga0105248_10037449 3300009177 Bacteria 5426
175 Ga0105248_10104018 3300009177 Bacteria 3201
176 Ga0105237_10007569 3300009545 Bacteria 11873
177 Ga0105237_10059289 3300009545 Bacteria 3829
178 Ga0105237_10071121 3300009545 Bacteria 3474
179 Ga0105237_10331235 3300009545 Bacteria 1527
180 Ga0105237_10586216 3300009545 Bacteria 1122
181 Ga0105238_10416397 3300009551 Bacteria 1338
182 Ga0105238_10417492 3300009551 Bacteria 1336
183 Ga0105238_10421831 3300009551 Bacteria 1329
184 Ga0105249_10005346 3300009553 Bacteria 11078
185 Ga0105249_10010397 3300009553 Bacteria 8177
186 Ga0105249_10019072 3300009553 Bacteria 6117
187 Ga0105249_10039328 3300009553 Bacteria 4294
188 Ga0105249_10190707 3300009553 Bacteria 2000
189 Ga0105239_10025114 3300010375 Bacteria 6563
190 Ga0105239_10259052 3300010375 Bacteria 1954
191 Ga0105246_10030856 3300011119 Bacteria 3543
192 Ga0157369_10063138 3300013105 Bacteria 3991
193 Ga0157374_10004235 3300013296 Bacteria 12058
194 Ga0157374_10113725 3300013296 Bacteria 2605
195 Ga0157378_10018225 3300013297 Bacteria 6163
196 Ga0163162_10042988 3300013306 Bacteria 4523
197 Ga0163162_10151572 3300013306 Bacteria 2437
198 Ga0163162_10270258 3300013306 Bacteria 1832
199 Ga0163162_10559184 3300013306 Bacteria 1272
200 Ga0157372_10133548 3300013307 Bacteria 2857
201 Ga0157372_10210981 3300013307 Bacteria 2251
202 Ga0157375_10093432 3300013308 Bacteria 3074
203 Ga0157375_10156116 3300013308 Bacteria 2421
204 Ga0163163_10000224 3300014325 Bacteria 58364
205 Ga0163163_10095289 3300014325 Bacteria 2996
206 Ga0163163_10098889 3300014325 Bacteria 2939
207 Ga0163163_10170415 3300014325 Bacteria 2223
208 Ga0163163_10600005 3300014325 Bacteria 1164
209 Ga0157377_10004582 3300014745 Bacteria 6385
210 Ga0157379_10018255 3300014968 Bacteria 6182
211 Ga0157379_10018378 3300014968 Bacteria 6163
212 Ga0157379_10096304 3300014968 Bacteria 2656
213 Ga0157379_10312959 3300014968 Bacteria 1432
214 Ga0157379_10432862 3300014968 Bacteria 1212
215 Ga0157376_10297088 3300014969 Bacteria 1527
216 Ga0157376_10331552 3300014969 Bacteria 1450
217 Ga0163161_10051924 3300017792 Bacteria 2972
218 Ga0213872_10111046 3300021361 Bacteria 1218
219 Ga0213874_10053720 3300021377 Bacteria 1243
220 Ga0213874_10069458 3300021377 Bacteria 1120
221 Ga0213871_10062904 3300021441 Bacteria 1036
222 Ga0207692_10062106 3300025898 Bacteria 1938
223 Ga0207642_10046387 3300025899 Bacteria 1936
224 Ga0207710_10000156 3300025900 Bacteria 73078
225 Ga0207710_10013173 3300025900 Bacteria 3484
226 Ga0207710_10048974 3300025900 Bacteria 1892
227 Ga0207688_10035285 3300025901 Bacteria 2771
228 Ga0207688_10320913 3300025901 Bacteria 950
229 Ga0207680_10005027 3300025903 Bacteria 6303
230 Ga0207680_10019582 3300025903 Bacteria 3622
231 Ga0207680_10037509 3300025903 Bacteria 2798
232 Ga0207680_10105811 3300025903 Bacteria 1816
233 Ga0207685_10057621 3300025905 Bacteria 1525
234 Ga0207699_10004337 3300025906 Bacteria 6784
235 Ga0207699_10019985 3300025906 Bacteria 3581
236 Ga0207645_10080607 3300025907 Bacteria 2086
237 Ga0207645_10170043 3300025907 Bacteria 1428
238 Ga0207654_10612632 3300025911 Bacteria 778
239 Ga0207707_10035001 3300025912 Bacteria 4392
240 Ga0207707_10187897 3300025912 Bacteria 1803
241 Ga0207707_10265105 3300025912 Unclassified 1490
242 Ga0207695_10012860 3300025913 Bacteria 10019
243 Ga0207695_10017655 3300025913 Bacteria 8290
244 Ga0207695_10110248 3300025913 Bacteria 2732
245 Ga0207695_10125113 3300025913 Bacteria 2534
246 Ga0207695_10161072 3300025913 Bacteria 2175
247 Ga0207671_10135856 3300025914 Bacteria 1891
248 Ga0207671_10390523 3300025914 Bacteria 1106
249 Ga0207671_10528168 3300025914 Unclassified 941
250 Ga0207693_10003470 3300025915 Bacteria 13451
251 Ga0207663_10029268 3300025916 Bacteria 3233
252 Ga0207663_10071005 3300025916 Bacteria 2245
253 Ga0207663_10268686 3300025916 Bacteria 1262
254 Ga0207660_10010562 3300025917 Bacteria 5996
255 Ga0207662_10004422 3300025918 Bacteria 7391
256 Ga0207657_10402287 3300025919 Bacteria 1077
257 Ga0207649_10064865 3300025920 Bacteria 2310
258 Ga0207652_10018298 3300025921 Bacteria 5746
259 Ga0207681_10041775 3300025923 Bacteria 3059
260 Ga0207694_10095602 3300025924 Bacteria 2349
261 Ga0207694_10374751 3300025924 Bacteria 1181
262 Ga0207659_10001804 3300025926 Bacteria 12667
263 Ga0207687_10334965 3300025927 Bacteria 1229
264 Ga0207700_10010282 3300025928 Bacteria 5893
265 Ga0207700_10049162 3300025928 Bacteria 3136
266 Ga0207700_10330715 3300025928 Bacteria 1322
267 Ga0207700_10471811 3300025928 Bacteria 1108
268 Ga0207664_10052313 3300025929 Bacteria 3230
269 Ga0207664_10137571 3300025929 Bacteria 2062
270 Ga0207644_10001074 3300025931 Bacteria 17501
271 Ga0207644_10040757 3300025931 Bacteria 3282
272 Ga0207644_10602885 3300025931 Bacteria 912
273 Ga0207706_10079481 3300025933 Bacteria 2884
274 Ga0207709_10057906 3300025935 Bacteria 2405
275 Ga0207670_10008874 3300025936 Bacteria 5698
276 Ga0207704_10006319 3300025938 Bacteria 5517
277 Ga0207704_11094631 3300025938 Bacteria 677
278 Ga0207665_10103157 3300025939 Bacteria 1994
279 Ga0207691_10004479 3300025940 Bacteria 13536
280 Ga0207711_10020470 3300025941 Bacteria 5516
281 Ga0207711_10115545 3300025941 Bacteria 2391
282 Ga0207711_10218530 3300025941 Bacteria 1742
283 Ga0207689_10005177 3300025942 Bacteria 11713
284 Ga0207689_10290643 3300025942 Bacteria 1354
285 Ga0207661_10095298 3300025944 Bacteria 2488
286 Ga0207679_10029066 3300025945 Bacteria 3845
287 Ga0207667_10001582 3300025949 Bacteria 28630
288 Ga0207667_10103672 3300025949 Bacteria 2934
289 Ga0207651_10007041 3300025960 Bacteria 5963
290 Ga0207651_10539969 3300025960 Bacteria 1012
291 Ga0207712_10092926 3300025961 Bacteria 2225
292 Ga0207712_10112237 3300025961 Bacteria 2047
293 Ga0207712_10306154 3300025961 Bacteria 1306
294 Ga0207712_10339821 3300025961 Bacteria 1245
295 Ga0207668_10016147 3300025972 Bacteria 4654
296 Ga0207640_10063039 3300025981 Bacteria 2462
297 Ga0207658_10004873 3300025986 Bacteria 9263
298 Ga0207658_10133104 3300025986 Bacteria 2000
299 Ga0207677_10172390 3300026023 Bacteria 1693
300 Ga0207677_10917787 3300026023 Bacteria 790
301 Ga0207703_10000366 3300026035 Bacteria 48363
302 Ga0207703_10000934 3300026035 Bacteria 28340
303 Ga0207703_10153953 3300026035 Bacteria 2007
304 Ga0207703_10497357 3300026035 Bacteria 1144
305 Ga0207703_10655985 3300026035 Bacteria 996
306 Ga0207678_10158512 3300026067 Bacteria 1933
