F460144

General Info

Members Datasets Scaffolds Average Seq Length
531 306 528 166

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10871581|Ga0207709_108715811
Length 199
Sequence MAEPFLSEIRIMSFVFAPKGWALCNGQLLPINQNQALFSLLGTTFGGDGRVNFALPDNRGRVPIHVGSGHTLGERGGEQAHTLSIAELPQHVHVLSGTDNASVNTPANNSVLGKSAPQPAYGGPTGLVRQVDRHPTIKVLALSFLILIGVALIVEGAHFEIPKGYLYFAMAFSVVVEMINIRLRRLLDRRKHPDENAGG

Samples

Sample ID Description Type Environment
1 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
6 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
168 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
169 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
190 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
191 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
216 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
217 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
220 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
243 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
244 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
249 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
250 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
251 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
252 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
253 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
254 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
255 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.45
Metatranscriptomes 9.98
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0.38
Rhizoplane 2.07
Rhizosphere 91.34
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1a_Contig_146 2124908026 Bacteria 986
2 SwRhRL3b_contig_650789 2162886006 Bacteria 814
3 MRS1b_contig_3936707 2162886011 Unclassified 1172
4 rootH1_10276648 3300003323 Bacteria 3524
5 Ga0065714_10002185 3300005288 Bacteria 199213
6 Ga0065714_10100667 3300005288 Bacteria 1659
7 Ga0065714_10239774 3300005288 Viruses 797
8 Ga0065704_10108146 3300005289 Bacteria 2035
9 Ga0065712_10016338 3300005290 Bacteria 2784
10 Ga0065712_10067734 3300005290 Bacteria 110577
11 Ga0065712_10069481 3300005290 Bacteria 7202
12 Ga0065712_10090625 3300005290 Bacteria 2408
13 Ga0065712_10123424 3300005290 Bacteria 1638
14 Ga0065712_10411832 3300005290 Bacteria 720
15 Ga0065712_10447132 3300005290 Bacteria 673
16 Ga0065715_10003195 3300005293 Bacteria 9867
17 Ga0065715_10089642 3300005293 Bacteria 9108
18 Ga0065715_10117657 3300005293 Bacteria 2340
19 Ga0065715_10155088 3300005293 Bacteria 1660
20 Ga0065715_10330366 3300005293 Bacteria 985
21 Ga0065707_10104343 3300005295 Bacteria 2700
22 Ga0065707_10247949 3300005295 Bacteria 1134
23 Ga0065707_10386472 3300005295 Bacteria 870
24 Ga0070658_10028381 3300005327 Bacteria 4491
25 Ga0070676_10009244 3300005328 Bacteria 5327
26 Ga0070683_100082585 3300005329 Bacteria 3009
27 Ga0070690_100096855 3300005330 Bacteria 1950
28 Ga0070670_100040328 3300005331 Bacteria 4015
29 Ga0068869_100098134 3300005334 Bacteria 2213
30 Ga0070666_10024395 3300005335 Bacteria 3938
31 Ga0070680_100024813 3300005336 Bacteria 4792
32 Ga0070680_100065153 3300005336 Bacteria 2986
33 Ga0070680_100400861 3300005336 Bacteria 1169
34 Ga0070682_101005799 3300005337 Bacteria 692
35 Ga0070682_101409476 3300005337 Bacteria 596
36 Ga0070660_100166718 3300005339 Bacteria 1777
37 Ga0070689_100004561 3300005340 Bacteria 9380
38 Ga0070689_100696239 3300005340 Bacteria 887
39 Ga0070687_100071084 3300005343 Unclassified 1869
40 Ga0070687_100228588 3300005343 Viruses 1144
41 Ga0070661_100164699 3300005344 Bacteria 1681
42 Ga0070661_100412066 3300005344 Bacteria 1070
43 Ga0070692_10024409 3300005345 Bacteria 2971
44 Ga0070669_100031760 3300005353 Bacteria 3814
45 Ga0070669_100965698 3300005353 Bacteria 730
46 Ga0070675_100331981 3300005354 Bacteria 1345
47 Ga0070671_101381393 3300005355 Bacteria 622
48 Ga0070673_100021792 3300005364 Bacteria 4654
49 Ga0070688_100249604 3300005365 Bacteria 1263
50 Ga0070667_100014321 3300005367 Bacteria 6554
51 Ga0070667_100057474 3300005367 Bacteria 3288
52 Ga0070701_10042363 3300005438 Bacteria 2323
53 Ga0070705_100000033 3300005440 Bacteria 68216
54 Ga0070705_100156895 3300005440 Bacteria 1517
55 Ga0070705_100761275 3300005440 Bacteria 767
56 Ga0070700_100001026 3300005441 Bacteria 13798
57 Ga0070700_100752887 3300005441 Bacteria 780
58 Ga0070694_100148372 3300005444 Bacteria 1710
59 Ga0070708_100429241 3300005445 Bacteria 1246
60 Ga0070708_100946285 3300005445 Bacteria 808
61 Ga0070663_100507783 3300005455 Bacteria 1002
62 Ga0070678_100269162 3300005456 Bacteria 1436
63 Ga0070662_100086598 3300005457 Bacteria 2343
64 Ga0070681_10383241 3300005458 Bacteria 1317
65 Ga0068867_101652894 3300005459 Unclassified 600
66 Ga0070699_100008853 3300005518 Bacteria 8716
67 Ga0070699_100144356 3300005518 Bacteria 2103
68 Ga0070679_100122652 3300005530 Bacteria 2582
69 Ga0070684_100007385 3300005535 Bacteria 8544
70 Ga0070697_100224016 3300005536 Bacteria 1603
71 Ga0068853_100059812 3300005539 Bacteria 3292
72 Ga0068853_100502288 3300005539 Bacteria 1145
73 Ga0068853_100687326 3300005539 Bacteria 975
74 Ga0070672_101027865 3300005543 Bacteria 731
75 Ga0070686_100451969 3300005544 Bacteria 988
76 Ga0070695_100589073 3300005545 Bacteria 872
77 Ga0070695_100657646 3300005545 Bacteria 828
78 Ga0070693_100001821 3300005547 Bacteria 9731
79 Ga0070665_100000179 3300005548 Bacteria 112608
80 Ga0070704_100056839 3300005549 Bacteria 2780
81 Ga0068855_101144714 3300005563 Bacteria 811
82 Ga0070664_100039012 3300005564 Bacteria 4000
83 Ga0070664_100140599 3300005564 Bacteria 2126
84 Ga0068857_100021714 3300005577 Bacteria 5648
85 Ga0068857_100092164 3300005577 Bacteria 2713
86 Ga0068854_100116804 3300005578 Bacteria 2020
87 Ga0068854_100311304 3300005578 Bacteria 1277
88 Ga0070702_100541303 3300005615 Bacteria 862
89 Ga0070702_100957626 3300005615 Bacteria 674
90 Ga0068852_100093549 3300005616 Bacteria 2695
91 Ga0068852_100210627 3300005616 Bacteria 1844
92 Ga0068859_100024145 3300005617 Bacteria 6100
93 Ga0068859_100103525 3300005617 Bacteria 2905
94 Ga0068859_100994750 3300005617 Bacteria 921
95 Ga0068859_102404944 3300005617 Bacteria 580
96 Ga0068864_100060116 3300005618 Bacteria 3290
97 Ga0068864_100362595 3300005618 Bacteria 1370
98 Ga0068851_10024362 3300005834 Bacteria 2962
99 Ga0068870_10021098 3300005840 Bacteria 3182
100 Ga0068870_10798400 3300005840 Bacteria 659
101 Ga0068870_11049059 3300005840 Viruses 584
102 Ga0068863_101492096 3300005841 Unclassified 684
103 Ga0068858_100016768 3300005842 Bacteria 6879
104 Ga0068858_100059763 3300005842 Bacteria 3523
105 Ga0068858_100125763 3300005842 Bacteria 2401
106 Ga0068858_100340487 3300005842 Bacteria 1435
107 Ga0068858_101597237 3300005842 Unclassified 644
108 Ga0068860_100037539 3300005843 Bacteria 4638
109 Ga0068860_100059880 3300005843 Bacteria 3619
110 Ga0068860_100069039 3300005843 Bacteria 3358
111 Ga0068860_100623305 3300005843 Bacteria 1085
112 Ga0068862_100006996 3300005844 Bacteria 9365
113 Ga0081538_10049220 3300005981 Bacteria 2558
114 Ga0081539_10053872 3300005985 Bacteria 2249
115 Ga0075365_10022649 3300006038 Bacteria 3940
116 Ga0075365_10034113 3300006038 Bacteria 3285
117 Ga0075365_10697418 3300006038 Bacteria 717
118 Ga0075363_100048850 3300006048 Bacteria 2251
119 Ga0075363_100138484 3300006048 Bacteria 1369
120 Ga0075364_10015888 3300006051 Bacteria 4673
