F460144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 306 | 528 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300025935|Ga0207709_10871581|Ga0207709_108715811 |
| Length | 199 |
| Sequence | MAEPFLSEIRIMSFVFAPKGWALCNGQLLPINQNQALFSLLGTTFGGDGRVNFALPDNRGRVPIHVGSGHTLGERGGEQAHTLSIAELPQHVHVLSGTDNASVNTPANNSVLGKSAPQPAYGGPTGLVRQVDRHPTIKVLALSFLILIGVALIVEGAHFEIPKGYLYFAMAFSVVVEMINIRLRRLLDRRKHPDENAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908026 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 6 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 168 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 169 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 187 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 189 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 190 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 191 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 216 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 217 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 218 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 219 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 220 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 234 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 235 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 236 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 238 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 239 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 241 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 242 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 244 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 249 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 250 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 252 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 253 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 254 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 255 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 256 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 258 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 261 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 271 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 272 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.45 |
| Metatranscriptomes | 9.98 |
| Isolates | 0.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.71 |
| Nodule | 0.38 |
| Rhizoplane | 2.07 |
| Rhizosphere | 91.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1a_Contig_146 | 2124908026 | Bacteria | 986 |
| 2 | SwRhRL3b_contig_650789 | 2162886006 | Bacteria | 814 |
| 3 | MRS1b_contig_3936707 | 2162886011 | Unclassified | 1172 |
| 4 | rootH1_10276648 | 3300003323 | Bacteria | 3524 |
| 5 | Ga0065714_10002185 | 3300005288 | Bacteria | 199213 |
| 6 | Ga0065714_10100667 | 3300005288 | Bacteria | 1659 |
| 7 | Ga0065714_10239774 | 3300005288 | Viruses | 797 |
| 8 | Ga0065704_10108146 | 3300005289 | Bacteria | 2035 |
| 9 | Ga0065712_10016338 | 3300005290 | Bacteria | 2784 |
| 10 | Ga0065712_10067734 | 3300005290 | Bacteria | 110577 |
| 11 | Ga0065712_10069481 | 3300005290 | Bacteria | 7202 |
| 12 | Ga0065712_10090625 | 3300005290 | Bacteria | 2408 |
| 13 | Ga0065712_10123424 | 3300005290 | Bacteria | 1638 |
| 14 | Ga0065712_10411832 | 3300005290 | Bacteria | 720 |
| 15 | Ga0065712_10447132 | 3300005290 | Bacteria | 673 |
| 16 | Ga0065715_10003195 | 3300005293 | Bacteria | 9867 |
| 17 | Ga0065715_10089642 | 3300005293 | Bacteria | 9108 |
| 18 | Ga0065715_10117657 | 3300005293 | Bacteria | 2340 |
| 19 | Ga0065715_10155088 | 3300005293 | Bacteria | 1660 |
| 20 | Ga0065715_10330366 | 3300005293 | Bacteria | 985 |
| 21 | Ga0065707_10104343 | 3300005295 | Bacteria | 2700 |
| 22 | Ga0065707_10247949 | 3300005295 | Bacteria | 1134 |
| 23 | Ga0065707_10386472 | 3300005295 | Bacteria | 870 |
| 24 | Ga0070658_10028381 | 3300005327 | Bacteria | 4491 |
| 25 | Ga0070676_10009244 | 3300005328 | Bacteria | 5327 |
| 26 | Ga0070683_100082585 | 3300005329 | Bacteria | 3009 |
| 27 | Ga0070690_100096855 | 3300005330 | Bacteria | 1950 |