307 Ga0207708_10160233 3300026075 Bacteria 1776
308 Ga0207702_10168801 3300026078 Bacteria 2004
309 Ga0207702_10631137 3300026078 Bacteria 1053
310 Ga0207641_10000196 3300026088 Bacteria 81985
311 Ga0207641_10026648 3300026088 Bacteria 4772
312 Ga0207641_10150471 3300026088 Bacteria 2107
313 Ga0207641_10155847 3300026088 Bacteria 2072
314 Ga0207648_10017152 3300026089 Bacteria 6598
315 Ga0207648_10054165 3300026089 Bacteria 3504
316 Ga0207676_10057171 3300026095 Bacteria 3071
317 Ga0207676_10150039 3300026095 Bacteria 2007
318 Ga0207674_10048501 3300026116 Bacteria 4346
319 Ga0207674_10129843 3300026116 Bacteria 2484
320 Ga0207675_100048326 3300026118 Bacteria 3972
321 Ga0207675_100115965 3300026118 Bacteria 2531
322 Ga0207675_100623444 3300026118 Bacteria 1083
323 Ga0207683_10005129 3300026121 Bacteria 11244
324 Ga0207683_10085484 3300026121 Bacteria 2804
325 Ga0207428_10005862 3300027907 Bacteria 11387
326 Ga0207428_10031564 3300027907 Bacteria 4367
327 Ga0207428_10081208 3300027907 Bacteria 2532
328 Ga0268266_10000938 3300028379 Bacteria 37164
329 Ga0268266_10002660 3300028379 Bacteria 18804
330 Ga0268266_10081289 3300028379 Bacteria 2825
331 Ga0268266_10122198 3300028379 Bacteria 2318
332 Ga0268266_10134031 3300028379 Bacteria 2217
333 Ga0268266_10196693 3300028379 Bacteria 1843
334 Ga0268266_10758878 3300028379 Bacteria 936
335 Ga0268265_10008201 3300028380 Bacteria 7058
336 Ga0268265_10025509 3300028380 Bacteria 4197
337 Ga0268264_10000182 3300028381 Bacteria 134007
338 Ga0268264_10070440 3300028381 Bacteria 2960
339 Ga0268264_10087115 3300028381 Bacteria 2684
340 Ga0265334_10008041 3300028573 Bacteria 4502
341 Ga0265338_10343473 3300028800 Bacteria 1075
342 Ga0307511_10000008 3300030521 Bacteria 159928
343 Ga0265328_10132286 3300031239 Bacteria 934
344 Ga0265340_10035104 3300031247 Bacteria 2491
345 Ga0265340_10043220 3300031247 Bacteria 2209
346 Ga0265340_10193320 3300031247 Bacteria 917
347 Ga0307513_10068953 3300031456 Bacteria 3702
348 Ga0307509_10000154 3300031507 Bacteria 106459
349 Ga0307509_10000162 3300031507 Bacteria 104449
350 Ga0307408_100474905 3300031548 Bacteria 1090
351 Ga0307408_100606754 3300031548 Bacteria 973
352 Ga0265313_10026139 3300031595 Bacteria 3081
353 Ga0307508_10245082 3300031616 Bacteria 1389
354 Ga0307508_10302614 3300031616 Bacteria 1192
355 Ga0307413_10036708 3300031824 Bacteria 2824
356 Ga0307413_10119921 3300031824 Bacteria 1780
357 Ga0307413_10844183 3300031824 Bacteria 773
358 Ga0307406_10033435 3300031901 Bacteria 3148
359 Ga0307407_10356036 3300031903 Bacteria 1038
360 Ga0307409_100039376 3300031995 Bacteria 3507
361 Ga0307409_101145149 3300031995 Bacteria 800
362 Ga0307409_101444317 3300031995 Bacteria 715
363 Ga0307416_100165328 3300032002 Bacteria 2051
364 Ga0307416_100915629 3300032002 Bacteria 977
365 Ga0307414_10277466 3300032004 Unclassified 1407
366 Ga0307411_10792977 3300032005 Unclassified 833
367 Ga0307415_100037822 3300032126 Bacteria 3175
368 Ga0307510_10000003 3300033180 Bacteria 756654
369 Ga0307510_10000959 3300033180 Bacteria 30502
370 Ga0373958_0034278 3300034819 Bacteria 1011
371 Ga0373936_0025191 3300035113 Unclassified 2325
372 Ga0373936_0076094 3300035113 Bacteria 1390
373 Ga0373945_0043753 3300035116 Bacteria 1626
374 Ga0373956_0225224 3300035119 Unclassified 890
375 Ga0373943_0027338 3300035170 Bacteria 2680
376 Ga0373946_0039609 3300035171 Bacteria 1924
377 Ga0373955_0083623 3300035172 Bacteria 1808
378 Ga0373931_0219121 3300035691 Bacteria 1145
379 Ga0373927_0019863 3300035695 Bacteria 4405
380 Ga0373947_0096605 3300035725 Bacteria 1850
381 Ga0373937_0063084 3300036401 Bacteria 3407
382 Ga0373925_0119420 3300037068 Bacteria 2045
383 Ga0373925_0284718 3300037068 Bacteria 1332
384 Ga0436365_0509966 3300039437 Bacteria 3793
385 Ga0436365_0981884 3300039437 Bacteria 3421
386 Ga0436365_1338189 3300039437 Bacteria 806
387 Ga0436360_0578160 3300039438 Bacteria 8826
388 Ga0436360_0584636 3300039438 Bacteria 829
389 Ga0436360_0732653 3300039438 Bacteria 1023
390 Ga0436361_1047185 3300039447 Bacteria 1912
391 Ga0436363_1033365 3300039450 Bacteria 15814
392 Ga0436363_1305614 3300039450 Bacteria 8672
393 Ga0436363_1490709 3300039450 Bacteria 2593
394 Ga0436362_0021549 3300039453 Bacteria 1035
395 Ga0436362_1178881 3300039453 Bacteria 2209
396 Ga0436362_1277379 3300039453 Bacteria 1755
397 Ga0451797_1206887 3300041453 Bacteria 885
398 Ga0439448_0120213 3300042005 Bacteria 901
399 Ga0450888_032563 3300042126 Bacteria 702
400 Ga0439464_0034504 3300042439 Bacteria 1427
401 Ga0439440_0034537 3300042993 Bacteria 1210
402 Ga0466969_0000684 3300044656 Bacteria 18469
403 Ga0466969_0006450 3300044656 Bacteria 6245
404 Ga0466969_0013465 3300044656 Bacteria 4308
405 Ga0466965_0072025 3300044683 Bacteria 1739
406 Ga0466966_0001828 3300044684 Bacteria 13811
407 Ga0466966_0043011 3300044684 Bacteria 2897
408 Ga0466961_0000614 3300044693 Bacteria 22481
409 Ga0466964_0000095 3300044706 Bacteria 21226
410 Ga0466971_0003951 3300044719 Bacteria 6370
411 Ga0466970_0020292 3300044765 Bacteria 3451
412 Ga0466970_0401912 3300044765 Bacteria 782
413 Ga0466959_0007718 3300045049 Bacteria 7560
414 Ga0466959_0394123 3300045049 Bacteria 941
415 Ga0451576_0111304 3300045051 Bacteria 2849
416 Ga0466958_0028366 3300045836 Bacteria 3319
417 Ga0466958_0398262 3300045836 Bacteria 889
418 Ga0495638_0226812 3300046460 Bacteria 1041
419 Ga0495650_0011741 3300046471 Bacteria 4766
420 Ga0495580_0003185 3300046472 Bacteria 14055
421 Ga0495580_0172968 3300046472 Bacteria 1492
422 Ga0495580_0461737 3300046472 Bacteria 851
423 Ga0495580_0520504 3300046472 Bacteria 793
424 Ga0495639_0023259 3300046475 Bacteria 2723
425 Ga0495606_0078058 3300046507 Bacteria 2066
426 Ga0495606_0134806 3300046507 Bacteria 1464
427 Ga0495628_0057204 3300046516 Bacteria 3068
428 Ga0495630_0072304 3300046517 Bacteria 2596
429 Ga0495632_0030263 3300046519 Bacteria 2812
430 Ga0495586_0129488 3300046535 Bacteria 1413
431 Ga0495645_0181220 3300046543 Bacteria 1443
432 Ga0495634_0293825 3300046642 Bacteria 984
433 Ga0495625_0183446 3300046660 Bacteria 1390
434 Ga0495647_0042515 3300046681 Bacteria 1735
435 Ga0495647_0126272 3300046681 Unclassified 1080
436 Ga0495658_0008333 3300046683 Bacteria 5135
437 Ga0495658_0079599 3300046683 Bacteria 1920
438 Ga0495624_0305940 3300046690 Bacteria 958
439 Ga0495674_0105299 3300047319 Bacteria 2397