121 Ga0075364_10088908 3300006051 Bacteria 2048
122 Ga0070716_100291333 3300006173 Bacteria 1131
123 Ga0075367_10003744 3300006178 Bacteria 7320
124 Ga0075367_10815190 3300006178 Bacteria 595
125 Ga0097621_100411609 3300006237 Bacteria 1212
126 Ga0075370_10006444 3300006353 Bacteria 5904
127 Ga0075370_10560728 3300006353 Bacteria 691
128 Ga0075428_100055948 3300006844 Bacteria 4322
129 Ga0075428_100144434 3300006844 Bacteria 2586
130 Ga0075428_100316599 3300006844 Bacteria 1677
131 Ga0075430_100095047 3300006846 Bacteria 2491
132 Ga0075430_100155616 3300006846 Bacteria 1903
133 Ga0075431_100195262 3300006847 Bacteria 2072
134 Ga0075431_100333914 3300006847 Bacteria 1526
135 Ga0075433_10040420 3300006852 Bacteria 4037
136 Ga0075433_10068170 3300006852 Bacteria 3123
137 Ga0075433_10249529 3300006852 Bacteria 1575
138 Ga0075433_10592096 3300006852 Bacteria 974
139 Ga0075433_10645829 3300006852 Viruses 928
140 Ga0075434_100134297 3300006871 Bacteria 2494
141 Ga0075434_100665995 3300006871 Bacteria 1059
142 Ga0075434_100899200 3300006871 Bacteria 900
143 Ga0075429_100024991 3300006880 Bacteria 5186
144 Ga0075429_100095944 3300006880 Bacteria 2586
145 Ga0068865_100130514 3300006881 Bacteria 1882
146 Ga0068865_100487985 3300006881 Bacteria 1025
147 Ga0097620_100024143 3300006931 Bacteria 6100
148 Ga0097620_100103523 3300006931 Bacteria 2905
149 Ga0097620_100994588 3300006931 Bacteria 921
150 Ga0097620_102404899 3300006931 Bacteria 580
151 Ga0105240_10014904 3300009093 Bacteria 10589
152 Ga0105240_10136075 3300009093 Bacteria 2942
153 Ga0105240_10474545 3300009093 Bacteria 1395
154 Ga0105240_11904852 3300009093 Bacteria 619
155 Ga0111539_10033293 3300009094 Bacteria 6257
156 Ga0111539_10060846 3300009094 Bacteria 4475
157 Ga0111539_10071593 3300009094 Bacteria 4090
158 Ga0111539_10436007 3300009094 Bacteria 1526
159 Ga0111539_12764582 3300009094 Bacteria 569
160 Ga0105245_10115983 3300009098 Bacteria 2497
161 Ga0105247_10004407 3300009101 Bacteria 8985
162 Ga0105247_10018366 3300009101 Bacteria 4196
163 Ga0105247_10021665 3300009101 Bacteria 3867
164 Ga0105247_10997783 3300009101 Bacteria 654
165 Ga0114129_10147944 3300009147 Bacteria 3216
166 Ga0114129_10200216 3300009147 Bacteria 2705
167 Ga0114129_10269750 3300009147 Bacteria 2277
168 Ga0114129_11599846 3300009147 Bacteria 798
169 Ga0105243_10000199 3300009148 Bacteria 70022
170 Ga0105243_10368309 3300009148 Unclassified 1325
171 Ga0105243_10674275 3300009148 Bacteria 1005
172 Ga0105241_10012655 3300009174 Bacteria 6191
173 Ga0105242_10000105 3300009176 Bacteria 60065
174 Ga0105242_10001700 3300009176 Bacteria 17415
175 Ga0105242_10219117 3300009176 Bacteria 1700
176 Ga0105248_10008640 3300009177 Bacteria 11188
177 Ga0105248_10015792 3300009177 Bacteria 8322
178 Ga0105248_10046365 3300009177 Bacteria 4871
179 Ga0105248_10055045 3300009177 Bacteria 4462
180 Ga0105248_10582781 3300009177 Bacteria 1262
181 Ga0105237_10143445 3300009545 Bacteria 2383
182 Ga0105237_10195599 3300009545 Bacteria 2022
183 Ga0105237_10236756 3300009545 Bacteria 1827
184 Ga0105238_10032774 3300009551 Bacteria 5287
185 Ga0105238_10043005 3300009551 Bacteria 4572
186 Ga0105238_10077418 3300009551 Bacteria 3317
187 Ga0105238_10083955 3300009551 Bacteria 3174
188 Ga0105249_10308074 3300009553 Bacteria 1591
189 Ga0105249_10764513 3300009553 Bacteria 1029
190 Ga0105249_10992031 3300009553 Bacteria 908
191 Ga0105239_10030365 3300010375 Bacteria 5942
192 Ga0105239_10049441 3300010375 Bacteria 4611
193 Ga0105239_10070561 3300010375 Bacteria 3838
194 Ga0105239_10196727 3300010375 Bacteria 2258
195 Ga0105239_10339837 3300010375 Bacteria 1694
196 Ga0105239_10977716 3300010375 Bacteria 973
197 Ga0105246_10091418 3300011119 Bacteria 2194
198 Ga0105246_10202672 3300011119 Bacteria 1543
199 Ga0105246_10272364 3300011119 Bacteria 1354
200 Ga0157373_10003863 3300013100 Bacteria 11320
201 Ga0157373_10007782 3300013100 Bacteria 7967
202 Ga0157373_10584551 3300013100 Bacteria 812
203 Ga0157370_10144125 3300013104 Bacteria 2219
204 Ga0157370_10208733 3300013104 Bacteria 1810
205 Ga0157369_10023529 3300013105 Bacteria 6861
206 Ga0157374_10544366 3300013296 Bacteria 1168
207 Ga0157378_10081313 3300013297 Bacteria 2928
208 Ga0163162_10131057 3300013306 Bacteria 2616
209 Ga0163162_10325400 3300013306 Bacteria 1670
210 Ga0163162_10487052 3300013306 Bacteria 1364
211 Ga0163162_11838934 3300013306 Bacteria 693
212 Ga0157372_10072927 3300013307 Bacteria 3869
213 Ga0157375_10025205 3300013308 Bacteria 5521
214 Ga0157375_11712218 3300013308 Bacteria 744
215 Ga0163163_10021718 3300014325 Bacteria 6063
216 Ga0163163_10428262 3300014325 Bacteria 1382
217 Ga0157380_10533537 3300014326 Bacteria 1147
218 Ga0157377_10283366 3300014745 Viruses 1087
219 Ga0157379_10048201 3300014968 Bacteria 3803
220 Ga0157379_10107042 3300014968 Bacteria 2510
221 Ga0157379_10232138 3300014968 Bacteria 1672
222 Ga0157379_10256369 3300014968 Bacteria 1589
223 Ga0157379_10830756 3300014968 Bacteria 873
224 Ga0163161_10108358 3300017792 Bacteria 2074
225 Ga0213873_10000004 3300021358 Bacteria 774374
226 Ga0213876_10000007 3300021384 Bacteria 670340
227 Ga0213876_10000620 3300021384 Bacteria 26119
228 Ga0213875_10446114 3300021388 Bacteria 619
229 Ga0209148_1000111 3300025254 Bacteria 198095
230 Ga0209455_1000201 3300025272 Bacteria 86804
231 Ga0207710_10004482 3300025900 Bacteria 6086
232 Ga0207710_10016777 3300025900 Bacteria 3100
233 Ga0207710_10062205 3300025900 Viruses 1696
234 Ga0207710_10116558 3300025900 Bacteria 1272
235 Ga0207680_10156441 3300025903 Bacteria 1524
236 Ga0207647_10096611 3300025904 Bacteria 1758
237 Ga0207645_10053795 3300025907 Bacteria 2572
238 Ga0207643_10011131 3300025908 Bacteria 4857
239 Ga0207705_10127716 3300025909 Bacteria 1890
240 Ga0207654_10011244 3300025911 Bacteria 4562
241 Ga0207654_10044055 3300025911 Bacteria 2532
242 Ga0207707_10133881 3300025912 Bacteria 2167
243 Ga0207707_10147173 3300025912 Bacteria 2059
244 Ga0207695_10045760 3300025913 Bacteria 4643
245 Ga0207695_10219796 3300025913 Bacteria 1807
246 Ga0207695_10406815 3300025913 Unclassified 1245
247 Ga0207695_11371240 3300025913 Bacteria 587
248 Ga0207671_10040072 3300025914 Bacteria 3468
249 Ga0207671_10155180 3300025914 Bacteria 1770
250 Ga0207660_10023034 3300025917 Bacteria 4203
251 Ga0207660_10681530 3300025917 Bacteria 838
252 Ga0207662_10047362 3300025918 Viruses 2546
253 Ga0207662_10059619 3300025918 Bacteria 2288
254 Ga0207657_10010088 3300025919 Bacteria 9444
255 Ga0207649_10236192 3300025920 Bacteria 1310
256 Ga0207649_10866037 3300025920 Bacteria 707
257 Ga0207652_10260222 3300025921 Bacteria 1565
258 Ga0207681_10006643 3300025923 Bacteria 7102
259 Ga0207694_10005564 3300025924 Bacteria 9658
260 Ga0207694_10098316 3300025924 Bacteria 2317
261 Ga0207694_10132881 3300025924 Bacteria 1996
262 Ga0207650_10045011 3300025925 Bacteria 3246
263 Ga0207650_10244212 3300025925 Bacteria 1452
264 Ga0207650_10807856 3300025925 Viruses 795
265 Ga0207659_10266158 3300025926 Bacteria 1397
266 Ga0207687_10076778 3300025927 Bacteria 2400
267 Ga0207687_11257785 3300025927 Bacteria 636
268 Ga0207644_10253875 3300025931 Bacteria 1404
269 Ga0207706_10081254 3300025933 Bacteria 2848
270 Ga0207686_10000064 3300025934 Bacteria 95481
271 Ga0207686_10001331 3300025934 Bacteria 14069
272 Ga0207709_10000150 3300025935 Bacteria 95086
273 Ga0207709_10554514 3300025935 Bacteria 904