| 28 | Ga0070670_100040328 | 3300005331 | Bacteria | 4015 |
| 29 | Ga0068869_100098134 | 3300005334 | Bacteria | 2213 |
| 30 | Ga0070666_10024395 | 3300005335 | Bacteria | 3938 |
| 31 | Ga0070680_100024813 | 3300005336 | Bacteria | 4792 |
| 32 | Ga0070680_100065153 | 3300005336 | Bacteria | 2986 |
| 33 | Ga0070680_100400861 | 3300005336 | Bacteria | 1169 |
| 34 | Ga0070682_101005799 | 3300005337 | Bacteria | 692 |
| 35 | Ga0070682_101409476 | 3300005337 | Bacteria | 596 |
| 36 | Ga0070660_100166718 | 3300005339 | Bacteria | 1777 |
| 37 | Ga0070689_100004561 | 3300005340 | Bacteria | 9380 |
| 38 | Ga0070689_100696239 | 3300005340 | Bacteria | 887 |
| 39 | Ga0070687_100071084 | 3300005343 | Unclassified | 1869 |
| 40 | Ga0070687_100228588 | 3300005343 | Viruses | 1144 |
| 41 | Ga0070661_100164699 | 3300005344 | Bacteria | 1681 |
| 42 | Ga0070661_100412066 | 3300005344 | Bacteria | 1070 |
| 43 | Ga0070692_10024409 | 3300005345 | Bacteria | 2971 |
| 44 | Ga0070669_100031760 | 3300005353 | Bacteria | 3814 |
| 45 | Ga0070669_100965698 | 3300005353 | Bacteria | 730 |
| 46 | Ga0070675_100331981 | 3300005354 | Bacteria | 1345 |
| 47 | Ga0070671_101381393 | 3300005355 | Bacteria | 622 |
| 48 | Ga0070673_100021792 | 3300005364 | Bacteria | 4654 |
| 49 | Ga0070688_100249604 | 3300005365 | Bacteria | 1263 |
| 50 | Ga0070667_100014321 | 3300005367 | Bacteria | 6554 |
| 51 | Ga0070667_100057474 | 3300005367 | Bacteria | 3288 |
| 52 | Ga0070701_10042363 | 3300005438 | Bacteria | 2323 |
| 53 | Ga0070705_100000033 | 3300005440 | Bacteria | 68216 |
| 54 | Ga0070705_100156895 | 3300005440 | Bacteria | 1517 |
| 55 | Ga0070705_100761275 | 3300005440 | Bacteria | 767 |
| 56 | Ga0070700_100001026 | 3300005441 | Bacteria | 13798 |
| 57 | Ga0070700_100752887 | 3300005441 | Bacteria | 780 |
| 58 | Ga0070694_100148372 | 3300005444 | Bacteria | 1710 |
| 59 | Ga0070708_100429241 | 3300005445 | Bacteria | 1246 |
| 60 | Ga0070708_100946285 | 3300005445 | Bacteria | 808 |
| 61 | Ga0070663_100507783 | 3300005455 | Bacteria | 1002 |
| 62 | Ga0070678_100269162 | 3300005456 | Bacteria | 1436 |
| 63 | Ga0070662_100086598 | 3300005457 | Bacteria | 2343 |
| 64 | Ga0070681_10383241 | 3300005458 | Bacteria | 1317 |
| 65 | Ga0068867_101652894 | 3300005459 | Unclassified | 600 |
| 66 | Ga0070699_100008853 | 3300005518 | Bacteria | 8716 |
| 67 | Ga0070699_100144356 | 3300005518 | Bacteria | 2103 |
| 68 | Ga0070679_100122652 | 3300005530 | Bacteria | 2582 |
| 69 | Ga0070684_100007385 | 3300005535 | Bacteria | 8544 |
| 70 | Ga0070697_100224016 | 3300005536 | Bacteria | 1603 |
| 71 | Ga0068853_100059812 | 3300005539 | Bacteria | 3292 |
| 72 | Ga0068853_100502288 | 3300005539 | Bacteria | 1145 |
| 73 | Ga0068853_100687326 | 3300005539 | Bacteria | 975 |
| 74 | Ga0070672_101027865 | 3300005543 | Bacteria | 731 |
| 75 | Ga0070686_100451969 | 3300005544 | Bacteria | 988 |
| 76 | Ga0070695_100589073 | 3300005545 | Bacteria | 872 |
| 77 | Ga0070695_100657646 | 3300005545 | Bacteria | 828 |
| 78 | Ga0070693_100001821 | 3300005547 | Bacteria | 9731 |
| 79 | Ga0070665_100000179 | 3300005548 | Bacteria | 112608 |
| 80 | Ga0070704_100056839 | 3300005549 | Bacteria | 2780 |
| 81 | Ga0068855_101144714 | 3300005563 | Bacteria | 811 |
| 82 | Ga0070664_100039012 | 3300005564 | Bacteria | 4000 |
| 83 | Ga0070664_100140599 | 3300005564 | Bacteria | 2126 |
| 84 | Ga0068857_100021714 | 3300005577 | Bacteria | 5648 |
| 85 | Ga0068857_100092164 | 3300005577 | Bacteria | 2713 |
| 86 | Ga0068854_100116804 | 3300005578 | Bacteria | 2020 |
| 87 | Ga0068854_100311304 | 3300005578 | Bacteria | 1277 |
| 88 | Ga0070702_100541303 | 3300005615 | Bacteria | 862 |
| 89 | Ga0070702_100957626 | 3300005615 | Bacteria | 674 |
| 90 | Ga0068852_100093549 | 3300005616 | Bacteria | 2695 |
| 91 | Ga0068852_100210627 | 3300005616 | Bacteria | 1844 |
| 92 | Ga0068859_100024145 | 3300005617 | Bacteria | 6100 |
| 93 | Ga0068859_100103525 | 3300005617 | Bacteria | 2905 |
| 94 | Ga0068859_100994750 | 3300005617 | Bacteria | 921 |
| 95 | Ga0068859_102404944 | 3300005617 | Bacteria | 580 |
| 96 | Ga0068864_100060116 | 3300005618 | Bacteria | 3290 |