440 Ga0495672_0134952 3300047320 Bacteria 1295
441 Ga0495680_0338544 3300047322 Bacteria 1050
442 Ga0495687_056788 3300047443 Bacteria 1631
443 Ga0495687_118435 3300047443 Bacteria 960
444 Ga0495686_0068866 3300047472 Bacteria 2183
445 Ga0496100_0062048 3300048903 Bacteria 2465
446 Ga0496101_0016954 3300048904 Bacteria 4931
447 Ga0496101_0614928 3300048904 Bacteria 859
448 Ga0496102_0005754 3300048905 Bacteria 10535
449 Ga0496102_0009171 3300048905 Bacteria 8488
450 Ga0496102_0019614 3300048905 Bacteria 5957
451 Ga0496102_0135186 3300048905 Bacteria 2310
452 Ga0496103_0052221 3300048906 Bacteria 2532
453 Ga0496104_0034341 3300048907 Bacteria 4729
454 Ga0496104_0140401 3300048907 Bacteria 2321
455 Ga0496104_0153842 3300048907 Bacteria 2207
456 Ga0496104_0345594 3300048907 Bacteria 1400
457 Ga0496105_0148357 3300048908 Bacteria 1928
458 Ga0496106_0007946 3300048909 Bacteria 7837
459 Ga0496106_0047111 3300048909 Bacteria 3243
460 Ga0496106_0391070 3300048909 Bacteria 1117
461 Ga0496106_0449786 3300048909 Bacteria 1035
462 Ga0496106_0715968 3300048909 Bacteria 797
463 Ga0496107_0079291 3300048910 Bacteria 2393
464 Ga0496108_0008197 3300048911 Bacteria 8480
465 Ga0496108_0067260 3300048911 Bacteria 3022
466 Ga0496109_0029076 3300048912 Bacteria 4947
467 Ga0496109_0495577 3300048912 Bacteria 1153
468 Ga0496110_0107308 3300048913 Bacteria 2506
469 Ga0496110_0112707 3300048913 Bacteria 2445
470 Ga0496111_0000810 3300048914 Bacteria 16784
471 Ga0496111_0124432 3300048914 Bacteria 1906
472 Ga0496112_0020539 3300048915 Bacteria 6263
473 Ga0496112_0033730 3300048915 Bacteria 4977
474 Ga0496113_0076939 3300048916 Bacteria 2550
475 Ga0496114_0147574 3300048917 Bacteria 2039
476 Ga0496115_0037648 3300048918 Bacteria 3834
477 Ga0496116_0273968 3300048919 Bacteria 822
478 Ga0496117_0000095 3300048920 Bacteria 198731
479 Ga0496117_0076827 3300048920 Bacteria 2212
480 Ga0496118_0000003 3300048921 Bacteria 773148
481 Ga0496118_0081800 3300048921 Bacteria 2266
482 Ga0496119_0003983 3300048922 Bacteria 14949
483 Ga0496119_0012799 3300048922 Bacteria 6768
484 Ga0496120_0000842 3300048923 Bacteria 43622
485 Ga0496121_0000547 3300048924 Bacteria 70979
486 Ga0496121_0251154 3300048924 Bacteria 1226
487 Ga0496125_0000112 3300048928 Bacteria 188192
488 Ga0496125_0002321 3300048928 Bacteria 25054
489 Ga0496125_0006226 3300048928 Bacteria 12987
490 Ga0496126_0001774 3300048929 Bacteria 31913
491 Ga0496126_0585245 3300048929 Bacteria 881
492 Ga0501297_019143 3300049520 Unclassified 845
493 Ga0501299_113966 3300049522 Bacteria 643
494 Ga0501034_0161459 3300049571 Bacteria 2212
495 Ga0501046_0153975 3300049580 Unclassified 1733
496 Ga0501047_0069767 3300049581 Bacteria 3384
497 Ga0501067_0147069 3300049583 Bacteria 1313
498 nmdc:mga05p37_37913_c1 3300050507 Bacteria 5912
499 nmdc:mga05p37_51358_c1 3300050507 Bacteria 3037
500 nmdc:mga09592_200742_c1 3300050508 Bacteria 1727
501 nmdc:mga09592_32024_c1 3300050508 Bacteria 4383
502 nmdc:mga09592_7589_c1 3300050508 Bacteria 8822
503 nmdc:mga0qj67_14359_c1 3300050509 Bacteria 5988
504 nmdc:mga0qj67_22091_c1 3300050509 Bacteria 4884
505 nmdc:mga0qj67_316727_c1 3300050509 Bacteria 1263
506 nmdc:mga0qj67_32398_c1 3300050509 Unclassified 4075
507 nmdc:mga0qj67_49041_c1 3300050509 Bacteria 3337
508 nmdc:mga0qj67_841683_c1 3300050509 Bacteria 725
509 nmdc:mga06r32_1290_c1 3300050510 Bacteria 22556
510 nmdc:mga06r32_1456893_c1 3300050510 Bacteria 626
511 nmdc:mga06r32_336_c1 3300050510 Bacteria 39160
512 nmdc:mga06r32_410620_c1 3300050510 Bacteria 1335
513 nmdc:mga06r32_4764_c1 3300050510 Bacteria 12199
514 nmdc:mga08y16_333127_c1 3300050511 Bacteria 1561
515 nmdc:mga08y16_350053_c1 3300050511 Bacteria 1518
516 nmdc:mga08y16_4878_c1 3300050511 Bacteria 14012
517 nmdc:mga08y16_6554_c1 3300050511 Bacteria 12205
518 nmdc:mga08x19_181679_c1 3300050514 Bacteria 1436
519 Ga0495619_0389184 3300053085 Unclassified 963
520 Ga0500614_123138 3300053123 Unclassified 765
521 Ga0500617_029067 3300053124 Bacteria 2466
522 Ga0500658_0079160 3300053134 Bacteria 1402
523 Ga0500568_0075629 3300053139 Bacteria 1283
524 Ga0500588_0003915 3300053146 Bacteria 3185
525 Ga0500616_0203559 3300053153 Bacteria 875
526 Ga0500622_0002144 3300053156 Bacteria 14664
527 Ga0500622_0007193 3300053156 Bacteria 6342
528 Ga0500630_133595 3300053159 Bacteria 1080
529 Ga0500637_0022394 3300053178 Bacteria 3443
530 Ga0500637_0059240 3300053178 Bacteria 2191
531 Ga0466962_0000111 3300061719 Bacteria 33174

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100066377 Ga0070662_1000663772 167
2 3300009094 Ga0111539_10208141 Ga0111539_102081413 167
3 3300050511 nmdc:mga08y16_333127_c1 nmdc:mga08y16_333127_c1_250_795 167
4 3300053134 Ga0500658_0079160 Ga0500658_0079160_553_1080 173
5 3300049522 Ga0501299_113966 Ga0501299_113966_62_628 175
6 3300049581 Ga0501047_0069767 Ga0501047_0069767_1677_2210 175
7 3300005293 Ga0065715_10536340 Ga0065715_105363401 176
8 3300005329 Ga0070683_100202970 Ga0070683_1002029702 176
9 3300005330 Ga0070690_100005087 Ga0070690_1000050879 176
10 3300005334 Ga0068869_100297601 Ga0068869_1002976012 176
11 3300005335 Ga0070666_10025349 Ga0070666_100253493 176
12 3300005338 Ga0068868_100161301 Ga0068868_1001613013 176
13 3300005340 Ga0070689_100004646 Ga0070689_1000046464 176
14 3300005344 Ga0070661_100048418 Ga0070661_1000484182 176
15 3300005347 Ga0070668_100277099 Ga0070668_1002770991 176
16 3300005354 Ga0070675_100001313 Ga0070675_10000131314 176
17 3300005364 Ga0070673_100003052 Ga0070673_10000305213 176
18 3300005365 Ga0070688_100001473 Ga0070688_10000147314 176
19 3300005366 Ga0070659_100595272 Ga0070659_1005952722 176
20 3300005367 Ga0070667_100017869 Ga0070667_1000178696 176
21 3300005438 Ga0070701_10021666 Ga0070701_100216663 176
22 3300005440 Ga0070705_100051614 Ga0070705_1000516142 176
23 3300005441 Ga0070700_100025522 Ga0070700_1000255224 176
24 3300005444 Ga0070694_100680856 Ga0070694_1006808562 176
25 3300005456 Ga0070678_100092629 Ga0070678_1000926293 176
26 3300005459 Ga0068867_100014153 Ga0068867_1000141533 176
27 3300005466 Ga0070685_10092761 Ga0070685_100927613 176
28 3300005539 Ga0068853_100282550 Ga0068853_1002825502 176
29 3300005543 Ga0070672_100013830 Ga0070672_1000138304 176
30 3300005544 Ga0070686_100001603 Ga0070686_10000160313 176
31 3300005548 Ga0070665_100030247 Ga0070665_1000302476 176
32 3300005564 Ga0070664_100006418 Ga0070664_10000641810 176