274 Ga0207709_10871581 3300025935 Bacteria 730
275 Ga0207670_10626618 3300025936 Bacteria 885
276 Ga0207704_10172092 3300025938 Bacteria 1555
277 Ga0207704_10295877 3300025938 Bacteria 1238
278 Ga0207665_10332868 3300025939 Bacteria 1142
279 Ga0207711_10005433 3300025941 Bacteria 10778
280 Ga0207711_10007485 3300025941 Bacteria 9132
281 Ga0207711_10025400 3300025941 Bacteria 4971
282 Ga0207711_10055203 3300025941 Bacteria 3411
283 Ga0207711_10236136 3300025941 Bacteria 1675
284 Ga0207711_10312244 3300025941 Bacteria 1451
285 Ga0207689_10188618 3300025942 Bacteria 1701
286 Ga0207689_10581299 3300025942 Bacteria 942
287 Ga0207689_10764104 3300025942 Bacteria 816
288 Ga0207661_10120760 3300025944 Bacteria 2230
289 Ga0207661_10920371 3300025944 Bacteria 805
290 Ga0207679_10042462 3300025945 Bacteria 3268
291 Ga0207679_10052072 3300025945 Bacteria 3001
292 Ga0207679_10313722 3300025945 Bacteria 1356
293 Ga0207679_11151091 3300025945 Bacteria 712
294 Ga0207667_10037455 3300025949 Bacteria 5183
295 Ga0207651_10037058 3300025960 Bacteria 3191
296 Ga0207651_10835717 3300025960 Bacteria 818
297 Ga0207712_10250798 3300025961 Bacteria 1430
298 Ga0207712_10576269 3300025961 Bacteria 971
299 Ga0207640_10220455 3300025981 Bacteria 1452
300 Ga0207640_10277330 3300025981 Bacteria 1315
301 Ga0207640_10367710 3300025981 Bacteria 1161
302 Ga0207640_10432663 3300025981 Bacteria 1080
303 Ga0207640_10893317 3300025981 Bacteria 776
304 Ga0207658_10001796 3300025986 Bacteria 16077
305 Ga0207658_10058611 3300025986 Bacteria 2866
306 Ga0207658_10248920 3300025986 Unclassified 1509
307 Ga0207703_10016093 3300026035 Bacteria 5832
308 Ga0207703_10165044 3300026035 Bacteria 1942
309 Ga0207703_10215123 3300026035 Bacteria 1715
310 Ga0207703_10716195 3300026035 Bacteria 952
311 Ga0207639_10154401 3300026041 Bacteria 1926
312 Ga0207639_10458477 3300026041 Bacteria 1158
313 Ga0207678_10506638 3300026067 Bacteria 1052
314 Ga0207708_10001475 3300026075 Bacteria 17580
315 Ga0207708_10042120 3300026075 Bacteria 3481
316 Ga0207708_11252157 3300026075 Bacteria 649
317 Ga0207702_10591176 3300026078 Bacteria 1088
318 Ga0207641_10268618 3300026088 Bacteria 1600
319 Ga0207641_10676812 3300026088 Bacteria 1015
320 Ga0207641_10773373 3300026088 Bacteria 949
321 Ga0207674_10010522 3300026116 Bacteria 10471
322 Ga0207674_10039647 3300026116 Bacteria 4882
323 Ga0207675_100109547 3300026118 Bacteria 2606
324 Ga0207675_100559706 3300026118 Viruses 1143
325 Ga0207683_10260558 3300026121 Bacteria 1583
326 Ga0207698_10127504 3300026142 Bacteria 2167
327 Ga0207428_10046485 3300027907 Bacteria 3491
328 Ga0207428_10236161 3300027907 Bacteria 1367
329 Ga0268266_10000001 3300028379 Bacteria 4040580
330 Ga0268266_10135966 3300028379 Bacteria 2202
331 Ga0268265_10086988 3300028380 Bacteria 2485
332 Ga0268265_10105480 3300028380 Bacteria 2287
333 Ga0268265_10672265 3300028380 Bacteria 997
334 Ga0268264_10006136 3300028381 Bacteria 10149
335 Ga0268264_10018818 3300028381 Bacteria 5648
336 Ga0268264_10044462 3300028381 Bacteria 3684
337 Ga0268264_10127792 3300028381 Bacteria 2249
338 Ga0316176_1020679 3300030732 Bacteria 1079
339 Ga0314311_1060014 3300030733 Bacteria 962
340 Ga0316178_1008711 3300030735 Bacteria 851
341 Ga0307408_100002168 3300031548 Bacteria 14045
342 Ga0307408_100013461 3300031548 Bacteria 5430
343 Ga0307408_100246931 3300031548 Bacteria 1470
344 Ga0307408_100333373 3300031548 Bacteria 1282
345 Ga0307413_10945039 3300031824 Bacteria 735
346 Ga0307410_10095814 3300031852 Bacteria 2117
347 Ga0307410_10490671 3300031852 Bacteria 1009
348 Ga0307410_11385322 3300031852 Bacteria 617
349 Ga0307406_10000010 3300031901 Bacteria 114357
350 Ga0307407_10000463 3300031903 Bacteria 12432
351 Ga0307412_10000046 3300031911 Bacteria 163839
352 Ga0307412_10172188 3300031911 Bacteria 1620
353 Ga0307412_10542792 3300031911 Bacteria 975
354 Ga0307409_100000918 3300031995 Bacteria 13668
355 Ga0307416_100002604 3300032002 Bacteria 10416
356 Ga0307416_100104981 3300032002 Bacteria 2472
357 Ga0307416_100291356 3300032002 Bacteria 1616
358 Ga0307416_100852966 3300032002 Bacteria 1009
359 Ga0307416_101626981 3300032002 Bacteria 751
360 Ga0307411_10102888 3300032005 Bacteria 2025
361 Ga0307411_10146292 3300032005 Bacteria 1749
362 Ga0307415_101767007 3300032126 Bacteria 598
363 Ga0373941_0153321 3300035115 Viruses 847
364 Ga0373942_0009185 3300035207 Bacteria 2310
365 Ga0395905_0384878 3300037471 Bacteria 1297
366 Ga0436364_0443686 3300037853 Bacteria 619
367 Ga0436365_0748815 3300039437 Bacteria 55323
368 Ga0436365_1010975 3300039437 Bacteria 46606
369 Ga0436362_0290430 3300039453 Bacteria 772596
370 Ga0439453_0003316 3300041408 Bacteria 2308
371 Ga0451802_1946418 3300041460 Bacteria 1040
372 Ga0451807_1784760 3300041486 Bacteria 900
373 Ga0450890_000006 3300042127 Bacteria 82518
374 Ga0450891_000537 3300042129 Bacteria 3933
375 Ga0450892_000002 3300042130 Bacteria 27249
376 Ga0439446_0012471 3300042156 Bacteria 2322
377 Ga0450893_0000217 3300042532 Bacteria 7673
378 Ga0450893_0000426 3300042532 Bacteria 5944
379 Ga0451577_0001523 3300042876 Bacteria 30532
380 Ga0451577_0006115 3300042876 Bacteria 12093
381 Ga0453684_0000548 3300044712 Bacteria 142109
382 Ga0453684_0001943 3300044712 Bacteria 53305
383 Ga0453684_0030647 3300044712 Bacteria 7590
384 Ga0453684_0081068 3300044712 Bacteria 4049
385 Ga0453684_0225520 3300044712 Bacteria 2167
386 Ga0453684_0868459 3300044712 Bacteria 968
387 Ga0453684_1002923 3300044712 Bacteria 888
388 Ga0451576_0322975 3300045051 Bacteria 1615
389 Ga0495638_0034323 3300046460 Bacteria 3239
390 Ga0495638_0301060 3300046460 Bacteria 864
391 Ga0495620_0000378 3300046515 Bacteria 30356
392 Ga0495625_0071161 3300046660 Bacteria 2441
393 Ga0495658_0265975 3300046683 Bacteria 1080
394 Ga0495686_0256478 3300047472 Bacteria 980
395 Ga0496102_1040173 3300048905 Bacteria 739
396 Ga0496106_0008702 3300048909 Bacteria 7511
397 Ga0496107_0092270 3300048910 Bacteria 2214
398 Ga0496109_0080162 3300048912 Bacteria 3008
399 Ga0496110_0052660 3300048913 Bacteria 3577
400 Ga0496111_0224109 3300048914 Bacteria 1397
401 Ga0496112_0246555 3300048915 Viruses 1738
402 Ga0496113_0108926 3300048916 Bacteria 2154
403 Ga0496115_0392467 3300048918 Bacteria 1127
404 Ga0501308_004366 3300049128 Bacteria 1360
405 Ga0501310_004317 3300049130 Bacteria 1423
406 Ga0501304_000795 3300049160 Bacteria 1810
407 Ga0501307_013459 3300049162 Viruses 988
408 Ga0501291_000365 3300049514 Bacteria 5551
409 Ga0501292_002158 3300049515 Unclassified 2508
410 Ga0501296_000708 3300049519 Unclassified 3301
411 Ga0501298_001374 3300049521 Bacteria 3573
412 Ga0501300_003609 3300049523 Bacteria 2304
413 Ga0501311_014912 3300049527 Viruses 997
414 Ga0501320_005314 3300049536 Viruses 1169
415 Ga0501321_001740 3300049537 Bacteria 1790
416 Ga0501323_005052 3300049539 Bacteria 1425
417 Ga0501034_0057650 3300049571 Bacteria 3905
418 Ga0501034_0316207 3300049571 Bacteria 1495
419 Ga0501039_0084860 3300049575 Bacteria 2467
420 Ga0501043_0118002 3300049579 Bacteria 2082
421 Ga0501067_0037433 3300049583 Bacteria 2695
422 Ga0501067_0563058 3300049583 Bacteria 638
423 Ga0501068_0015655 3300049584 Bacteria 4360
424 Ga0501068_0203783 3300049584 Bacteria 1255
425 Ga0501069_0009215 3300049585 Bacteria 5207
426 Ga0501070_0034481 3300049586 Bacteria 4231
427 Ga0501070_0175622 3300049586 Bacteria 1764
428 Ga0501071_1048446 3300049587 Bacteria 630
429 Ga0501072_0301172 3300049588 Bacteria 1274