| 97 | Ga0068864_100362595 | 3300005618 | Bacteria | 1370 |
| 98 | Ga0068851_10024362 | 3300005834 | Bacteria | 2962 |
| 99 | Ga0068870_10021098 | 3300005840 | Bacteria | 3182 |
| 100 | Ga0068870_10798400 | 3300005840 | Bacteria | 659 |
| 101 | Ga0068870_11049059 | 3300005840 | Viruses | 584 |
| 102 | Ga0068863_101492096 | 3300005841 | Unclassified | 684 |
| 103 | Ga0068858_100016768 | 3300005842 | Bacteria | 6879 |
| 104 | Ga0068858_100059763 | 3300005842 | Bacteria | 3523 |
| 105 | Ga0068858_100125763 | 3300005842 | Bacteria | 2401 |
| 106 | Ga0068858_100340487 | 3300005842 | Bacteria | 1435 |
| 107 | Ga0068858_101597237 | 3300005842 | Unclassified | 644 |
| 108 | Ga0068860_100037539 | 3300005843 | Bacteria | 4638 |
| 109 | Ga0068860_100059880 | 3300005843 | Bacteria | 3619 |
| 110 | Ga0068860_100069039 | 3300005843 | Bacteria | 3358 |
| 111 | Ga0068860_100623305 | 3300005843 | Bacteria | 1085 |
| 112 | Ga0068862_100006996 | 3300005844 | Bacteria | 9365 |
| 113 | Ga0081538_10049220 | 3300005981 | Bacteria | 2558 |
| 114 | Ga0081539_10053872 | 3300005985 | Bacteria | 2249 |
| 115 | Ga0075365_10022649 | 3300006038 | Bacteria | 3940 |
| 116 | Ga0075365_10034113 | 3300006038 | Bacteria | 3285 |
| 117 | Ga0075365_10697418 | 3300006038 | Bacteria | 717 |
| 118 | Ga0075363_100048850 | 3300006048 | Bacteria | 2251 |
| 119 | Ga0075363_100138484 | 3300006048 | Bacteria | 1369 |
| 120 | Ga0075364_10015888 | 3300006051 | Bacteria | 4673 |
| 121 | Ga0075364_10088908 | 3300006051 | Bacteria | 2048 |
| 122 | Ga0070716_100291333 | 3300006173 | Bacteria | 1131 |
| 123 | Ga0075367_10003744 | 3300006178 | Bacteria | 7320 |
| 124 | Ga0075367_10815190 | 3300006178 | Bacteria | 595 |
| 125 | Ga0097621_100411609 | 3300006237 | Bacteria | 1212 |
| 126 | Ga0075370_10006444 | 3300006353 | Bacteria | 5904 |
| 127 | Ga0075370_10560728 | 3300006353 | Bacteria | 691 |
| 128 | Ga0075428_100055948 | 3300006844 | Bacteria | 4322 |
| 129 | Ga0075428_100144434 | 3300006844 | Bacteria | 2586 |
| 130 | Ga0075428_100316599 | 3300006844 | Bacteria | 1677 |
| 131 | Ga0075430_100095047 | 3300006846 | Bacteria | 2491 |
| 132 | Ga0075430_100155616 | 3300006846 | Bacteria | 1903 |
| 133 | Ga0075431_100195262 | 3300006847 | Bacteria | 2072 |
| 134 | Ga0075431_100333914 | 3300006847 | Bacteria | 1526 |
| 135 | Ga0075433_10040420 | 3300006852 | Bacteria | 4037 |
| 136 | Ga0075433_10068170 | 3300006852 | Bacteria | 3123 |
| 137 | Ga0075433_10249529 | 3300006852 | Bacteria | 1575 |
| 138 | Ga0075433_10592096 | 3300006852 | Bacteria | 974 |
| 139 | Ga0075433_10645829 | 3300006852 | Viruses | 928 |
| 140 | Ga0075434_100134297 | 3300006871 | Bacteria | 2494 |
| 141 | Ga0075434_100665995 | 3300006871 | Bacteria | 1059 |
| 142 | Ga0075434_100899200 | 3300006871 | Bacteria | 900 |
| 143 | Ga0075429_100024991 | 3300006880 | Bacteria | 5186 |
| 144 | Ga0075429_100095944 | 3300006880 | Bacteria | 2586 |
| 145 | Ga0068865_100130514 | 3300006881 | Bacteria | 1882 |
| 146 | Ga0068865_100487985 | 3300006881 | Bacteria | 1025 |
| 147 | Ga0097620_100024143 | 3300006931 | Bacteria | 6100 |
| 148 | Ga0097620_100103523 | 3300006931 | Bacteria | 2905 |
| 149 | Ga0097620_100994588 | 3300006931 | Bacteria | 921 |
| 150 | Ga0097620_102404899 | 3300006931 | Bacteria | 580 |
| 151 | Ga0105240_10014904 | 3300009093 | Bacteria | 10589 |
| 152 | Ga0105240_10136075 | 3300009093 | Bacteria | 2942 |
| 153 | Ga0105240_10474545 | 3300009093 | Bacteria | 1395 |
| 154 | Ga0105240_11904852 | 3300009093 | Bacteria | 619 |
| 155 | Ga0111539_10033293 | 3300009094 | Bacteria | 6257 |
| 156 | Ga0111539_10060846 | 3300009094 | Bacteria | 4475 |
| 157 | Ga0111539_10071593 | 3300009094 | Bacteria | 4090 |
| 158 | Ga0111539_10436007 | 3300009094 | Bacteria | 1526 |
| 159 | Ga0111539_12764582 | 3300009094 | Bacteria | 569 |
| 160 | Ga0105245_10115983 | 3300009098 | Bacteria | 2497 |
| 161 | Ga0105247_10004407 | 3300009101 | Bacteria | 8985 |
| 162 | Ga0105247_10018366 | 3300009101 | Bacteria | 4196 |
| 163 | Ga0105247_10021665 | 3300009101 | Bacteria | 3867 |
| 164 | Ga0105247_10997783 | 3300009101 | Bacteria | 654 |