33 3300005577 Ga0068857_100083909 Ga0068857_1000839095 176
34 3300005578 Ga0068854_100054600 Ga0068854_1000546004 176
35 3300005615 Ga0070702_100026125 Ga0070702_1000261255 176
36 3300005617 Ga0068859_100034061 Ga0068859_1000340614 176
37 3300005618 Ga0068864_100005920 Ga0068864_1000059205 176
38 3300005718 Ga0068866_10028329 Ga0068866_100283294 176
39 3300005719 Ga0068861_100028504 Ga0068861_1000285045 176
40 3300005834 Ga0068851_10327548 Ga0068851_103275481 176
41 3300005841 Ga0068863_100006160 Ga0068863_1000061609 176
42 3300005844 Ga0068862_100002992 Ga0068862_10000299215 176
43 3300006237 Ga0097621_100054799 Ga0097621_1000547993 176
44 3300006931 Ga0097620_100034060 Ga0097620_1000340607 176
45 3300009098 Ga0105245_10512446 Ga0105245_105124462 176
46 3300009177 Ga0105248_10003310 Ga0105248_100033105 176
47 3300009553 Ga0105249_10039328 Ga0105249_100393284 176
48 3300013308 Ga0157375_10093432 Ga0157375_100934323 176
49 3300014325 Ga0163163_10000224 Ga0163163_100002248 176
50 3300014745 Ga0157377_10004582 Ga0157377_100045828 176
51 3300014968 Ga0157379_10312959 Ga0157379_103129592 176
52 3300017792 Ga0163161_10051924 Ga0163161_100519244 176
53 3300025899 Ga0207642_10046387 Ga0207642_100463872 176
54 3300025900 Ga0207710_10048974 Ga0207710_100489743 176
55 3300025901 Ga0207688_10035285 Ga0207688_100352855 176
56 3300025903 Ga0207680_10005027 Ga0207680_100050275 176
57 3300025907 Ga0207645_10170043 Ga0207645_101700432 176
58 3300025918 Ga0207662_10004422 Ga0207662_100044222 176
59 3300025919 Ga0207657_10402287 Ga0207657_104022872 176
60 3300025920 Ga0207649_10064865 Ga0207649_100648652 176
61 3300025923 Ga0207681_10041775 Ga0207681_100417752 176
62 3300025926 Ga0207659_10001804 Ga0207659_100018049 176
63 3300025927 Ga0207687_10334965 Ga0207687_103349652 176
64 3300025936 Ga0207670_10008874 Ga0207670_100088745 176
65 3300025940 Ga0207691_10004479 Ga0207691_1000447914 176
66 3300025941 Ga0207711_10115545 Ga0207711_101155453 176
67 3300025942 Ga0207689_10005177 Ga0207689_100051772 176
68 3300025945 Ga0207679_10029066 Ga0207679_100290666 176
69 3300025960 Ga0207651_10007041 Ga0207651_100070416 176
70 3300025961 Ga0207712_10112237 Ga0207712_101122372 176
71 3300025981 Ga0207640_10063039 Ga0207640_100630393 176
72 3300026023 Ga0207677_10917787 Ga0207677_109177871 176
73 3300026075 Ga0207708_10160233 Ga0207708_101602332 176
74 3300026088 Ga0207641_10026648 Ga0207641_100266485 176
75 3300026089 Ga0207648_10017152 Ga0207648_100171523 176
76 3300026116 Ga0207674_10048501 Ga0207674_100485016 176
77 3300026121 Ga0207683_10085484 Ga0207683_100854844 176
78 3300028379 Ga0268266_10122198 Ga0268266_101221982 176
79 3300028380 Ga0268265_10025509 Ga0268265_100255096 176
80 3300028381 Ga0268264_10070440 Ga0268264_100704405 176
81 3300031548 Ga0307408_100606754 Ga0307408_1006067542 176
82 3300031824 Ga0307413_10036708 Ga0307413_100367081 176
83 3300032002 Ga0307416_100165328 Ga0307416_1001653282 176
84 3300032004 Ga0307414_10277466 Ga0307414_102774661 176
85 3300032126 Ga0307415_100037822 Ga0307415_1000378224 176
86 3300034819 Ga0373958_0034278 Ga0373958_0034278_430_975 176
87 3300035691 Ga0373931_0219121 Ga0373931_0219121_171_716 176
88 3300042126 Ga0450888_032563 Ga0450888_032563_13_558 176
89 3300042993 Ga0439440_0034537 Ga0439440_0034537_311_856 176
90 3300045051 Ga0451576_0111304 Ga0451576_0111304_2273_2818 176
91 3300046660 Ga0495625_0183446 Ga0495625_0183446_244_789 176
92 3300048907 Ga0496104_0140401 Ga0496104_0140401_1232_1777 176
93 3300048909 Ga0496106_0047111 Ga0496106_0047111_2240_2785 176
94 3300048913 Ga0496110_0112707 Ga0496110_0112707_810_1355 176
95 3300048914 Ga0496111_0124432 Ga0496111_0124432_699_1244 176
96 3300049520 Ga0501297_019143 Ga0501297_019143_75_620 176
97 3300050510 nmdc:mga06r32_1456893_c1 nmdc:mga06r32_1456893_c1_38_583 176
98 3300050510 nmdc:mga06r32_410620_c1 nmdc:mga06r32_410620_c1_41_586 176
99 3300053156 Ga0500622_0002144 Ga0500622_0002144_13047_13583 176
100 3300006844 Ga0075428_100004599 Ga0075428_10000459916 177
101 3300006846 Ga0075430_100003571 Ga0075430_1000035715 177
102 3300006847 Ga0075431_100115456 Ga0075431_1001154562 177
103 3300006880 Ga0075429_100004004 Ga0075429_10000400413 177
104 3300031901 Ga0307406_10033435 Ga0307406_100334354 177
105 3300047320 Ga0495672_0134952 Ga0495672_0134952_488_1048 178
106 3300009094 Ga0111539_10139930 Ga0111539_101399303 179
107 3300009147 Ga0114129_10003320 Ga0114129_1000332011 179
108 3300031548 Ga0307408_100474905 Ga0307408_1004749051 179
109 3300031995 Ga0307409_101444317 Ga0307409_1014443171 179
110 3300032005 Ga0307411_10792977 Ga0307411_107929772 179
111 3300049580 Ga0501046_0153975 Ga0501046_0153975_912_1481 179
112 3300050507 nmdc:mga05p37_37913_c1 nmdc:mga05p37_37913_c1_3184_3750 179
113 3300050508 nmdc:mga09592_32024_c1 nmdc:mga09592_32024_c1_2559_3125 179
114 3300050509 nmdc:mga0qj67_22091_c1 nmdc:mga0qj67_22091_c1_2302_2868 179
115 3300050510 nmdc:mga06r32_1290_c1 nmdc:mga06r32_1290_c1_19272_19838 179
116 3300053156 Ga0500622_0007193 Ga0500622_0007193_3419_3985 179
117 3300014968 Ga0157379_10432862 Ga0157379_104328622 180
118 3300046471 Ga0495650_0011741 Ga0495650_0011741_1004_1573 180
119 3300049571 Ga0501034_0161459 Ga0501034_0161459_850_1416 180
120 3300053124 Ga0500617_029067 Ga0500617_029067_1330_1905 180
121 3300053146 Ga0500588_0003915 Ga0500588_0003915_606_1181 180
122 3300031824 Ga0307413_10119921 Ga0307413_101199213 181
123 3300047472 Ga0495686_0068866 Ga0495686_0068866_1181_1759 181
124 3300053139 Ga0500568_0075629 Ga0500568_0075629_579_1154 181
125 3300053153 Ga0500616_0203559 Ga0500616_0203559_176_751 181
126 3300031824 Ga0307413_10844183 Ga0307413_108441831 182
127 3300046460 Ga0495638_0226812 Ga0495638_0226812_64_651 182
128 3300050509 nmdc:mga0qj67_32398_c1 nmdc:mga0qj67_32398_c1_2216_2797 182
129 3300006237 Ga0097621_100117028 Ga0097621_1001170282 186
130 3300037068 Ga0373925_0284718 Ga0373925_0284718_740_1315 186
131 3300044656 Ga0466969_0006450 Ga0466969_0006450_5260_5838 186
132 3300044684 Ga0466966_0043011 Ga0466966_0043011_1469_2047 186
133 3300005458 Ga0070681_10020717 Ga0070681_100207172 188
134 3300005535 Ga0070684_100191908 Ga0070684_1001919082 188
135 3300005548 Ga0070665_100718760 Ga0070665_1007187602 188
136 3300005937 Ga0081455_10162484 Ga0081455_101624842 188
137 3300006846 Ga0075430_100224110 Ga0075430_1002241102 188
138 3300009094 Ga0111539_10053499 Ga0111539_100534995 188