430 Ga0501201_001940 3300049651 Viruses 1911
431 Ga0501216_001073 3300049660 Unclassified 3559
432 Ga0501217_011917 3300049661 Viruses 1929
433 Ga0501233_004273 3300049668 Bacteria 2610
434 Ga0501235_002450 3300049669 Bacteria 4001
435 Ga0501240_008580 3300049673 Viruses 1315
436 Ga0501249_003401 3300049679 Bacteria 3194
437 Ga0501256_008126 3300049685 Viruses 973
438 Ga0501257_013460 3300049686 Bacteria 1875
439 Ga0501257_017957 3300049686 Bacteria 1647
440 Ga0501258_013173 3300049687 Viruses 905
441 Ga0501260_000609 3300049689 Unclassified 2768
442 Ga0501261_005441 3300049690 Bacteria 1601
443 Ga0501225_0005013 3300049705 Bacteria 3911
444 Ga0501080_0148550 3300049742 Bacteria 2167
445 Ga0501080_0314265 3300049742 Bacteria 1419
446 Ga0501083_0317153 3300049744 Bacteria 1014
447 Ga0501264_004974 3300049761 Viruses 1205
448 Ga0501266_035568 3300049763 Bacteria 725
449 Ga0501270_000988 3300049767 Unclassified 2616
450 Ga0501272_008306 3300049769 Viruses 1138
451 Ga0501279_010964 3300049775 Viruses 1222
452 Ga0501280_005003 3300049776 Bacteria 1916
453 Ga0501283_001376 3300049779 Bacteria 3170
454 Ga0501212_041169 3300049851 Unclassified 764
455 nmdc:mga03683_114049_c1 3300050489 Bacteria 1197
456 nmdc:mga03n38_121502_c1 3300050490 Bacteria 1284
457 nmdc:mga00v17_68129_c1 3300050491 Bacteria 2200
458 nmdc:mga00v17_8931_c1 3300050491 Bacteria 5407
459 nmdc:mga0yw44_30110_c1 3300050492 Bacteria 3141
460 nmdc:mga0yw44_3298_c1 3300050492 Bacteria 7135
461 nmdc:mga0yw44_461361_c1 3300050492 Bacteria 861
462 nmdc:mga06z11_8029_c1 3300050494 Bacteria 4376
463 nmdc:mga07m45_6620_c1 3300050496 Bacteria 5872
464 nmdc:mga05p37_1306623_c1 3300050507 Bacteria 739
465 nmdc:mga05p37_200535_c1 3300050507 Bacteria 2417
466 nmdc:mga05p37_234374_c1 3300050507 Bacteria 2210
467 nmdc:mga09592_4728_c1 3300050508 Bacteria 11028
468 nmdc:mga09592_538451_c1 3300050508 Bacteria 1003
469 nmdc:mga09592_70405_c1 3300050508 Bacteria 2968
470 nmdc:mga0qj67_159412_c1 3300050509 Bacteria 1832
471 nmdc:mga06r32_134314_c1 3300050510 Bacteria 2449
472 nmdc:mga06r32_19372_c1 3300050510 Bacteria 6243
473 nmdc:mga08y16_131786_c1 3300050511 Bacteria 2599
474 nmdc:mga08y16_142879_c1 3300050511 Bacteria 2488
475 nmdc:mga08y16_18309_c1 3300050511 Bacteria 7380
476 nmdc:mga0n895_90216_c1 3300050512 Bacteria 3066
477 nmdc:mga0a205_101602_c1 3300050515 Bacteria 2774
478 nmdc:mga0a205_68467_c1 3300050515 Bacteria 3428
479 nmdc:mga0a205_84437_c1 3300050515 Bacteria 3067
480 Ga0500658_0046436 3300053134 Bacteria 1759
481 Ga0500604_0035392 3300053151 Bacteria 1485
482 Ga0500616_0003753 3300053153 Bacteria 11321
483 Ga0587084_000788 3300059477 Bacteria 2718
484 Ga0587084_045996 3300059477 Bacteria 758
485 Ga0587093_022428 3300059478 Bacteria 856
486 Ga0587066_044669 3300059490 Bacteria 849
487 Ga0587070_004038 3300059491 Bacteria 1821
488 Ga0587073_0100067 3300059492 Bacteria 752
489 Ga0587077_020798 3300059493 Bacteria 1157
490 Ga0587080_071696 3300059503 Bacteria 694
491 Ga0587082_038055 3300059504 Bacteria 870
492 Ga0587083_0003545 3300059505 Bacteria 2082
493 Ga0587085_006608 3300059506 Bacteria 1417
494 Ga0587086_031880 3300059507 Bacteria 779
495 Ga0587086_041830 3300059507 Bacteria 712
496 Ga0587088_027312 3300059508 Bacteria 997
497 Ga0587091_052582 3300059511 Bacteria 841
498 Ga0587091_102011 3300059511 Unclassified 674
499 Ga0587091_110524 3300059511 Bacteria 656
500 Ga0587092_012392 3300059512 Bacteria 1202
501 Ga0587094_017026 3300059513 Bacteria 1018
502 Ga0587106_029306 3300059605 Bacteria 873
503 Ga0587125_015939 3300059607 Bacteria 838
504 Ga0587125_029693 3300059607 Unclassified 692
505 Ga0587101_036472 3300059623 Viruses 792
506 Ga0587101_123331 3300059623 Bacteria 538
507 Ga0587109_012662 3300059624 Bacteria 1387
508 Ga0587117_065611 3300059627 Bacteria 633
509 Ga0587062_053140 3300059639 Bacteria 691
510 Ga0587062_065269 3300059639 Bacteria 647
511 Ga0587067_023222 3300059640 Bacteria 1086
512 Ga0587069_037409 3300059642 Bacteria 814
513 Ga0587069_038156 3300059642 Bacteria 809
514 Ga0587072_021851 3300059643 Bacteria 1139
515 Ga0587076_048041 3300059645 Bacteria 822
516 Ga0587076_084636 3300059645 Unclassified 683
517 Ga0587078_007699 3300059646 Bacteria 1196
518 Ga0587079_001936 3300059647 Bacteria 2431
519 Ga0587100_033367 3300059648 Bacteria 555
520 Ga0587102_044485 3300059649 Bacteria 582
521 Ga0587107_024791 3300059652 Bacteria 868
522 Ga0587108_007574 3300059653 Bacteria 865
523 Ga0587110_022011 3300059654 Bacteria 728
524 Ga0587071_002128 3300060344 Bacteria 2632
525 Ga0587071_166826 3300060344 Bacteria 557
526 Ga0587111_0002351 3300060346 Bacteria 2504
527 Ga0587111_0046074 3300060346 Bacteria 947
528 Ga0530510_0095465 3300061734 Bacteria 2172

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059653 Ga0587108_007574 Ga0587108_007574_189_701 152
2 3300025934 Ga0207686_10001331 Ga0207686_100013312 155
3 3300009147 Ga0114129_10147944 Ga0114129_101479444 156
4 3300046460 Ga0495638_0301060 Ga0495638_0301060_43_543 157
5 3300046660 Ga0495625_0071161 Ga0495625_0071161_548_1048 157
6 3300047472 Ga0495686_0256478 Ga0495686_0256478_346_846 157
7 3300053134 Ga0500658_0046436 Ga0500658_0046436_713_1213 157
8 3300053151 Ga0500604_0035392 Ga0500604_0035392_167_667 157
9 3300005290 Ga0065712_10411832 Ga0065712_104118321 159
10 3300005293 Ga0065715_10330366 Ga0065715_103303661 159
11 3300005543 Ga0070672_101027865 Ga0070672_1010278651 159
12 3300009148 Ga0105243_10000199 Ga0105243_1000019931 159
13 3300025945 Ga0207679_11151091 Ga0207679_111510911 159
14 3300005445 Ga0070708_100946285 Ga0070708_1009462852 160
15 3300006871 Ga0075434_100665995 Ga0075434_1006659951 160
16 3300005367 Ga0070667_100014321 Ga0070667_1000143214 161
17 3300005548 Ga0070665_100000179 Ga0070665_10000017935 161
18 3300009176 Ga0105242_10001700 Ga0105242_100017002 161
19 3300025986 Ga0207658_10001796 Ga0207658_1000179616 161
20 3300028379 Ga0268266_10000001 Ga0268266_100000012370 161
21 3300028381 Ga0268264_10006136 Ga0268264_100061369 161
22 3300053153 Ga0500616_0003753 Ga0500616_0003753_5614_6114 161
23 iso_pu_bacteria 2509276022 2509393812 161
24 iso_pu_bacteria 3000135777 3000137595 161
25 3300006038 Ga0075365_10697418 Ga0075365_106974182 162
26 3300009093 Ga0105240_10474545 Ga0105240_104745452 162
27 3300009147 Ga0114129_10269750 Ga0114129_102697503 162
28 3300009551 Ga0105238_10083955 Ga0105238_100839553 162
29 3300010375 Ga0105239_10030365 Ga0105239_100303656 162
30 3300013104 Ga0157370_10208733 Ga0157370_102087332 162
31 3300025911 Ga0207654_10044055 Ga0207654_100440553 162
32 3300025913 Ga0207695_10219796 Ga0207695_102197963 162
33 3300025924 Ga0207694_10098316 Ga0207694_100983162 162
34 3300032002 Ga0307416_100104981 Ga0307416_1001049812 162
35 3300050492 nmdc:mga0yw44_461361_c1 nmdc:mga0yw44_461361_c1_27_527 162
36 3300050507 nmdc:mga05p37_200535_c1 nmdc:mga05p37_200535_c1_1574_2071 162
37 iso_pu_bacteria 2513237351 2514585820 162
38 2162886006 SwRhRL3b_contig_650789 SwRhRL3b_0049.00001650 163
39 3300005288 Ga0065714_10239774 Ga0065714_102397741 163
40 3300005289 Ga0065704_10108146 Ga0065704_101081462 163
41 3300005290 Ga0065712_10090625 Ga0065712_100906252 163
42 3300005290 Ga0065712_10447132 Ga0065712_104471321 163
43 3300005293 Ga0065715_10117657 Ga0065715_101176571 163
44 3300005295 Ga0065707_10104343 Ga0065707_101043431 163
45 3300005295 Ga0065707_10386472 Ga0065707_103864721 163