| 165 | Ga0114129_10147944 | 3300009147 | Bacteria | 3216 |
| 166 | Ga0114129_10200216 | 3300009147 | Bacteria | 2705 |
| 167 | Ga0114129_10269750 | 3300009147 | Bacteria | 2277 |
| 168 | Ga0114129_11599846 | 3300009147 | Bacteria | 798 |
| 169 | Ga0105243_10000199 | 3300009148 | Bacteria | 70022 |
| 170 | Ga0105243_10368309 | 3300009148 | Unclassified | 1325 |
| 171 | Ga0105243_10674275 | 3300009148 | Bacteria | 1005 |
| 172 | Ga0105241_10012655 | 3300009174 | Bacteria | 6191 |
| 173 | Ga0105242_10000105 | 3300009176 | Bacteria | 60065 |
| 174 | Ga0105242_10001700 | 3300009176 | Bacteria | 17415 |
| 175 | Ga0105242_10219117 | 3300009176 | Bacteria | 1700 |
| 176 | Ga0105248_10008640 | 3300009177 | Bacteria | 11188 |
| 177 | Ga0105248_10015792 | 3300009177 | Bacteria | 8322 |
| 178 | Ga0105248_10046365 | 3300009177 | Bacteria | 4871 |
| 179 | Ga0105248_10055045 | 3300009177 | Bacteria | 4462 |
| 180 | Ga0105248_10582781 | 3300009177 | Bacteria | 1262 |
| 181 | Ga0105237_10143445 | 3300009545 | Bacteria | 2383 |
| 182 | Ga0105237_10195599 | 3300009545 | Bacteria | 2022 |
| 183 | Ga0105237_10236756 | 3300009545 | Bacteria | 1827 |
| 184 | Ga0105238_10032774 | 3300009551 | Bacteria | 5287 |
| 185 | Ga0105238_10043005 | 3300009551 | Bacteria | 4572 |
| 186 | Ga0105238_10077418 | 3300009551 | Bacteria | 3317 |
| 187 | Ga0105238_10083955 | 3300009551 | Bacteria | 3174 |
| 188 | Ga0105249_10308074 | 3300009553 | Bacteria | 1591 |
| 189 | Ga0105249_10764513 | 3300009553 | Bacteria | 1029 |
| 190 | Ga0105249_10992031 | 3300009553 | Bacteria | 908 |
| 191 | Ga0105239_10030365 | 3300010375 | Bacteria | 5942 |
| 192 | Ga0105239_10049441 | 3300010375 | Bacteria | 4611 |
| 193 | Ga0105239_10070561 | 3300010375 | Bacteria | 3838 |
| 194 | Ga0105239_10196727 | 3300010375 | Bacteria | 2258 |
| 195 | Ga0105239_10339837 | 3300010375 | Bacteria | 1694 |
| 196 | Ga0105239_10977716 | 3300010375 | Bacteria | 973 |
| 197 | Ga0105246_10091418 | 3300011119 | Bacteria | 2194 |
| 198 | Ga0105246_10202672 | 3300011119 | Bacteria | 1543 |
| 199 | Ga0105246_10272364 | 3300011119 | Bacteria | 1354 |
| 200 | Ga0157373_10003863 | 3300013100 | Bacteria | 11320 |
| 201 | Ga0157373_10007782 | 3300013100 | Bacteria | 7967 |
| 202 | Ga0157373_10584551 | 3300013100 | Bacteria | 812 |
| 203 | Ga0157370_10144125 | 3300013104 | Bacteria | 2219 |
| 204 | Ga0157370_10208733 | 3300013104 | Bacteria | 1810 |
| 205 | Ga0157369_10023529 | 3300013105 | Bacteria | 6861 |
| 206 | Ga0157374_10544366 | 3300013296 | Bacteria | 1168 |
| 207 | Ga0157378_10081313 | 3300013297 | Bacteria | 2928 |
| 208 | Ga0163162_10131057 | 3300013306 | Bacteria | 2616 |
| 209 | Ga0163162_10325400 | 3300013306 | Bacteria | 1670 |
| 210 | Ga0163162_10487052 | 3300013306 | Bacteria | 1364 |
| 211 | Ga0163162_11838934 | 3300013306 | Bacteria | 693 |
| 212 | Ga0157372_10072927 | 3300013307 | Bacteria | 3869 |
| 213 | Ga0157375_10025205 | 3300013308 | Bacteria | 5521 |
| 214 | Ga0157375_11712218 | 3300013308 | Bacteria | 744 |
| 215 | Ga0163163_10021718 | 3300014325 | Bacteria | 6063 |
| 216 | Ga0163163_10428262 | 3300014325 | Bacteria | 1382 |
| 217 | Ga0157380_10533537 | 3300014326 | Bacteria | 1147 |
| 218 | Ga0157377_10283366 | 3300014745 | Viruses | 1087 |
| 219 | Ga0157379_10048201 | 3300014968 | Bacteria | 3803 |
| 220 | Ga0157379_10107042 | 3300014968 | Bacteria | 2510 |
| 221 | Ga0157379_10232138 | 3300014968 | Bacteria | 1672 |
| 222 | Ga0157379_10256369 | 3300014968 | Bacteria | 1589 |
| 223 | Ga0157379_10830756 | 3300014968 | Bacteria | 873 |
| 224 | Ga0163161_10108358 | 3300017792 | Bacteria | 2074 |
| 225 | Ga0213873_10000004 | 3300021358 | Bacteria | 774374 |
| 226 | Ga0213876_10000007 | 3300021384 | Bacteria | 670340 |
| 227 | Ga0213876_10000620 | 3300021384 | Bacteria | 26119 |
| 228 | Ga0213875_10446114 | 3300021388 | Bacteria | 619 |
| 229 | Ga0209148_1000111 | 3300025254 | Bacteria | 198095 |
| 230 | Ga0209455_1000201 | 3300025272 | Bacteria | 86804 |
| 231 | Ga0207710_10004482 | 3300025900 | Bacteria | 6086 |
| 232 | Ga0207710_10016777 | 3300025900 | Bacteria | 3100 |