139 3300013307 Ga0157372_10133548 Ga0157372_101335482 188
140 3300025901 Ga0207688_10320913 Ga0207688_103209132 188
141 3300026118 Ga0207675_100623444 Ga0207675_1006234442 188
142 3300027907 Ga0207428_10031564 Ga0207428_100315644 188
143 3300028379 Ga0268266_10758878 Ga0268266_107588782 188
144 3300031456 Ga0307513_10068953 Ga0307513_100689536 188
145 3300032002 Ga0307416_100915629 Ga0307416_1009156291 188
146 3300042005 Ga0439448_0120213 Ga0439448_0120213_33_641 188
147 3300042439 Ga0439464_0034504 Ga0439464_0034504_733_1347 188
148 3300050511 nmdc:mga08y16_6554_c1 nmdc:mga08y16_6554_c1_10918_11532 188
149 3300005328 Ga0070676_10070758 Ga0070676_100707582 189
150 3300005331 Ga0070670_100051719 Ga0070670_1000517194 189
151 3300005336 Ga0070680_100018473 Ga0070680_1000184732 189
152 3300005347 Ga0070668_100032662 Ga0070668_1000326625 189
153 3300005353 Ga0070669_100007716 Ga0070669_1000077164 189
154 3300005546 Ga0070696_100161689 Ga0070696_1001616893 189
155 3300005577 Ga0068857_100328600 Ga0068857_1003286002 189
156 3300005719 Ga0068861_100078218 Ga0068861_1000782183 189
157 3300005844 Ga0068862_100000964 Ga0068862_10000096416 189
158 3300006844 Ga0075428_100034146 Ga0075428_1000341466 189
159 3300006846 Ga0075430_100010773 Ga0075430_1000107735 189
160 3300006847 Ga0075431_100064187 Ga0075431_1000641875 189
161 3300006847 Ga0075431_100151389 Ga0075431_1001513892 189
162 3300006880 Ga0075429_100367433 Ga0075429_1003674332 189
163 3300009094 Ga0111539_10009119 Ga0111539_100091197 189
164 3300009147 Ga0114129_10199810 Ga0114129_101998103 189
165 3300009148 Ga0105243_10335975 Ga0105243_103359752 189
166 3300009553 Ga0105249_10019072 Ga0105249_100190723 189
167 3300013306 Ga0163162_10151572 Ga0163162_101515724 189
168 3300025907 Ga0207645_10080607 Ga0207645_100806072 189
169 3300025933 Ga0207706_10079481 Ga0207706_100794812 189
170 3300025935 Ga0207709_10057906 Ga0207709_100579063 189
171 3300025938 Ga0207704_11094631 Ga0207704_110946311 189
172 3300025942 Ga0207689_10290643 Ga0207689_102906431 189
173 3300025961 Ga0207712_10306154 Ga0207712_103061542 189
174 3300025972 Ga0207668_10016147 Ga0207668_100161475 189
175 3300026116 Ga0207674_10129843 Ga0207674_101298432 189
176 3300026118 Ga0207675_100048326 Ga0207675_1000483265 189
177 3300027907 Ga0207428_10081208 Ga0207428_100812083 189
178 3300039437 Ga0436365_0509966 Ga0436365_0509966_2048_2620 189
179 3300039453 Ga0436362_1178881 Ga0436362_1178881_1120_1692 189
180 3300050508 nmdc:mga09592_200742_c1 nmdc:mga09592_200742_c1_1057_1683 189
181 3300050509 nmdc:mga0qj67_14359_c1 nmdc:mga0qj67_14359_c1_3099_3728 189
182 3300050509 nmdc:mga0qj67_316727_c1 nmdc:mga0qj67_316727_c1_153_785 189
183 3300050509 nmdc:mga0qj67_49041_c1 nmdc:mga0qj67_49041_c1_2310_2936 189
184 3300050509 nmdc:mga0qj67_841683_c1 nmdc:mga0qj67_841683_c1_64_690 189
185 3300050510 nmdc:mga06r32_4764_c1 nmdc:mga06r32_4764_c1_9096_9725 189
186 3300050511 nmdc:mga08y16_350053_c1 nmdc:mga08y16_350053_c1_412_1038 189
187 3300035113 Ga0373936_0025191 Ga0373936_0025191_272_844 190
188 3300053159 Ga0500630_133595 Ga0500630_133595_156_728 190
189 3300053178 Ga0500637_0022394 Ga0500637_0022394_2412_3008 190
190 3300006847 Ga0075431_100001502 Ga0075431_1000015027 191
191 3300006880 Ga0075429_100012088 Ga0075429_10001208811 191
192 3300009094 Ga0111539_10008393 Ga0111539_1000839313 191
193 3300009174 Ga0105241_10133809 Ga0105241_101338092 191
194 3300013306 Ga0163162_10270258 Ga0163162_102702582 191
195 3300014325 Ga0163163_10600005 Ga0163163_106000052 191
196 3300014969 Ga0157376_10331552 Ga0157376_103315522 191
197 3300026035 Ga0207703_10655985 Ga0207703_106559852 191
198 3300027907 Ga0207428_10005862 Ga0207428_100058622 191
199 3300031507 Ga0307509_10000154 Ga0307509_1000015474 191
200 3300039438 Ga0436360_0732653 Ga0436360_0732653_272_952 191
201 3300050507 nmdc:mga05p37_51358_c1 nmdc:mga05p37_51358_c1_244_873 191
202 3300050508 nmdc:mga09592_7589_c1 nmdc:mga09592_7589_c1_6820_7449 191
203 3300050510 nmdc:mga06r32_336_c1 nmdc:mga06r32_336_c1_21438_22067 191
204 3300050511 nmdc:mga08y16_4878_c1 nmdc:mga08y16_4878_c1_3591_4220 191
205 3300009093 Ga0105240_10269937 Ga0105240_102699372 192
206 3300045049 Ga0466959_0394123 Ga0466959_0394123_36_617 192
207 3300005434 Ga0070709_10010637 Ga0070709_100106373 193
208 3300005518 Ga0070699_100052569 Ga0070699_1000525692 193
209 3300005545 Ga0070695_100027921 Ga0070695_1000279213 193
210 3300006163 Ga0070715_10063584 Ga0070715_100635842 193
211 3300025906 Ga0207699_10004337 Ga0207699_100043372 193
212 3300039450 Ga0436363_1490709 Ga0436363_1490709_355_939 193
213 3300048905 Ga0496102_0005754 Ga0496102_0005754_7680_8282 193
214 3300048920 Ga0496117_0076827 Ga0496117_0076827_539_1141 193
215 3300025928 Ga0207700_10471811 Ga0207700_104718111 194
216 3300031239 Ga0265328_10132286 Ga0265328_101322862 194
217 3300039438 Ga0436360_0584636 Ga0436360_0584636_151_750 194
218 3300039450 Ga0436363_1305614 Ga0436363_1305614_6593_7204 194
219 3300046472 Ga0495580_0461737 Ga0495580_0461737_114_719 194
220 3300005330 Ga0070690_100015419 Ga0070690_1000154194 195
221 3300005334 Ga0068869_100575855 Ga0068869_1005758552 195
222 3300005338 Ga0068868_100075978 Ga0068868_1000759782 195
223 3300005355 Ga0070671_100007614 Ga0070671_1000076147 195
224 3300005367 Ga0070667_100130789 Ga0070667_1001307891 195
225 3300005434 Ga0070709_10010051 Ga0070709_100100515 195
226 3300005435 Ga0070714_100063291 Ga0070714_1000632912 195
227 3300005436 Ga0070713_100004623 Ga0070713_1000046234 195
228 3300005437 Ga0070710_10003168 Ga0070710_100031684 195
229 3300005439 Ga0070711_100002611 Ga0070711_1000026116 195
230 3300005456 Ga0070678_100354927 Ga0070678_1003549271 195
231 3300005459 Ga0068867_100038622 Ga0068867_1000386222 195
232 3300005544 Ga0070686_100069512 Ga0070686_1000695122 195
233 3300005614 Ga0068856_100012687 Ga0068856_1000126878 195
234 3300005841 Ga0068863_100012172 Ga0068863_1000121726 195
235 3300005842 Ga0068858_100022020 Ga0068858_1000220206 195
236 3300005843 Ga0068860_100013007 Ga0068860_1000130077 195
237 3300006173 Ga0070716_100039090 Ga0070716_1000390902 195
238 3300006175 Ga0070712_100002067 Ga0070712_10000206710 195
239 3300006237 Ga0097621_100089156 Ga0097621_1000891562 195
240 3300006358 Ga0068871_100086254 Ga0068871_1000862542 195
241 3300006881 Ga0068865_100095333 Ga0068865_1000953332 195