46 3300005327 Ga0070658_10028381 Ga0070658_100283811 163
47 3300005329 Ga0070683_100082585 Ga0070683_1000825852 163
48 3300005330 Ga0070690_100096855 Ga0070690_1000968552 163
49 3300005335 Ga0070666_10024395 Ga0070666_100243952 163
50 3300005336 Ga0070680_100024813 Ga0070680_1000248132 163
51 3300005336 Ga0070680_100065153 Ga0070680_1000651532 163
52 3300005337 Ga0070682_101409476 Ga0070682_1014094761 163
53 3300005339 Ga0070660_100166718 Ga0070660_1001667181 163
54 3300005343 Ga0070687_100228588 Ga0070687_1002285882 163
55 3300005344 Ga0070661_100164699 Ga0070661_1001646992 163
56 3300005344 Ga0070661_100412066 Ga0070661_1004120661 163
57 3300005353 Ga0070669_100965698 Ga0070669_1009656981 163
58 3300005355 Ga0070671_101381393 Ga0070671_1013813931 163
59 3300005367 Ga0070667_100057474 Ga0070667_1000574743 163
60 3300005441 Ga0070700_100001026 Ga0070700_10000102611 163
61 3300005457 Ga0070662_100086598 Ga0070662_1000865982 163
62 3300005458 Ga0070681_10383241 Ga0070681_103832413 163
63 3300005530 Ga0070679_100122652 Ga0070679_1001226524 163
64 3300005535 Ga0070684_100007385 Ga0070684_1000073854 163
65 3300005539 Ga0068853_100502288 Ga0068853_1005022882 163
66 3300005539 Ga0068853_100687326 Ga0068853_1006873262 163
67 3300005563 Ga0068855_101144714 Ga0068855_1011447141 163
68 3300005564 Ga0070664_100039012 Ga0070664_1000390122 163
69 3300005577 Ga0068857_100021714 Ga0068857_1000217142 163
70 3300005578 Ga0068854_100311304 Ga0068854_1003113042 163
71 3300005615 Ga0070702_100541303 Ga0070702_1005413031 163
72 3300005616 Ga0068852_100093549 Ga0068852_1000935491 163
73 3300005617 Ga0068859_102404944 Ga0068859_1024049441 163
74 3300005834 Ga0068851_10024362 Ga0068851_100243622 163
75 3300005840 Ga0068870_11049059 Ga0068870_110490591 163
76 3300005841 Ga0068863_101492096 Ga0068863_1014920961 163
77 3300005842 Ga0068858_100059763 Ga0068858_1000597632 163
78 3300005842 Ga0068858_100340487 Ga0068858_1003404872 163
79 3300005843 Ga0068860_100037539 Ga0068860_1000375394 163
80 3300005843 Ga0068860_100069039 Ga0068860_1000690392 163
81 3300006038 Ga0075365_10034113 Ga0075365_100341132 163
82 3300006051 Ga0075364_10088908 Ga0075364_100889084 163
83 3300006178 Ga0075367_10815190 Ga0075367_108151901 163
84 3300006237 Ga0097621_100411609 Ga0097621_1004116092 163
85 3300006852 Ga0075433_10068170 Ga0075433_100681704 163
86 3300006881 Ga0068865_100130514 Ga0068865_1001305143 163
87 3300006931 Ga0097620_102404899 Ga0097620_1024048991 163
88 3300009093 Ga0105240_10014904 Ga0105240_100149047 163
89 3300009093 Ga0105240_10136075 Ga0105240_101360752 163
90 3300009093 Ga0105240_11904852 Ga0105240_119048521 163
91 3300009094 Ga0111539_10436007 Ga0111539_104360072 163
92 3300009098 Ga0105245_10115983 Ga0105245_101159833 163
93 3300009101 Ga0105247_10018366 Ga0105247_100183662 163
94 3300009174 Ga0105241_10012655 Ga0105241_100126552 163
95 3300009177 Ga0105248_10015792 Ga0105248_100157923 163
96 3300009177 Ga0105248_10046365 Ga0105248_100463654 163
97 3300009545 Ga0105237_10195599 Ga0105237_101955992 163
98 3300009545 Ga0105237_10236756 Ga0105237_102367562 163
99 3300009551 Ga0105238_10032774 Ga0105238_100327742 163
100 3300009551 Ga0105238_10043005 Ga0105238_100430052 163
101 3300009551 Ga0105238_10077418 Ga0105238_100774183 163
102 3300009553 Ga0105249_10308074 Ga0105249_103080743 163
103 3300010375 Ga0105239_10049441 Ga0105239_100494412 163
104 3300010375 Ga0105239_10070561 Ga0105239_100705612 163
105 3300011119 Ga0105246_10091418 Ga0105246_100914182 163
106 3300013100 Ga0157373_10584551 Ga0157373_105845511 163
107 3300013104 Ga0157370_10144125 Ga0157370_101441252 163
108 3300013105 Ga0157369_10023529 Ga0157369_100235292 163
109 3300013306 Ga0163162_10131057 Ga0163162_101310572 163
110 3300013306 Ga0163162_10487052 Ga0163162_104870522 163
111 3300013307 Ga0157372_10072927 Ga0157372_100729274 163
112 3300014745 Ga0157377_10283366 Ga0157377_102833661 163
113 3300014968 Ga0157379_10107042 Ga0157379_101070421 163
114 3300025900 Ga0207710_10062205 Ga0207710_100622051 163
115 3300025903 Ga0207680_10156441 Ga0207680_101564413 163
116 3300025909 Ga0207705_10127716 Ga0207705_101277161 163
117 3300025911 Ga0207654_10011244 Ga0207654_100112442 163
118 3300025912 Ga0207707_10147173 Ga0207707_101471733 163
119 3300025913 Ga0207695_10045760 Ga0207695_100457602 163
120 3300025913 Ga0207695_10406815 Ga0207695_104068151 163
121 3300025913 Ga0207695_11371240 Ga0207695_113712401 163
122 3300025914 Ga0207671_10040072 Ga0207671_100400722 163
123 3300025917 Ga0207660_10023034 Ga0207660_100230342 163
124 3300025918 Ga0207662_10047362 Ga0207662_100473622 163
125 3300025919 Ga0207657_10010088 Ga0207657_100100882 163
126 3300025920 Ga0207649_10866037 Ga0207649_108660371 163
127 3300025921 Ga0207652_10260222 Ga0207652_102602223 163
128 3300025924 Ga0207694_10132881 Ga0207694_101328812 163
129 3300025927 Ga0207687_10076778 Ga0207687_100767783 163
130 3300025931 Ga0207644_10253875 Ga0207644_102538752 163
131 3300025933 Ga0207706_10081254 Ga0207706_100812542 163
132 3300025938 Ga0207704_10172092 Ga0207704_101720922 163
133 3300025941 Ga0207711_10005433 Ga0207711_100054335 163
134 3300025941 Ga0207711_10312244 Ga0207711_103122442 163
135 3300025942 Ga0207689_10764104 Ga0207689_107641041 163
136 3300025944 Ga0207661_10120760 Ga0207661_101207603 163
137 3300025945 Ga0207679_10042462 Ga0207679_100424623 163
138 3300025945 Ga0207679_10052072 Ga0207679_100520721 163
139 3300025949 Ga0207667_10037455 Ga0207667_100374552 163
140 3300025961 Ga0207712_10250798 Ga0207712_102507981 163
141 3300025981 Ga0207640_10277330 Ga0207640_102773302 163
142 3300025981 Ga0207640_10367710 Ga0207640_103677102 163
143 3300025986 Ga0207658_10058611 Ga0207658_100586112 163
144 3300026035 Ga0207703_10165044 Ga0207703_101650441 163
145 3300026035 Ga0207703_10215123 Ga0207703_102151231 163
146 3300026035 Ga0207703_10716195 Ga0207703_107161952 163
147 3300026041 Ga0207639_10154401 Ga0207639_101544011 163
148 3300026041 Ga0207639_10458477 Ga0207639_104584772 163
149 3300026075 Ga0207708_10001475 Ga0207708_1000147513 163
150 3300026078 Ga0207702_10591176 Ga0207702_105911761 163
151 3300026088 Ga0207641_10676812 Ga0207641_106768122 163
152 3300026116 Ga0207674_10010522 Ga0207674_100105223 163
153 3300026118 Ga0207675_100559706 Ga0207675_1005597062 163
154 3300027907 Ga0207428_10236161 Ga0207428_102361613 163
155 3300028379 Ga0268266_10135966 Ga0268266_101359662 163
156 3300028381 Ga0268264_10044462 Ga0268264_100444622 163
157 3300028381 Ga0268264_10127792 Ga0268264_101277922 163
158 3300031548 Ga0307408_100246931 Ga0307408_1002469311 163
159 3300031852 Ga0307410_10490671 Ga0307410_104906712 163
160 3300032002 Ga0307416_100291356 Ga0307416_1002913563 163
161 3300032002 Ga0307416_100852966 Ga0307416_1008529662 163
162 3300037471 Ga0395905_0384878 Ga0395905_0384878_110_610 163
163 3300046683 Ga0495658_0265975 Ga0495658_0265975_229_735 163
164 3300050491 nmdc:mga00v17_68129_c1 nmdc:mga00v17_68129_c1_485_982 163
165 3300050492 nmdc:mga0yw44_3298_c1 nmdc:mga0yw44_3298_c1_3102_3599 163
166 3300050515 nmdc:mga0a205_68467_c1 nmdc:mga0a205_68467_c1_1204_1704 163
167 3300059607 Ga0587125_029693 Ga0587125_029693_16_516 163
168 3300059624 Ga0587109_012662 Ga0587109_012662_705_1205 163
169 3300059645 Ga0587076_084636 Ga0587076_084636_172_669 163
170 3300003323 rootH1_10276648 rootH1_102766482 164