| 233 | Ga0207710_10062205 | 3300025900 | Viruses | 1696 |
| 234 | Ga0207710_10116558 | 3300025900 | Bacteria | 1272 |
| 235 | Ga0207680_10156441 | 3300025903 | Bacteria | 1524 |
| 236 | Ga0207647_10096611 | 3300025904 | Bacteria | 1758 |
| 237 | Ga0207645_10053795 | 3300025907 | Bacteria | 2572 |
| 238 | Ga0207643_10011131 | 3300025908 | Bacteria | 4857 |
| 239 | Ga0207705_10127716 | 3300025909 | Bacteria | 1890 |
| 240 | Ga0207654_10011244 | 3300025911 | Bacteria | 4562 |
| 241 | Ga0207654_10044055 | 3300025911 | Bacteria | 2532 |
| 242 | Ga0207707_10133881 | 3300025912 | Bacteria | 2167 |
| 243 | Ga0207707_10147173 | 3300025912 | Bacteria | 2059 |
| 244 | Ga0207695_10045760 | 3300025913 | Bacteria | 4643 |
| 245 | Ga0207695_10219796 | 3300025913 | Bacteria | 1807 |
| 246 | Ga0207695_10406815 | 3300025913 | Unclassified | 1245 |
| 247 | Ga0207695_11371240 | 3300025913 | Bacteria | 587 |
| 248 | Ga0207671_10040072 | 3300025914 | Bacteria | 3468 |
| 249 | Ga0207671_10155180 | 3300025914 | Bacteria | 1770 |
| 250 | Ga0207660_10023034 | 3300025917 | Bacteria | 4203 |
| 251 | Ga0207660_10681530 | 3300025917 | Bacteria | 838 |
| 252 | Ga0207662_10047362 | 3300025918 | Viruses | 2546 |
| 253 | Ga0207662_10059619 | 3300025918 | Bacteria | 2288 |
| 254 | Ga0207657_10010088 | 3300025919 | Bacteria | 9444 |
| 255 | Ga0207649_10236192 | 3300025920 | Bacteria | 1310 |
| 256 | Ga0207649_10866037 | 3300025920 | Bacteria | 707 |
| 257 | Ga0207652_10260222 | 3300025921 | Bacteria | 1565 |
| 258 | Ga0207681_10006643 | 3300025923 | Bacteria | 7102 |
| 259 | Ga0207694_10005564 | 3300025924 | Bacteria | 9658 |
| 260 | Ga0207694_10098316 | 3300025924 | Bacteria | 2317 |
| 261 | Ga0207694_10132881 | 3300025924 | Bacteria | 1996 |
| 262 | Ga0207650_10045011 | 3300025925 | Bacteria | 3246 |
| 263 | Ga0207650_10244212 | 3300025925 | Bacteria | 1452 |
| 264 | Ga0207650_10807856 | 3300025925 | Viruses | 795 |
| 265 | Ga0207659_10266158 | 3300025926 | Bacteria | 1397 |
| 266 | Ga0207687_10076778 | 3300025927 | Bacteria | 2400 |
| 267 | Ga0207687_11257785 | 3300025927 | Bacteria | 636 |
| 268 | Ga0207644_10253875 | 3300025931 | Bacteria | 1404 |
| 269 | Ga0207706_10081254 | 3300025933 | Bacteria | 2848 |
| 270 | Ga0207686_10000064 | 3300025934 | Bacteria | 95481 |
| 271 | Ga0207686_10001331 | 3300025934 | Bacteria | 14069 |
| 272 | Ga0207709_10000150 | 3300025935 | Bacteria | 95086 |
| 273 | Ga0207709_10554514 | 3300025935 | Bacteria | 904 |
| 274 | Ga0207709_10871581 | 3300025935 | Bacteria | 730 |
| 275 | Ga0207670_10626618 | 3300025936 | Bacteria | 885 |
| 276 | Ga0207704_10172092 | 3300025938 | Bacteria | 1555 |
| 277 | Ga0207704_10295877 | 3300025938 | Bacteria | 1238 |
| 278 | Ga0207665_10332868 | 3300025939 | Bacteria | 1142 |
| 279 | Ga0207711_10005433 | 3300025941 | Bacteria | 10778 |
| 280 | Ga0207711_10007485 | 3300025941 | Bacteria | 9132 |
| 281 | Ga0207711_10025400 | 3300025941 | Bacteria | 4971 |
| 282 | Ga0207711_10055203 | 3300025941 | Bacteria | 3411 |
| 283 | Ga0207711_10236136 | 3300025941 | Bacteria | 1675 |
| 284 | Ga0207711_10312244 | 3300025941 | Bacteria | 1451 |
| 285 | Ga0207689_10188618 | 3300025942 | Bacteria | 1701 |
| 286 | Ga0207689_10581299 | 3300025942 | Bacteria | 942 |
| 287 | Ga0207689_10764104 | 3300025942 | Bacteria | 816 |
| 288 | Ga0207661_10120760 | 3300025944 | Bacteria | 2230 |
| 289 | Ga0207661_10920371 | 3300025944 | Bacteria | 805 |
| 290 | Ga0207679_10042462 | 3300025945 | Bacteria | 3268 |
| 291 | Ga0207679_10052072 | 3300025945 | Bacteria | 3001 |
| 292 | Ga0207679_10313722 | 3300025945 | Bacteria | 1356 |
| 293 | Ga0207679_11151091 | 3300025945 | Bacteria | 712 |
| 294 | Ga0207667_10037455 | 3300025949 | Bacteria | 5183 |
| 295 | Ga0207651_10037058 | 3300025960 | Bacteria | 3191 |
| 296 | Ga0207651_10835717 | 3300025960 | Bacteria | 818 |
| 297 | Ga0207712_10250798 | 3300025961 | Bacteria | 1430 |
| 298 | Ga0207712_10576269 | 3300025961 | Bacteria | 971 |
| 299 | Ga0207640_10220455 | 3300025981 | Bacteria | 1452 |
| 300 | Ga0207640_10277330 | 3300025981 | Bacteria | 1315 |
| 301 | Ga0207640_10367710 | 3300025981 | Bacteria | 1161 |