242 3300009098 Ga0105245_10006627 Ga0105245_1000662712 195
243 3300009101 Ga0105247_10427191 Ga0105247_104271911 195
244 3300009174 Ga0105241_10011336 Ga0105241_100113362 195
245 3300009176 Ga0105242_10007452 Ga0105242_100074527 195
246 3300009177 Ga0105248_10037449 Ga0105248_100374492 195
247 3300009545 Ga0105237_10059289 Ga0105237_100592894 195
248 3300010375 Ga0105239_10025114 Ga0105239_100251146 195
249 3300013296 Ga0157374_10004235 Ga0157374_100042356 195
250 3300013297 Ga0157378_10018225 Ga0157378_100182253 195
251 3300013306 Ga0163162_10042988 Ga0163162_100429884 195
252 3300014325 Ga0163163_10098889 Ga0163163_100988892 195
253 3300014968 Ga0157379_10096304 Ga0157379_100963042 195
254 3300014969 Ga0157376_10297088 Ga0157376_102970882 195
255 3300025898 Ga0207692_10062106 Ga0207692_100621062 195
256 3300025903 Ga0207680_10019582 Ga0207680_100195822 195
257 3300025905 Ga0207685_10057621 Ga0207685_100576211 195
258 3300025906 Ga0207699_10019985 Ga0207699_100199852 195
259 3300025914 Ga0207671_10528168 Ga0207671_105281682 195
260 3300025915 Ga0207693_10003470 Ga0207693_100034706 195
261 3300025916 Ga0207663_10029268 Ga0207663_100292682 195
262 3300025928 Ga0207700_10010282 Ga0207700_100102824 195
263 3300025929 Ga0207664_10137571 Ga0207664_101375712 195
264 3300025931 Ga0207644_10040757 Ga0207644_100407572 195
265 3300025938 Ga0207704_10006319 Ga0207704_100063192 195
266 3300025939 Ga0207665_10103157 Ga0207665_101031572 195
267 3300025941 Ga0207711_10218530 Ga0207711_102185302 195
268 3300025960 Ga0207651_10539969 Ga0207651_105399692 195
269 3300025986 Ga0207658_10133104 Ga0207658_101331042 195
270 3300026023 Ga0207677_10172390 Ga0207677_101723902 195
271 3300026035 Ga0207703_10153953 Ga0207703_101539532 195
272 3300026078 Ga0207702_10168801 Ga0207702_101688012 195
273 3300026088 Ga0207641_10155847 Ga0207641_101558472 195
274 3300026089 Ga0207648_10054165 Ga0207648_100541652 195
275 3300026095 Ga0207676_10057171 Ga0207676_100571713 195
276 3300026121 Ga0207683_10005129 Ga0207683_1000512913 195
277 3300028381 Ga0268264_10087115 Ga0268264_100871152 195
278 3300035116 Ga0373945_0043753 Ga0373945_0043753_658_1254 195
279 3300035119 Ga0373956_0225224 Ga0373956_0225224_116_712 195
280 3300035170 Ga0373943_0027338 Ga0373943_0027338_1801_2397 195
281 3300035171 Ga0373946_0039609 Ga0373946_0039609_864_1460 195
282 3300035172 Ga0373955_0083623 Ga0373955_0083623_738_1334 195
283 3300035695 Ga0373927_0019863 Ga0373927_0019863_3262_3858 195
284 3300035725 Ga0373947_0096605 Ga0373947_0096605_253_849 195
285 3300036401 Ga0373937_0063084 Ga0373937_0063084_2612_3208 195
286 3300037068 Ga0373925_0119420 Ga0373925_0119420_1216_1812 195
287 3300039437 Ga0436365_1338189 Ga0436365_1338189_101_691 195
288 3300046472 Ga0495580_0003185 Ga0495580_0003185_2065_2661 195
289 3300046472 Ga0495580_0172968 Ga0495580_0172968_283_879 195
290 3300046516 Ga0495628_0057204 Ga0495628_0057204_1121_1717 195
291 3300046517 Ga0495630_0072304 Ga0495630_0072304_551_1147 195
292 3300046535 Ga0495586_0129488 Ga0495586_0129488_391_987 195
293 3300046543 Ga0495645_0181220 Ga0495645_0181220_670_1266 195
294 3300046642 Ga0495634_0293825 Ga0495634_0293825_72_668 195
295 3300046681 Ga0495647_0126272 Ga0495647_0126272_99_695 195
296 3300046683 Ga0495658_0079599 Ga0495658_0079599_845_1441 195
297 3300046690 Ga0495624_0305940 Ga0495624_0305940_64_660 195
298 3300047319 Ga0495674_0105299 Ga0495674_0105299_673_1269 195
299 3300047322 Ga0495680_0338544 Ga0495680_0338544_215_811 195
300 3300048903 Ga0496100_0062048 Ga0496100_0062048_492_1088 195
301 3300048904 Ga0496101_0016954 Ga0496101_0016954_3632_4228 195
302 3300048905 Ga0496102_0009171 Ga0496102_0009171_5746_6342 195
303 3300048906 Ga0496103_0052221 Ga0496103_0052221_415_1011 195
304 3300048907 Ga0496104_0153842 Ga0496104_0153842_496_1092 195
305 3300048908 Ga0496105_0148357 Ga0496105_0148357_374_970 195
306 3300048909 Ga0496106_0007946 Ga0496106_0007946_3053_3649 195
307 3300048910 Ga0496107_0079291 Ga0496107_0079291_1008_1604 195
308 3300048911 Ga0496108_0008197 Ga0496108_0008197_986_1582 195
309 3300048912 Ga0496109_0029076 Ga0496109_0029076_2004_2600 195
310 3300048913 Ga0496110_0107308 Ga0496110_0107308_1721_2317 195
311 3300048914 Ga0496111_0000810 Ga0496111_0000810_2518_3114 195
312 3300048915 Ga0496112_0033730 Ga0496112_0033730_922_1518 195
313 3300048916 Ga0496113_0076939 Ga0496113_0076939_891_1487 195
314 3300048917 Ga0496114_0147574 Ga0496114_0147574_1053_1649 195
315 3300048918 Ga0496115_0037648 Ga0496115_0037648_3128_3724 195
316 3300053085 Ga0495619_0389184 Ga0495619_0389184_199_795 195
317 3300009545 Ga0105237_10071121 Ga0105237_100711213 196
318 3300053178 Ga0500637_0059240 Ga0500637_0059240_281_883 196
319 3300021361 Ga0213872_10111046 Ga0213872_101110462 197
320 3300039447 Ga0436361_1047185 Ga0436361_1047185_879_1553 197
321 3300045836 Ga0466958_0028366 Ga0466958_0028366_1632_2345 197
322 3300007265 Ga0099794_10029540 Ga0099794_100295402 198
323 3300007788 Ga0099795_10038906 Ga0099795_100389062 198
324 3300044656 Ga0466969_0000684 Ga0466969_0000684_36_749 198
325 3300044684 Ga0466966_0001828 Ga0466966_0001828_10292_11005 198
326 3300044693 Ga0466961_0000614 Ga0466961_0000614_18735_19448 198
327 3300044706 Ga0466964_0000095 Ga0466964_0000095_13063_13776 198
328 3300044719 Ga0466971_0003951 Ga0466971_0003951_1471_2184 198
329 3300044765 Ga0466970_0020292 Ga0466970_0020292_369_1082 198
330 3300061719 Ga0466962_0000111 Ga0466962_0000111_28224_28937 198
331 3300005329 Ga0070683_100003293 Ga0070683_1000032937 199
332 3300005458 Ga0070681_10206642 Ga0070681_102066422 199
333 3300005563 Ga0068855_100000430 Ga0068855_10000043033 199
334 3300009093 Ga0105240_10021690 Ga0105240_100216904 199
335 3300009545 Ga0105237_10007569 Ga0105237_100075694 199
336 3300025912 Ga0207707_10265105 Ga0207707_102651052 199
337 3300025913 Ga0207695_10012860 Ga0207695_100128607 199
338 3300025944 Ga0207661_10095298 Ga0207661_100952982 199
339 3300044765 Ga0466970_0401912 Ga0466970_0401912_34_666 199
340 3300045049 Ga0466959_0007718 Ga0466959_0007718_2222_2854 199
341 3300045836 Ga0466958_0398262 Ga0466958_0398262_45_677 199
342 3300046681 Ga0495647_0042515 Ga0495647_0042515_737_1426 199
343 3300046683 Ga0495658_0008333 Ga0495658_0008333_414_1103 199
344 3300031903 Ga0307407_10356036 Ga0307407_103560362 200
345 3300031995 Ga0307409_101145149 Ga0307409_1011451492 200