171 3300005334 Ga0068869_100098134 Ga0068869_1000981343 164
172 3300005336 Ga0070680_100400861 Ga0070680_1004008611 164
173 3300005353 Ga0070669_100031760 Ga0070669_1000317603 164
174 3300005440 Ga0070705_100156895 Ga0070705_1001568952 164
175 3300005578 Ga0068854_100116804 Ga0068854_1001168041 164
176 3300005616 Ga0068852_100210627 Ga0068852_1002106272 164
177 3300005840 Ga0068870_10021098 Ga0068870_100210984 164
178 3300005843 Ga0068860_100623305 Ga0068860_1006233052 164
179 3300005844 Ga0068862_100006996 Ga0068862_1000069965 164
180 3300006048 Ga0075363_100048850 Ga0075363_1000488501 164
181 3300006173 Ga0070716_100291333 Ga0070716_1002913332 164
182 3300006178 Ga0075367_10003744 Ga0075367_100037442 164
183 3300006353 Ga0075370_10560728 Ga0075370_105607282 164
184 3300006844 Ga0075428_100055948 Ga0075428_1000559485 164
185 3300006846 Ga0075430_100095047 Ga0075430_1000950473 164
186 3300006847 Ga0075431_100333914 Ga0075431_1003339141 164
187 3300006880 Ga0075429_100024991 Ga0075429_1000249913 164
188 3300009147 Ga0114129_10200216 Ga0114129_102002163 164
189 3300009148 Ga0105243_10368309 Ga0105243_103683091 164
190 3300009177 Ga0105248_10582781 Ga0105248_105827812 164
191 3300009553 Ga0105249_10764513 Ga0105249_107645132 164
192 3300011119 Ga0105246_10202672 Ga0105246_102026722 164
193 3300013100 Ga0157373_10003863 Ga0157373_100038635 164
194 3300025254 Ga0209148_1000111 Ga0209148_1000111107 164
195 3300025272 Ga0209455_1000201 Ga0209455_100020123 164
196 3300025904 Ga0207647_10096611 Ga0207647_100966111 164
197 3300025908 Ga0207643_10011131 Ga0207643_100111316 164
198 3300025917 Ga0207660_10681530 Ga0207660_106815301 164
199 3300025923 Ga0207681_10006643 Ga0207681_100066435 164
200 3300025925 Ga0207650_10244212 Ga0207650_102442122 164
201 3300025939 Ga0207665_10332868 Ga0207665_103328681 164
202 3300025941 Ga0207711_10236136 Ga0207711_102361362 164
203 3300025942 Ga0207689_10188618 Ga0207689_101886182 164
204 3300025981 Ga0207640_10220455 Ga0207640_102204553 164
205 3300026075 Ga0207708_10042120 Ga0207708_100421206 164
206 3300026118 Ga0207675_100109547 Ga0207675_1001095474 164
207 3300026142 Ga0207698_10127504 Ga0207698_101275042 164
208 3300028380 Ga0268265_10086988 Ga0268265_100869882 164
209 3300030732 Ga0316176_1020679 Ga0316176_10206792 164
210 3300030733 Ga0314311_1060014 Ga0314311_10600141 164
211 3300030735 Ga0316178_1008711 Ga0316178_10087111 164
212 3300031548 Ga0307408_100002168 Ga0307408_10000216812 164
213 3300031852 Ga0307410_10095814 Ga0307410_100958141 164
214 3300031901 Ga0307406_10000010 Ga0307406_1000001067 164
215 3300031911 Ga0307412_10542792 Ga0307412_105427921 164
216 3300031995 Ga0307409_100000918 Ga0307409_1000009184 164
217 3300048909 Ga0496106_0008702 Ga0496106_0008702_6203_6703 164
218 3300048910 Ga0496107_0092270 Ga0496107_0092270_832_1332 164
219 3300050494 nmdc:mga06z11_8029_c1 nmdc:mga06z11_8029_c1_2113_2616 164
220 3300050507 nmdc:mga05p37_234374_c1 nmdc:mga05p37_234374_c1_901_1401 164
221 3300050508 nmdc:mga09592_70405_c1 nmdc:mga09592_70405_c1_2060_2560 164
222 3300050510 nmdc:mga06r32_134314_c1 nmdc:mga06r32_134314_c1_1227_1727 164
223 3300059477 Ga0587084_045996 Ga0587084_045996_80_580 164
224 3300059507 Ga0587086_031880 Ga0587086_031880_183_683 164
225 3300059511 Ga0587091_052582 Ga0587091_052582_176_676 164
226 3300059642 Ga0587069_038156 Ga0587069_038156_176_676 164
227 3300005288 Ga0065714_10100667 Ga0065714_101006673 165
228 3300005290 Ga0065712_10069481 Ga0065712_100694814 165
229 3300005293 Ga0065715_10003195 Ga0065715_100031955 165
230 3300005295 Ga0065707_10247949 Ga0065707_102479492 165
231 3300005337 Ga0070682_101005799 Ga0070682_1010057991 165
232 3300005343 Ga0070687_100071084 Ga0070687_1000710841 165
233 3300005345 Ga0070692_10024409 Ga0070692_100244094 165
234 3300005364 Ga0070673_100021792 Ga0070673_1000217924 165
235 3300005438 Ga0070701_10042363 Ga0070701_100423634 165
236 3300005440 Ga0070705_100000033 Ga0070705_1000000338 165
237 3300005441 Ga0070700_100752887 Ga0070700_1007528871 165
238 3300005455 Ga0070663_100507783 Ga0070663_1005077831 165
239 3300005456 Ga0070678_100269162 Ga0070678_1002691621 165
240 3300005459 Ga0068867_101652894 Ga0068867_1016528941 165
241 3300005518 Ga0070699_100144356 Ga0070699_1001443563 165
242 3300005539 Ga0068853_100059812 Ga0068853_1000598124 165
243 3300005544 Ga0070686_100451969 Ga0070686_1004519692 165
244 3300005545 Ga0070695_100589073 Ga0070695_1005890731 165
245 3300005547 Ga0070693_100001821 Ga0070693_1000018215 165
246 3300005564 Ga0070664_100140599 Ga0070664_1001405994 165
247 3300005577 Ga0068857_100092164 Ga0068857_1000921643 165
248 3300005617 Ga0068859_100024145 Ga0068859_1000241454 165
249 3300005617 Ga0068859_100994750 Ga0068859_1009947502 165
250 3300005618 Ga0068864_100060116 Ga0068864_1000601164 165
251 3300005618 Ga0068864_100362595 Ga0068864_1003625951 165
252 3300005842 Ga0068858_100016768 Ga0068858_1000167684 165
253 3300005842 Ga0068858_100125763 Ga0068858_1001257633 165
254 3300005843 Ga0068860_100059880 Ga0068860_1000598803 165
255 3300006844 Ga0075428_100144434 Ga0075428_1001444344 165
256 3300006846 Ga0075430_100155616 Ga0075430_1001556161 165
257 3300006847 Ga0075431_100195262 Ga0075431_1001952621 165
258 3300006852 Ga0075433_10249529 Ga0075433_102495292 165
259 3300006852 Ga0075433_10645829 Ga0075433_106458292 165
260 3300006871 Ga0075434_100134297 Ga0075434_1001342971 165
261 3300006880 Ga0075429_100095944 Ga0075429_1000959444 165
262 3300006881 Ga0068865_100487985 Ga0068865_1004879851 165
263 3300006931 Ga0097620_100024143 Ga0097620_1000241434 165
264 3300006931 Ga0097620_100994588 Ga0097620_1009945882 165
265 3300009094 Ga0111539_10071593 Ga0111539_100715936 165
266 3300009094 Ga0111539_12764582 Ga0111539_127645821 165
267 3300009101 Ga0105247_10004407 Ga0105247_100044074 165
268 3300009101 Ga0105247_10997783 Ga0105247_109977831 165
269 3300009147 Ga0114129_11599846 Ga0114129_115998462 165
270 3300009148 Ga0105243_10674275 Ga0105243_106742752 165
271 3300009176 Ga0105242_10219117 Ga0105242_102191173 165
272 3300009177 Ga0105248_10008640 Ga0105248_100086405 165
273 3300009177 Ga0105248_10055045 Ga0105248_100550455 165
274 3300009545 Ga0105237_10143445 Ga0105237_101434453 165
275 3300010375 Ga0105239_10196727 Ga0105239_101967274 165
276 3300010375 Ga0105239_10339837 Ga0105239_103398372 165
277 3300011119 Ga0105246_10272364 Ga0105246_102723642 165
278 3300013100 Ga0157373_10007782 Ga0157373_100077824 165
279 3300013296 Ga0157374_10544366 Ga0157374_105443662 165
280 3300013297 Ga0157378_10081313 Ga0157378_100813131 165
281 3300013306 Ga0163162_10325400 Ga0163162_103254002 165
282 3300013306 Ga0163162_11838934 Ga0163162_118389341 165
283 3300014325 Ga0163163_10021718 Ga0163163_100217185 165
284 3300014326 Ga0157380_10533537 Ga0157380_105335372 165
285 3300014968 Ga0157379_10048201 Ga0157379_100482015 165
286 3300014968 Ga0157379_10232138 Ga0157379_102321382 165
287 3300014968 Ga0157379_10256369 Ga0157379_102563692 165
288 3300017792 Ga0163161_10108358 Ga0163161_101083583 165
289 3300025900 Ga0207710_10004482 Ga0207710_100044823 165
290 3300025900 Ga0207710_10116558 Ga0207710_101165581 165
291 3300025912 Ga0207707_10133881 Ga0207707_101338811 165
292 3300025914 Ga0207671_10155180 Ga0207671_101551802 165
293 3300025918 Ga0207662_10059619 Ga0207662_100596193 165
294 3300025920 Ga0207649_10236192 Ga0207649_102361921 165