| 302 | Ga0207640_10432663 | 3300025981 | Bacteria | 1080 |
| 303 | Ga0207640_10893317 | 3300025981 | Bacteria | 776 |
| 304 | Ga0207658_10001796 | 3300025986 | Bacteria | 16077 |
| 305 | Ga0207658_10058611 | 3300025986 | Bacteria | 2866 |
| 306 | Ga0207658_10248920 | 3300025986 | Unclassified | 1509 |
| 307 | Ga0207703_10016093 | 3300026035 | Bacteria | 5832 |
| 308 | Ga0207703_10165044 | 3300026035 | Bacteria | 1942 |
| 309 | Ga0207703_10215123 | 3300026035 | Bacteria | 1715 |
| 310 | Ga0207703_10716195 | 3300026035 | Bacteria | 952 |
| 311 | Ga0207639_10154401 | 3300026041 | Bacteria | 1926 |
| 312 | Ga0207639_10458477 | 3300026041 | Bacteria | 1158 |
| 313 | Ga0207678_10506638 | 3300026067 | Bacteria | 1052 |
| 314 | Ga0207708_10001475 | 3300026075 | Bacteria | 17580 |
| 315 | Ga0207708_10042120 | 3300026075 | Bacteria | 3481 |
| 316 | Ga0207708_11252157 | 3300026075 | Bacteria | 649 |
| 317 | Ga0207702_10591176 | 3300026078 | Bacteria | 1088 |
| 318 | Ga0207641_10268618 | 3300026088 | Bacteria | 1600 |
| 319 | Ga0207641_10676812 | 3300026088 | Bacteria | 1015 |
| 320 | Ga0207641_10773373 | 3300026088 | Bacteria | 949 |
| 321 | Ga0207674_10010522 | 3300026116 | Bacteria | 10471 |
| 322 | Ga0207674_10039647 | 3300026116 | Bacteria | 4882 |
| 323 | Ga0207675_100109547 | 3300026118 | Bacteria | 2606 |
| 324 | Ga0207675_100559706 | 3300026118 | Viruses | 1143 |
| 325 | Ga0207683_10260558 | 3300026121 | Bacteria | 1583 |
| 326 | Ga0207698_10127504 | 3300026142 | Bacteria | 2167 |
| 327 | Ga0207428_10046485 | 3300027907 | Bacteria | 3491 |
| 328 | Ga0207428_10236161 | 3300027907 | Bacteria | 1367 |
| 329 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 330 | Ga0268266_10135966 | 3300028379 | Bacteria | 2202 |
| 331 | Ga0268265_10086988 | 3300028380 | Bacteria | 2485 |
| 332 | Ga0268265_10105480 | 3300028380 | Bacteria | 2287 |
| 333 | Ga0268265_10672265 | 3300028380 | Bacteria | 997 |
| 334 | Ga0268264_10006136 | 3300028381 | Bacteria | 10149 |
| 335 | Ga0268264_10018818 | 3300028381 | Bacteria | 5648 |
| 336 | Ga0268264_10044462 | 3300028381 | Bacteria | 3684 |
| 337 | Ga0268264_10127792 | 3300028381 | Bacteria | 2249 |
| 338 | Ga0316176_1020679 | 3300030732 | Bacteria | 1079 |
| 339 | Ga0314311_1060014 | 3300030733 | Bacteria | 962 |
| 340 | Ga0316178_1008711 | 3300030735 | Bacteria | 851 |
| 341 | Ga0307408_100002168 | 3300031548 | Bacteria | 14045 |
| 342 | Ga0307408_100013461 | 3300031548 | Bacteria | 5430 |
| 343 | Ga0307408_100246931 | 3300031548 | Bacteria | 1470 |
| 344 | Ga0307408_100333373 | 3300031548 | Bacteria | 1282 |
| 345 | Ga0307413_10945039 | 3300031824 | Bacteria | 735 |
| 346 | Ga0307410_10095814 | 3300031852 | Bacteria | 2117 |
| 347 | Ga0307410_10490671 | 3300031852 | Bacteria | 1009 |
| 348 | Ga0307410_11385322 | 3300031852 | Bacteria | 617 |
| 349 | Ga0307406_10000010 | 3300031901 | Bacteria | 114357 |
| 350 | Ga0307407_10000463 | 3300031903 | Bacteria | 12432 |
| 351 | Ga0307412_10000046 | 3300031911 | Bacteria | 163839 |
| 352 | Ga0307412_10172188 | 3300031911 | Bacteria | 1620 |
| 353 | Ga0307412_10542792 | 3300031911 | Bacteria | 975 |
| 354 | Ga0307409_100000918 | 3300031995 | Bacteria | 13668 |
| 355 | Ga0307416_100002604 | 3300032002 | Bacteria | 10416 |
| 356 | Ga0307416_100104981 | 3300032002 | Bacteria | 2472 |
| 357 | Ga0307416_100291356 | 3300032002 | Bacteria | 1616 |
| 358 | Ga0307416_100852966 | 3300032002 | Bacteria | 1009 |
| 359 | Ga0307416_101626981 | 3300032002 | Bacteria | 751 |
| 360 | Ga0307411_10102888 | 3300032005 | Bacteria | 2025 |
| 361 | Ga0307411_10146292 | 3300032005 | Bacteria | 1749 |
| 362 | Ga0307415_101767007 | 3300032126 | Bacteria | 598 |
| 363 | Ga0373941_0153321 | 3300035115 | Viruses | 847 |
| 364 | Ga0373942_0009185 | 3300035207 | Bacteria | 2310 |
| 365 | Ga0395905_0384878 | 3300037471 | Bacteria | 1297 |
| 366 | Ga0436364_0443686 | 3300037853 | Bacteria | 619 |
| 367 | Ga0436365_0748815 | 3300039437 | Bacteria | 55323 |
| 368 | Ga0436365_1010975 | 3300039437 | Bacteria | 46606 |
| 369 | Ga0436362_0290430 | 3300039453 | Bacteria | 772596 |