346 3300039453 Ga0436362_1277379 Ga0436362_1277379_194_817 200
347 3300005530 Ga0070679_100001720 Ga0070679_1000017206 202
348 3300005530 Ga0070679_100252584 Ga0070679_1002525842 202
349 3300025912 Ga0207707_10187897 Ga0207707_101878972 202
350 3300031995 Ga0307409_100039376 Ga0307409_1000393765 202
351 3300041453 Ga0451797_1206887 Ga0451797_1206887_36_671 203
352 3300005563 Ga0068855_100044104 Ga0068855_1000441042 204
353 3300009093 Ga0105240_10040582 Ga0105240_100405822 204
354 3300009545 Ga0105237_10586216 Ga0105237_105862162 204
355 3300009551 Ga0105238_10416397 Ga0105238_104163972 204
356 3300009551 Ga0105238_10421831 Ga0105238_104218312 204
357 3300013105 Ga0157369_10063138 Ga0157369_100631382 204
358 3300025912 Ga0207707_10035001 Ga0207707_100350013 204
359 3300025913 Ga0207695_10017655 Ga0207695_100176553 204
360 3300025914 Ga0207671_10390523 Ga0207671_103905232 204
361 3300025917 Ga0207660_10010562 Ga0207660_100105625 204
362 3300025924 Ga0207694_10095602 Ga0207694_100956022 204
363 3300025924 Ga0207694_10374751 Ga0207694_103747512 204
364 3300025949 Ga0207667_10103672 Ga0207667_101036722 204
365 3300026078 Ga0207702_10631137 Ga0207702_106311371 204
366 3300031247 Ga0265340_10043220 Ga0265340_100432202 204
367 3300044656 Ga0466969_0013465 Ga0466969_0013465_15_653 204
368 3300044683 Ga0466965_0072025 Ga0466965_0072025_1087_1707 204
369 3300005436 Ga0070713_100192289 Ga0070713_1001922892 205
370 3300005530 Ga0070679_100645925 Ga0070679_1006459251 205
371 3300005548 Ga0070665_100001206 Ga0070665_10000120615 205
372 3300005842 Ga0068858_100371314 Ga0068858_1003713142 205
373 3300009093 Ga0105240_10132598 Ga0105240_101325982 205
374 3300009093 Ga0105240_10155844 Ga0105240_101558442 205
375 3300014325 Ga0163163_10170415 Ga0163163_101704152 205
376 3300025913 Ga0207695_10125113 Ga0207695_101251132 205
377 3300025928 Ga0207700_10049162 Ga0207700_100491623 205
378 3300028379 Ga0268266_10000938 Ga0268266_1000093817 205
379 3300028573 Ga0265334_10008041 Ga0265334_100080413 205
380 3300048929 Ga0496126_0001774 Ga0496126_0001774_13117_13755 205
381 3300025913 Ga0207695_10110248 Ga0207695_101102482 206
382 3300028800 Ga0265338_10343473 Ga0265338_103434731 206
383 3300031595 Ga0265313_10026139 Ga0265313_100261392 206
384 3300031616 Ga0307508_10245082 Ga0307508_102450822 206
385 3300009093 Ga0105240_10028854 Ga0105240_100288544 207
386 3300010375 Ga0105239_10259052 Ga0105239_102590522 207
387 3300025913 Ga0207695_10161072 Ga0207695_101610722 207
388 3300046472 Ga0495580_0520504 Ga0495580_0520504_33_722 207
389 3300046475 Ga0495639_0023259 Ga0495639_0023259_1244_1933 207
390 3300005439 Ga0070711_100257644 Ga0070711_1002576442 208
391 3300006163 Ga0070715_10061214 Ga0070715_100612142 208
392 3300006173 Ga0070716_100011523 Ga0070716_1000115233 208
393 3300006175 Ga0070712_100032697 Ga0070712_1000326972 208
394 3300021377 Ga0213874_10053720 Ga0213874_100537202 208
395 3300021377 Ga0213874_10069458 Ga0213874_100694582 208
396 3300025916 Ga0207663_10071005 Ga0207663_100710052 208
397 3300025931 Ga0207644_10602885 Ga0207644_106028852 208
398 3300031247 Ga0265340_10035104 Ga0265340_100351042 208
399 3300039437 Ga0436365_0981884 Ga0436365_0981884_1478_2131 208
400 3300039450 Ga0436363_1033365 Ga0436363_1033365_787_1440 208
401 3300048907 Ga0496104_0345594 Ga0496104_0345594_67_735 208
402 3300048909 Ga0496106_0449786 Ga0496106_0449786_118_786 208
403 3300005367 Ga0070667_100336653 Ga0070667_1003366532 209
404 3300005548 Ga0070665_100249416 Ga0070665_1002494162 209
405 3300005842 Ga0068858_100304891 Ga0068858_1003048912 209
406 3300009545 Ga0105237_10331235 Ga0105237_103312352 209
407 3300014968 Ga0157379_10018255 Ga0157379_100182556 209
408 3300021441 Ga0213871_10062904 Ga0213871_100629042 209
409 3300025914 Ga0207671_10135856 Ga0207671_101358562 209
410 3300025949 Ga0207667_10001582 Ga0207667_1000158212 209
411 3300028379 Ga0268266_10196693 Ga0268266_101966932 209
412 3300031247 Ga0265340_10193320 Ga0265340_101933202 209
413 3300039438 Ga0436360_0578160 Ga0436360_0578160_6410_7087 209
414 3300047443 Ga0495687_118435 Ga0495687_118435_168_797 209
415 3300005530 Ga0070679_100197625 Ga0070679_1001976251 210
416 3300025921 Ga0207652_10018298 Ga0207652_100182984 210
417 3300039453 Ga0436362_0021549 Ga0436362_0021549_265_939 210
418 3300049583 Ga0501067_0147069 Ga0501067_0147069_618_1268 211
419 3300050514 nmdc:mga08x19_181679_c1 nmdc:mga08x19_181679_c1_208_885 211
420 3300005344 Ga0070661_100240481 Ga0070661_1002404812 213
421 3300005434 Ga0070709_10006956 Ga0070709_100069562 213
422 3300005435 Ga0070714_100007187 Ga0070714_1000071876 213
423 3300005436 Ga0070713_100101260 Ga0070713_1001012602 213
424 3300005455 Ga0070663_100500728 Ga0070663_1005007281 213
425 3300005548 Ga0070665_100035528 Ga0070665_1000355285 213
426 3300005614 Ga0068856_100208500 Ga0068856_1002085002 213
427 3300005844 Ga0068862_100087841 Ga0068862_1000878412 213
428 3300006028 Ga0070717_10198236 Ga0070717_101982362 213
429 3300009093 Ga0105240_10031390 Ga0105240_100313908 213
430 3300009551 Ga0105238_10417492 Ga0105238_104174922 213
431 3300009553 Ga0105249_10010397 Ga0105249_100103977 213
432 3300025916 Ga0207663_10268686 Ga0207663_102686862 213
433 3300025928 Ga0207700_10330715 Ga0207700_103307152 213
434 3300025929 Ga0207664_10052313 Ga0207664_100523132 213
435 3300025961 Ga0207712_10092926 Ga0207712_100929262 213
436 3300028379 Ga0268266_10002660 Ga0268266_100026602 213
437 3300028380 Ga0268265_10008201 Ga0268265_100082012 213
438 3300048904 Ga0496101_0614928 Ga0496101_0614928_13_684 213
439 3300048907 Ga0496104_0034341 Ga0496104_0034341_202_873 213
440 3300048909 Ga0496106_0715968 Ga0496106_0715968_33_725 213
441 3300048929 Ga0496126_0585245 Ga0496126_0585245_18_692 213
442 3300005335 Ga0070666_10009264 Ga0070666_100092643 214
443 3300005355 Ga0070671_100000556 Ga0070671_10000055616 214
444 3300005367 Ga0070667_100045902 Ga0070667_1000459022 214
445 3300005544 Ga0070686_100042370 Ga0070686_1000423702 214
446 3300005548 Ga0070665_100057979 Ga0070665_1000579794 214
447 3300005617 Ga0068859_100000406 Ga0068859_10000040637 214
448 3300005719 Ga0068861_100043462 Ga0068861_1000434623 214
449 3300005841 Ga0068863_100013032 Ga0068863_1000130322 214
450 3300005842 Ga0068858_100000330 Ga0068858_1000003307 214
451 3300005843 Ga0068860_100041273 Ga0068860_1000412732 214
452 3300006931 Ga0097620_100000406 Ga0097620_1000004062 214