295 3300025924 Ga0207694_10005564 Ga0207694_100055645 165
296 3300025927 Ga0207687_11257785 Ga0207687_112577852 165
297 3300025935 Ga0207709_10554514 Ga0207709_105545142 165
298 3300025938 Ga0207704_10295877 Ga0207704_102958772 165
299 3300025941 Ga0207711_10007485 Ga0207711_100074855 165
300 3300025941 Ga0207711_10025400 Ga0207711_100254005 165
301 3300025944 Ga0207661_10920371 Ga0207661_109203711 165
302 3300025945 Ga0207679_10313722 Ga0207679_103137221 165
303 3300025960 Ga0207651_10037058 Ga0207651_100370585 165
304 3300025960 Ga0207651_10835717 Ga0207651_108357171 165
305 3300025961 Ga0207712_10576269 Ga0207712_105762692 165
306 3300025981 Ga0207640_10432663 Ga0207640_104326631 165
307 3300025981 Ga0207640_10893317 Ga0207640_108933171 165
308 3300026035 Ga0207703_10016093 Ga0207703_100160935 165
309 3300026067 Ga0207678_10506638 Ga0207678_105066382 165
310 3300026075 Ga0207708_11252157 Ga0207708_112521572 165
311 3300026088 Ga0207641_10268618 Ga0207641_102686181 165
312 3300026088 Ga0207641_10773373 Ga0207641_107733732 165
313 3300026116 Ga0207674_10039647 Ga0207674_100396474 165
314 3300026121 Ga0207683_10260558 Ga0207683_102605583 165
315 3300028380 Ga0268265_10105480 Ga0268265_101054802 165
316 3300028380 Ga0268265_10672265 Ga0268265_106722652 165
317 3300028381 Ga0268264_10018818 Ga0268264_100188184 165
318 3300031548 Ga0307408_100013461 Ga0307408_1000134615 165
319 3300031548 Ga0307408_100333373 Ga0307408_1003333732 165
320 3300031852 Ga0307410_11385322 Ga0307410_113853221 165
321 3300031911 Ga0307412_10172188 Ga0307412_101721882 165
322 3300032005 Ga0307411_10102888 Ga0307411_101028882 165
323 3300032126 Ga0307415_101767007 Ga0307415_1017670071 165
324 3300041460 Ga0451802_1946418 Ga0451802_1946418_149_649 165
325 3300044712 Ga0453684_0000548 Ga0453684_0000548_63874_64377 165
326 3300044712 Ga0453684_0081068 Ga0453684_0081068_2316_2831 165
327 3300044712 Ga0453684_0225520 Ga0453684_0225520_1529_2029 165
328 3300044712 Ga0453684_0868459 Ga0453684_0868459_325_825 165
329 3300046460 Ga0495638_0034323 Ga0495638_0034323_1857_2357 165
330 3300046515 Ga0495620_0000378 Ga0495620_0000378_22826_23332 165
331 3300048905 Ga0496102_1040173 Ga0496102_1040173_74_574 165
332 3300048912 Ga0496109_0080162 Ga0496109_0080162_1176_1676 165
333 3300048913 Ga0496110_0052660 Ga0496110_0052660_109_609 165
334 3300048914 Ga0496111_0224109 Ga0496111_0224109_219_719 165
335 3300048915 Ga0496112_0246555 Ga0496112_0246555_207_707 165
336 3300048918 Ga0496115_0392467 Ga0496115_0392467_151_651 165
337 3300049128 Ga0501308_004366 Ga0501308_004366_110_613 165
338 3300049130 Ga0501310_004317 Ga0501310_004317_768_1268 165
339 3300049160 Ga0501304_000795 Ga0501304_000795_1149_1649 165
340 3300049162 Ga0501307_013459 Ga0501307_013459_335_835 165
341 3300049514 Ga0501291_000365 Ga0501291_000365_2577_3077 165
342 3300049515 Ga0501292_002158 Ga0501292_002158_394_894 165
343 3300049519 Ga0501296_000708 Ga0501296_000708_2332_2832 165
344 3300049521 Ga0501298_001374 Ga0501298_001374_2723_3223 165
345 3300049523 Ga0501300_003609 Ga0501300_003609_1570_2070 165
346 3300049527 Ga0501311_014912 Ga0501311_014912_161_661 165
347 3300049536 Ga0501320_005314 Ga0501320_005314_160_660 165
348 3300049537 Ga0501321_001740 Ga0501321_001740_156_656 165
349 3300049539 Ga0501323_005052 Ga0501323_005052_150_650 165
350 3300049651 Ga0501201_001940 Ga0501201_001940_859_1359 165
351 3300049660 Ga0501216_001073 Ga0501216_001073_2333_2833 165
352 3300049661 Ga0501217_011917 Ga0501217_011917_1044_1544 165
353 3300049668 Ga0501233_004273 Ga0501233_004273_1817_2317 165
354 3300049669 Ga0501235_002450 Ga0501235_002450_1902_2402 165
355 3300049673 Ga0501240_008580 Ga0501240_008580_414_914 165
356 3300049679 Ga0501249_003401 Ga0501249_003401_76_576 165
357 3300049685 Ga0501256_008126 Ga0501256_008126_37_537 165
358 3300049686 Ga0501257_013460 Ga0501257_013460_958_1461 165
359 3300049686 Ga0501257_017957 Ga0501257_017957_195_698 165
360 3300049687 Ga0501258_013173 Ga0501258_013173_374_874 165
361 3300049689 Ga0501260_000609 Ga0501260_000609_1692_2192 165
362 3300049690 Ga0501261_005441 Ga0501261_005441_61_561 165
363 3300049705 Ga0501225_0005013 Ga0501225_0005013_3214_3714 165
364 3300049761 Ga0501264_004974 Ga0501264_004974_473_973 165
365 3300049763 Ga0501266_035568 Ga0501266_035568_184_687 165
366 3300049767 Ga0501270_000988 Ga0501270_000988_476_976 165
367 3300049769 Ga0501272_008306 Ga0501272_008306_414_914 165
368 3300049775 Ga0501279_010964 Ga0501279_010964_365_865 165
369 3300049776 Ga0501280_005003 Ga0501280_005003_1370_1873 165
370 3300049779 Ga0501283_001376 Ga0501283_001376_1488_1988 165
371 3300049851 Ga0501212_041169 Ga0501212_041169_108_608 165
372 3300050507 nmdc:mga05p37_1306623_c1 nmdc:mga05p37_1306623_c1_23_523 165
373 3300050508 nmdc:mga09592_4728_c1 nmdc:mga09592_4728_c1_2026_2526 165
374 3300050509 nmdc:mga0qj67_159412_c1 nmdc:mga0qj67_159412_c1_68_568 165
375 3300050510 nmdc:mga06r32_19372_c1 nmdc:mga06r32_19372_c1_68_568 165
376 3300050511 nmdc:mga08y16_142879_c1 nmdc:mga08y16_142879_c1_1099_1599 165
377 3300050512 nmdc:mga0n895_90216_c1 nmdc:mga0n895_90216_c1_1900_2400 165
378 3300050515 nmdc:mga0a205_101602_c1 nmdc:mga0a205_101602_c1_1222_1722 165
379 3300059490 Ga0587066_044669 Ga0587066_044669_179_679 165
380 3300059511 Ga0587091_102011 Ga0587091_102011_17_526 165
381 3300059639 Ga0587062_053140 Ga0587062_053140_164_673 165
382 3300060344 Ga0587071_166826 Ga0587071_166826_16_516 165
383 3300060346 Ga0587111_0046074 Ga0587111_0046074_33_533 165
384 3300005440 Ga0070705_100761275 Ga0070705_1007612751 166
385 3300005615 Ga0070702_100957626 Ga0070702_1009576261 166
386 3300005840 Ga0068870_10798400 Ga0068870_107984001 166
387 3300005981 Ga0081538_10049220 Ga0081538_100492202 166
388 3300005985 Ga0081539_10053872 Ga0081539_100538722 166
389 3300006852 Ga0075433_10592096 Ga0075433_105920962 166
390 3300006871 Ga0075434_100899200 Ga0075434_1008992001 166
391 3300013308 Ga0157375_10025205 Ga0157375_100252053 166
392 3300014325 Ga0163163_10428262 Ga0163163_104282623 166
393 3300025935 Ga0207709_10871581 Ga0207709_108715811 166
394 3300025936 Ga0207670_10626618 Ga0207670_106266182 166
395 3300031824 Ga0307413_10945039 Ga0307413_109450392 166
396 3300032002 Ga0307416_101626981 Ga0307416_1016269812 166
397 3300041486 Ga0451807_1784760 Ga0451807_1784760_98_610 166
398 3300042156 Ga0439446_0012471 Ga0439446_0012471_1145_1648 166
399 3300042876 Ga0451577_0006115 Ga0451577_0006115_3250_3753 166
400 3300044712 Ga0453684_0030647 Ga0453684_0030647_5869_6372 166
401 3300049587 Ga0501071_1048446 Ga0501071_1048446_70_573 166
402 3300059477 Ga0587084_000788 Ga0587084_000788_1713_2216 166
403 3300059478 Ga0587093_022428 Ga0587093_022428_291_794 166
404 3300059491 Ga0587070_004038 Ga0587070_004038_973_1476 166
405 3300059492 Ga0587073_0100067 Ga0587073_0100067_23_526 166
406 3300059493 Ga0587077_020798 Ga0587077_020798_175_678 166
407 3300059503 Ga0587080_071696 Ga0587080_071696_165_668 166
408 3300059504 Ga0587082_038055 Ga0587082_038055_328_831 166
409 3300059505 Ga0587083_0003545 Ga0587083_0003545_544_1047 166
410 3300059506 Ga0587085_006608 Ga0587085_006608_408_911 166
411 3300059507 Ga0587086_041830 Ga0587086_041830_168_671 166
412 3300059508 Ga0587088_027312 Ga0587088_027312_31_534 166
413 3300059511 Ga0587091_110524 Ga0587091_110524_17_520 166
414 3300059512 Ga0587092_012392 Ga0587092_012392_37_540 166