| 370 | Ga0439453_0003316 | 3300041408 | Bacteria | 2308 |
| 371 | Ga0451802_1946418 | 3300041460 | Bacteria | 1040 |
| 372 | Ga0451807_1784760 | 3300041486 | Bacteria | 900 |
| 373 | Ga0450890_000006 | 3300042127 | Bacteria | 82518 |
| 374 | Ga0450891_000537 | 3300042129 | Bacteria | 3933 |
| 375 | Ga0450892_000002 | 3300042130 | Bacteria | 27249 |
| 376 | Ga0439446_0012471 | 3300042156 | Bacteria | 2322 |
| 377 | Ga0450893_0000217 | 3300042532 | Bacteria | 7673 |
| 378 | Ga0450893_0000426 | 3300042532 | Bacteria | 5944 |
| 379 | Ga0451577_0001523 | 3300042876 | Bacteria | 30532 |
| 380 | Ga0451577_0006115 | 3300042876 | Bacteria | 12093 |
| 381 | Ga0453684_0000548 | 3300044712 | Bacteria | 142109 |
| 382 | Ga0453684_0001943 | 3300044712 | Bacteria | 53305 |
| 383 | Ga0453684_0030647 | 3300044712 | Bacteria | 7590 |
| 384 | Ga0453684_0081068 | 3300044712 | Bacteria | 4049 |
| 385 | Ga0453684_0225520 | 3300044712 | Bacteria | 2167 |
| 386 | Ga0453684_0868459 | 3300044712 | Bacteria | 968 |
| 387 | Ga0453684_1002923 | 3300044712 | Bacteria | 888 |
| 388 | Ga0451576_0322975 | 3300045051 | Bacteria | 1615 |
| 389 | Ga0495638_0034323 | 3300046460 | Bacteria | 3239 |
| 390 | Ga0495638_0301060 | 3300046460 | Bacteria | 864 |
| 391 | Ga0495620_0000378 | 3300046515 | Bacteria | 30356 |
| 392 | Ga0495625_0071161 | 3300046660 | Bacteria | 2441 |
| 393 | Ga0495658_0265975 | 3300046683 | Bacteria | 1080 |
| 394 | Ga0495686_0256478 | 3300047472 | Bacteria | 980 |
| 395 | Ga0496102_1040173 | 3300048905 | Bacteria | 739 |
| 396 | Ga0496106_0008702 | 3300048909 | Bacteria | 7511 |
| 397 | Ga0496107_0092270 | 3300048910 | Bacteria | 2214 |
| 398 | Ga0496109_0080162 | 3300048912 | Bacteria | 3008 |
| 399 | Ga0496110_0052660 | 3300048913 | Bacteria | 3577 |
| 400 | Ga0496111_0224109 | 3300048914 | Bacteria | 1397 |
| 401 | Ga0496112_0246555 | 3300048915 | Viruses | 1738 |
| 402 | Ga0496113_0108926 | 3300048916 | Bacteria | 2154 |
| 403 | Ga0496115_0392467 | 3300048918 | Bacteria | 1127 |
| 404 | Ga0501308_004366 | 3300049128 | Bacteria | 1360 |
| 405 | Ga0501310_004317 | 3300049130 | Bacteria | 1423 |
| 406 | Ga0501304_000795 | 3300049160 | Bacteria | 1810 |
| 407 | Ga0501307_013459 | 3300049162 | Viruses | 988 |
| 408 | Ga0501291_000365 | 3300049514 | Bacteria | 5551 |
| 409 | Ga0501292_002158 | 3300049515 | Unclassified | 2508 |
| 410 | Ga0501296_000708 | 3300049519 | Unclassified | 3301 |
| 411 | Ga0501298_001374 | 3300049521 | Bacteria | 3573 |
| 412 | Ga0501300_003609 | 3300049523 | Bacteria | 2304 |
| 413 | Ga0501311_014912 | 3300049527 | Viruses | 997 |
| 414 | Ga0501320_005314 | 3300049536 | Viruses | 1169 |
| 415 | Ga0501321_001740 | 3300049537 | Bacteria | 1790 |
| 416 | Ga0501323_005052 | 3300049539 | Bacteria | 1425 |
| 417 | Ga0501034_0057650 | 3300049571 | Bacteria | 3905 |
| 418 | Ga0501034_0316207 | 3300049571 | Bacteria | 1495 |
| 419 | Ga0501039_0084860 | 3300049575 | Bacteria | 2467 |
| 420 | Ga0501043_0118002 | 3300049579 | Bacteria | 2082 |
| 421 | Ga0501067_0037433 | 3300049583 | Bacteria | 2695 |
| 422 | Ga0501067_0563058 | 3300049583 | Bacteria | 638 |
| 423 | Ga0501068_0015655 | 3300049584 | Bacteria | 4360 |
| 424 | Ga0501068_0203783 | 3300049584 | Bacteria | 1255 |
| 425 | Ga0501069_0009215 | 3300049585 | Bacteria | 5207 |
| 426 | Ga0501070_0034481 | 3300049586 | Bacteria | 4231 |
| 427 | Ga0501070_0175622 | 3300049586 | Bacteria | 1764 |
| 428 | Ga0501071_1048446 | 3300049587 | Bacteria | 630 |
| 429 | Ga0501072_0301172 | 3300049588 | Bacteria | 1274 |
| 430 | Ga0501201_001940 | 3300049651 | Viruses | 1911 |
| 431 | Ga0501216_001073 | 3300049660 | Unclassified | 3559 |
| 432 | Ga0501217_011917 | 3300049661 | Viruses | 1929 |
| 433 | Ga0501233_004273 | 3300049668 | Bacteria | 2610 |
| 434 | Ga0501235_002450 | 3300049669 | Bacteria | 4001 |
| 435 | Ga0501240_008580 | 3300049673 | Viruses | 1315 |
| 436 | Ga0501249_003401 | 3300049679 | Bacteria | 3194 |
| 437 | Ga0501256_008126 | 3300049685 | Viruses | 973 |
| 438 | Ga0501257_013460 | 3300049686 | Bacteria | 1875 |
| 439 | Ga0501257_017957 | 3300049686 | Bacteria | 1647 |