453 3300009092 Ga0105250_10021891 Ga0105250_100218913 214
454 3300009101 Ga0105247_10000121 Ga0105247_1000012159 214
455 3300009177 Ga0105248_10015452 Ga0105248_100154522 214
456 3300009553 Ga0105249_10005346 Ga0105249_100053466 214
457 3300013306 Ga0163162_10559184 Ga0163162_105591842 214
458 3300014968 Ga0157379_10018378 Ga0157379_100183784 214
459 3300025900 Ga0207710_10000156 Ga0207710_100001567 214
460 3300025903 Ga0207680_10105811 Ga0207680_101058112 214
461 3300025931 Ga0207644_10001074 Ga0207644_100010747 214
462 3300025941 Ga0207711_10020470 Ga0207711_100204702 214
463 3300025986 Ga0207658_10004873 Ga0207658_100048736 214
464 3300026035 Ga0207703_10000934 Ga0207703_100009346 214
465 3300026035 Ga0207703_10497357 Ga0207703_104973572 214
466 3300026088 Ga0207641_10150471 Ga0207641_101504712 214
467 3300026118 Ga0207675_100115965 Ga0207675_1001159652 214
468 3300028379 Ga0268266_10134031 Ga0268266_101340312 214
469 3300035113 Ga0373936_0076094 Ga0373936_0076094_681_1325 214
470 3300048905 Ga0496102_0019614 Ga0496102_0019614_3757_4401 214
471 3300048909 Ga0496106_0391070 Ga0496106_0391070_196_840 214
472 3300048911 Ga0496108_0067260 Ga0496108_0067260_1037_1681 214
473 3300048915 Ga0496112_0020539 Ga0496112_0020539_2914_3558 214
474 3300048924 Ga0496121_0000547 Ga0496121_0000547_3637_4281 214
475 3300048928 Ga0496125_0002321 Ga0496125_0002321_6492_7136 214
476 3300003320 rootH2_10085634 rootH2_100856342 215
477 3300003322 rootL2_10184575 rootL2_101845752 215
478 3300003323 rootH1_10176202 rootH1_101762022 215
479 3300005355 Ga0070671_100156719 Ga0070671_1001567192 215
480 3300005367 Ga0070667_100056977 Ga0070667_1000569772 215
481 3300005455 Ga0070663_100098183 Ga0070663_1000981831 215
482 3300005457 Ga0070662_100559275 Ga0070662_1005592752 215
483 3300005458 Ga0070681_10444084 Ga0070681_104440842 215
484 3300005548 Ga0070665_100186702 Ga0070665_1001867022 215
485 3300005564 Ga0070664_101121887 Ga0070664_1011218871 215
486 3300005614 Ga0068856_100188281 Ga0068856_1001882812 215
487 3300005616 Ga0068852_100469505 Ga0068852_1004695052 215
488 3300005617 Ga0068859_100018574 Ga0068859_1000185748 215
489 3300005843 Ga0068860_100006077 Ga0068860_10000607712 215
490 3300006358 Ga0068871_100353334 Ga0068871_1003533342 215
491 3300006931 Ga0097620_100018574 Ga0097620_1000185742 215
492 3300009101 Ga0105247_10017369 Ga0105247_100173692 215
493 3300009177 Ga0105248_10104018 Ga0105248_101040182 215
494 3300009553 Ga0105249_10190707 Ga0105249_101907072 215
495 3300011119 Ga0105246_10030856 Ga0105246_100308564 215
496 3300013296 Ga0157374_10113725 Ga0157374_101137252 215
497 3300013307 Ga0157372_10210981 Ga0157372_102109812 215
498 3300013308 Ga0157375_10156116 Ga0157375_101561161 215
499 3300014325 Ga0163163_10095289 Ga0163163_100952892 215
500 3300025900 Ga0207710_10013173 Ga0207710_100131732 215
501 3300025903 Ga0207680_10037509 Ga0207680_100375092 215
502 3300025911 Ga0207654_10612632 Ga0207654_106126321 215
503 3300025961 Ga0207712_10339821 Ga0207712_103398212 215
504 3300026035 Ga0207703_10000366 Ga0207703_100003662 215
505 3300026067 Ga0207678_10158512 Ga0207678_101585122 215
506 3300026088 Ga0207641_10000196 Ga0207641_1000019621 215
507 3300026095 Ga0207676_10150039 Ga0207676_101500392 215
508 3300028379 Ga0268266_10081289 Ga0268266_100812892 215
509 3300028381 Ga0268264_10000182 Ga0268264_10000182118 215
510 3300030521 Ga0307511_10000008 Ga0307511_1000000816 215
511 3300031507 Ga0307509_10000162 Ga0307509_1000016257 215
512 3300031616 Ga0307508_10302614 Ga0307508_103026142 215
513 3300033180 Ga0307510_10000003 Ga0307510_1000000318 215
514 3300033180 Ga0307510_10000959 Ga0307510_1000095923 215
515 3300046507 Ga0495606_0078058 Ga0495606_0078058_210_905 215
516 3300046507 Ga0495606_0134806 Ga0495606_0134806_19_729 215
517 3300046519 Ga0495632_0030263 Ga0495632_0030263_1265_1936 215
518 3300047443 Ga0495687_056788 Ga0495687_056788_863_1534 215
519 3300048905 Ga0496102_0135186 Ga0496102_0135186_1473_2183 215
520 3300048912 Ga0496109_0495577 Ga0496109_0495577_223_894 215
521 3300048919 Ga0496116_0273968 Ga0496116_0273968_90_800 215
522 3300048920 Ga0496117_0000095 Ga0496117_0000095_61520_62230 215
523 3300048921 Ga0496118_0000003 Ga0496118_0000003_21997_22707 215
524 3300048921 Ga0496118_0081800 Ga0496118_0081800_392_1063 215
525 3300048922 Ga0496119_0003983 Ga0496119_0003983_4974_5693 215
526 3300048922 Ga0496119_0012799 Ga0496119_0012799_5034_5744 215
527 3300048923 Ga0496120_0000842 Ga0496120_0000842_16103_16822 215
528 3300048924 Ga0496121_0251154 Ga0496121_0251154_133_843 215
529 3300048928 Ga0496125_0000112 Ga0496125_0000112_121442_122113 215
530 3300048928 Ga0496125_0006226 Ga0496125_0006226_2566_3276 215
531 3300053123 Ga0500614_123138 Ga0500614_123138_70_741 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01464

SLT

Transglycosylase SLT domain

102

199

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o1j-assembly1.cif.gz_A lytic transglycosylase in action 0.6449 71 210
3w6e-assembly3.cif.gz_C crystal structure of catalytic domain of chitinase from ralstonia sp. a-471 (e162q) 0.6252 74 200
6h5f-assembly1.cif.gz_A ltga disordered helix 0.6106 71 207
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.6039 150 197
4j36-assembly1.cif.gz_A cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.5777 149 197
ID Description Score Start End Superfamily
1slyA03 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7067 86 210 1.10.530.10
1slyA03 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.5286 86 210 1.10.530.10
af_P0AEZ7_97_250_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.5216 84 210 1.10.530.10
3fi7A01 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.4535 58 204 1.10.530.10
3fi7A01 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.4452 58 204 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A2W4MDE8-F1-model_v4 Transglycosylase SLT domain-containing protein 0.9158 37 199
AF-A0A534B9S3-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9011 37 207
AF-A0A829YMD2-F1-model_v4 Transglycosylase SLT domain-containing protein 0.8751 26 198
AF-A0A534HEK6-F1-model_v4 Lytic transglycosylase domain-containing protein 0.8691 67 208
AF-A0A7V1D5D2-F1-model_v4 Lytic transglycosylase domain-containing protein 0.8667 57 197

Feature Viewer

pLDDT pTM Quality
68.67 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map