415 3300059513 Ga0587094_017026 Ga0587094_017026_489_992 166
416 3300059605 Ga0587106_029306 Ga0587106_029306_27_530 166
417 3300059607 Ga0587125_015939 Ga0587125_015939_16_519 166
418 3300059623 Ga0587101_036472 Ga0587101_036472_146_652 166
419 3300059623 Ga0587101_123331 Ga0587101_123331_19_522 166
420 3300059627 Ga0587117_065611 Ga0587117_065611_67_570 166
421 3300059639 Ga0587062_065269 Ga0587062_065269_96_599 166
422 3300059640 Ga0587067_023222 Ga0587067_023222_500_1009 166
423 3300059642 Ga0587069_037409 Ga0587069_037409_19_522 166
424 3300059643 Ga0587072_021851 Ga0587072_021851_597_1100 166
425 3300059645 Ga0587076_048041 Ga0587076_048041_50_553 166
426 3300059646 Ga0587078_007699 Ga0587078_007699_653_1156 166
427 3300059647 Ga0587079_001936 Ga0587079_001936_502_1005 166
428 3300059648 Ga0587100_033367 Ga0587100_033367_13_516 166
429 3300059649 Ga0587102_044485 Ga0587102_044485_31_534 166
430 3300059652 Ga0587107_024791 Ga0587107_024791_31_534 166
431 3300059654 Ga0587110_022011 Ga0587110_022011_176_679 166
432 3300060344 Ga0587071_002128 Ga0587071_002128_686_1189 166
433 3300060346 Ga0587111_0002351 Ga0587111_0002351_1083_1586 166
434 3300061734 Ga0530510_0095465 Ga0530510_0095465_496_999 166
435 2124908026 MRS1a_Contig_146 MRS1a_00008900 167
436 2162886011 MRS1b_contig_3936707 MRS1b_0752.00000090 167
437 3300005288 Ga0065714_10002185 Ga0065714_10002185140 167
438 3300005290 Ga0065712_10016338 Ga0065712_100163381 167
439 3300005290 Ga0065712_10067734 Ga0065712_1006773422 167
440 3300005290 Ga0065712_10123424 Ga0065712_101234242 167
441 3300005293 Ga0065715_10089642 Ga0065715_100896422 167
442 3300005293 Ga0065715_10155088 Ga0065715_101550882 167
443 3300005328 Ga0070676_10009244 Ga0070676_100092442 167
444 3300005331 Ga0070670_100040328 Ga0070670_1000403282 167
445 3300005340 Ga0070689_100004561 Ga0070689_1000045617 167
446 3300005340 Ga0070689_100696239 Ga0070689_1006962392 167
447 3300005354 Ga0070675_100331981 Ga0070675_1003319813 167
448 3300005365 Ga0070688_100249604 Ga0070688_1002496042 167
449 3300005444 Ga0070694_100148372 Ga0070694_1001483721 167
450 3300005445 Ga0070708_100429241 Ga0070708_1004292412 167
451 3300005518 Ga0070699_100008853 Ga0070699_1000088534 167
452 3300005536 Ga0070697_100224016 Ga0070697_1002240161 167
453 3300005545 Ga0070695_100657646 Ga0070695_1006576461 167
454 3300005549 Ga0070704_100056839 Ga0070704_1000568393 167
455 3300005617 Ga0068859_100103525 Ga0068859_1001035251 167
456 3300005842 Ga0068858_101597237 Ga0068858_1015972372 167
457 3300006038 Ga0075365_10022649 Ga0075365_100226492 167
458 3300006048 Ga0075363_100138484 Ga0075363_1001384842 167
459 3300006051 Ga0075364_10015888 Ga0075364_100158882 167
460 3300006353 Ga0075370_10006444 Ga0075370_100064442 167
461 3300006844 Ga0075428_100316599 Ga0075428_1003165992 167
462 3300006852 Ga0075433_10040420 Ga0075433_100404204 167
463 3300006931 Ga0097620_100103523 Ga0097620_1001035231 167
464 3300009094 Ga0111539_10033293 Ga0111539_100332937 167
465 3300009094 Ga0111539_10060846 Ga0111539_100608465 167
466 3300009101 Ga0105247_10021665 Ga0105247_100216652 167
467 3300009176 Ga0105242_10000105 Ga0105242_100001056 167
468 3300009553 Ga0105249_10992031 Ga0105249_109920312 167
469 3300010375 Ga0105239_10977716 Ga0105239_109777161 167
470 3300013308 Ga0157375_11712218 Ga0157375_117122181 167
471 3300014968 Ga0157379_10830756 Ga0157379_108307562 167
472 3300021358 Ga0213873_10000004 Ga0213873_10000004572 167
473 3300021384 Ga0213876_10000007 Ga0213876_10000007572 167
474 3300021384 Ga0213876_10000620 Ga0213876_1000062021 167
475 3300021388 Ga0213875_10446114 Ga0213875_104461141 167
476 3300025900 Ga0207710_10016777 Ga0207710_100167772 167
477 3300025907 Ga0207645_10053795 Ga0207645_100537951 167
478 3300025925 Ga0207650_10045011 Ga0207650_100450114 167
479 3300025925 Ga0207650_10807856 Ga0207650_108078561 167
480 3300025926 Ga0207659_10266158 Ga0207659_102661583 167
481 3300025934 Ga0207686_10000064 Ga0207686_1000006445 167
482 3300025935 Ga0207709_10000150 Ga0207709_1000015045 167
483 3300025941 Ga0207711_10055203 Ga0207711_100552031 167
484 3300025942 Ga0207689_10581299 Ga0207689_105812992 167
485 3300025986 Ga0207658_10248920 Ga0207658_102489202 167
486 3300027907 Ga0207428_10046485 Ga0207428_100464854 167
487 3300031903 Ga0307407_10000463 Ga0307407_100004636 167
488 3300031911 Ga0307412_10000046 Ga0307412_10000046145 167
489 3300032002 Ga0307416_100002604 Ga0307416_1000026044 167
490 3300032005 Ga0307411_10146292 Ga0307411_101462923 167
491 3300035115 Ga0373941_0153321 Ga0373941_0153321_293_796 167
492 3300035207 Ga0373942_0009185 Ga0373942_0009185_1655_2158 167
493 3300037853 Ga0436364_0443686 Ga0436364_0443686_92_607 167
494 3300039437 Ga0436365_0748815 Ga0436365_0748815_49894_50412 167
495 3300039437 Ga0436365_1010975 Ga0436365_1010975_10582_11091 167
496 3300039453 Ga0436362_0290430 Ga0436362_0290430_128432_128941 167
497 3300041408 Ga0439453_0003316 Ga0439453_0003316_1473_1979 167
498 3300042127 Ga0450890_000006 Ga0450890_000006_50189_50695 167
499 3300042129 Ga0450891_000537 Ga0450891_000537_1377_1883 167
500 3300042130 Ga0450892_000002 Ga0450892_000002_8284_8790 167
501 3300042532 Ga0450893_0000217 Ga0450893_0000217_4807_5313 167
502 3300042532 Ga0450893_0000426 Ga0450893_0000426_981_1487 167
503 3300042876 Ga0451577_0001523 Ga0451577_0001523_23145_23648 167
504 3300044712 Ga0453684_0001943 Ga0453684_0001943_6732_7235 167
505 3300044712 Ga0453684_1002923 Ga0453684_1002923_208_714 167
506 3300045051 Ga0451576_0322975 Ga0451576_0322975_70_573 167
507 3300048916 Ga0496113_0108926 Ga0496113_0108926_1509_2015 167
508 3300049571 Ga0501034_0057650 Ga0501034_0057650_971_1477 167
509 3300049571 Ga0501034_0316207 Ga0501034_0316207_444_956 167
510 3300049575 Ga0501039_0084860 Ga0501039_0084860_1012_1518 167
511 3300049579 Ga0501043_0118002 Ga0501043_0118002_645_1151 167
512 3300049583 Ga0501067_0037433 Ga0501067_0037433_690_1196 167
513 3300049583 Ga0501067_0563058 Ga0501067_0563058_104_610 167
514 3300049584 Ga0501068_0015655 Ga0501068_0015655_110_616 167
515 3300049584 Ga0501068_0203783 Ga0501068_0203783_24_530 167
516 3300049585 Ga0501069_0009215 Ga0501069_0009215_2012_2518 167
517 3300049586 Ga0501070_0034481 Ga0501070_0034481_2791_3297 167
518 3300049586 Ga0501070_0175622 Ga0501070_0175622_831_1337 167
519 3300049588 Ga0501072_0301172 Ga0501072_0301172_679_1185 167
520 3300049742 Ga0501080_0148550 Ga0501080_0148550_1035_1541 167
521 3300049742 Ga0501080_0314265 Ga0501080_0314265_817_1329 167
522 3300049744 Ga0501083_0317153 Ga0501083_0317153_140_652 167
523 3300050489 nmdc:mga03683_114049_c1 nmdc:mga03683_114049_c1_134_646 167
524 3300050490 nmdc:mga03n38_121502_c1 nmdc:mga03n38_121502_c1_63_569 167
525 3300050491 nmdc:mga00v17_8931_c1 nmdc:mga00v17_8931_c1_2201_2707 167
526 3300050492 nmdc:mga0yw44_30110_c1 nmdc:mga0yw44_30110_c1_1806_2312 167
527 3300050496 nmdc:mga07m45_6620_c1 nmdc:mga07m45_6620_c1_1808_2314 167
528 3300050508 nmdc:mga09592_538451_c1 nmdc:mga09592_538451_c1_223_729 167
529 3300050511 nmdc:mga08y16_131786_c1 nmdc:mga08y16_131786_c1_608_1114 167
530 3300050511 nmdc:mga08y16_18309_c1 nmdc:mga08y16_18309_c1_1221_1727 167
531 3300050515 nmdc:mga0a205_84437_c1 nmdc:mga0a205_84437_c1_1776_2282 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.98

Feature Viewer

pLDDT pTM Quality
61.89 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map