| 440 | Ga0501258_013173 | 3300049687 | Viruses | 905 |
| 441 | Ga0501260_000609 | 3300049689 | Unclassified | 2768 |
| 442 | Ga0501261_005441 | 3300049690 | Bacteria | 1601 |
| 443 | Ga0501225_0005013 | 3300049705 | Bacteria | 3911 |
| 444 | Ga0501080_0148550 | 3300049742 | Bacteria | 2167 |
| 445 | Ga0501080_0314265 | 3300049742 | Bacteria | 1419 |
| 446 | Ga0501083_0317153 | 3300049744 | Bacteria | 1014 |
| 447 | Ga0501264_004974 | 3300049761 | Viruses | 1205 |
| 448 | Ga0501266_035568 | 3300049763 | Bacteria | 725 |
| 449 | Ga0501270_000988 | 3300049767 | Unclassified | 2616 |
| 450 | Ga0501272_008306 | 3300049769 | Viruses | 1138 |
| 451 | Ga0501279_010964 | 3300049775 | Viruses | 1222 |
| 452 | Ga0501280_005003 | 3300049776 | Bacteria | 1916 |
| 453 | Ga0501283_001376 | 3300049779 | Bacteria | 3170 |
| 454 | Ga0501212_041169 | 3300049851 | Unclassified | 764 |
| 455 | nmdc:mga03683_114049_c1 | 3300050489 | Bacteria | 1197 |
| 456 | nmdc:mga03n38_121502_c1 | 3300050490 | Bacteria | 1284 |
| 457 | nmdc:mga00v17_68129_c1 | 3300050491 | Bacteria | 2200 |
| 458 | nmdc:mga00v17_8931_c1 | 3300050491 | Bacteria | 5407 |
| 459 | nmdc:mga0yw44_30110_c1 | 3300050492 | Bacteria | 3141 |
| 460 | nmdc:mga0yw44_3298_c1 | 3300050492 | Bacteria | 7135 |
| 461 | nmdc:mga0yw44_461361_c1 | 3300050492 | Bacteria | 861 |
| 462 | nmdc:mga06z11_8029_c1 | 3300050494 | Bacteria | 4376 |
| 463 | nmdc:mga07m45_6620_c1 | 3300050496 | Bacteria | 5872 |
| 464 | nmdc:mga05p37_1306623_c1 | 3300050507 | Bacteria | 739 |
| 465 | nmdc:mga05p37_200535_c1 | 3300050507 | Bacteria | 2417 |
| 466 | nmdc:mga05p37_234374_c1 | 3300050507 | Bacteria | 2210 |
| 467 | nmdc:mga09592_4728_c1 | 3300050508 | Bacteria | 11028 |
| 468 | nmdc:mga09592_538451_c1 | 3300050508 | Bacteria | 1003 |
| 469 | nmdc:mga09592_70405_c1 | 3300050508 | Bacteria | 2968 |
| 470 | nmdc:mga0qj67_159412_c1 | 3300050509 | Bacteria | 1832 |
| 471 | nmdc:mga06r32_134314_c1 | 3300050510 | Bacteria | 2449 |
| 472 | nmdc:mga06r32_19372_c1 | 3300050510 | Bacteria | 6243 |
| 473 | nmdc:mga08y16_131786_c1 | 3300050511 | Bacteria | 2599 |
| 474 | nmdc:mga08y16_142879_c1 | 3300050511 | Bacteria | 2488 |
| 475 | nmdc:mga08y16_18309_c1 | 3300050511 | Bacteria | 7380 |
| 476 | nmdc:mga0n895_90216_c1 | 3300050512 | Bacteria | 3066 |
| 477 | nmdc:mga0a205_101602_c1 | 3300050515 | Bacteria | 2774 |
| 478 | nmdc:mga0a205_68467_c1 | 3300050515 | Bacteria | 3428 |
| 479 | nmdc:mga0a205_84437_c1 | 3300050515 | Bacteria | 3067 |
| 480 | Ga0500658_0046436 | 3300053134 | Bacteria | 1759 |
| 481 | Ga0500604_0035392 | 3300053151 | Bacteria | 1485 |
| 482 | Ga0500616_0003753 | 3300053153 | Bacteria | 11321 |
| 483 | Ga0587084_000788 | 3300059477 | Bacteria | 2718 |
| 484 | Ga0587084_045996 | 3300059477 | Bacteria | 758 |
| 485 | Ga0587093_022428 | 3300059478 | Bacteria | 856 |
| 486 | Ga0587066_044669 | 3300059490 | Bacteria | 849 |
| 487 | Ga0587070_004038 | 3300059491 | Bacteria | 1821 |
| 488 | Ga0587073_0100067 | 3300059492 | Bacteria | 752 |
| 489 | Ga0587077_020798 | 3300059493 | Bacteria | 1157 |
| 490 | Ga0587080_071696 | 3300059503 | Bacteria | 694 |
| 491 | Ga0587082_038055 | 3300059504 | Bacteria | 870 |
| 492 | Ga0587083_0003545 | 3300059505 | Bacteria | 2082 |
| 493 | Ga0587085_006608 | 3300059506 | Bacteria | 1417 |
| 494 | Ga0587086_031880 | 3300059507 | Bacteria | 779 |
| 495 | Ga0587086_041830 | 3300059507 | Bacteria | 712 |
| 496 | Ga0587088_027312 | 3300059508 | Bacteria | 997 |
| 497 | Ga0587091_052582 | 3300059511 | Bacteria | 841 |
| 498 | Ga0587091_102011 | 3300059511 | Unclassified | 674 |
| 499 | Ga0587091_110524 | 3300059511 | Bacteria | 656 |
| 500 | Ga0587092_012392 | 3300059512 | Bacteria | 1202 |
| 501 | Ga0587094_017026 | 3300059513 | Bacteria | 1018 |
| 502 | Ga0587106_029306 | 3300059605 | Bacteria | 873 |
| 503 | Ga0587125_015939 | 3300059607 | Bacteria | 838 |
| 504 | Ga0587125_029693 | 3300059607 | Unclassified | 692 |
| 505 | Ga0587101_036472 | 3300059623 | Viruses | 792 |
| 506 | Ga0587101_123331 | 3300059623 | Bacteria | 538 |
| 507 | Ga0587109_012662 | 3300059624 | Bacteria | 1387 |
| 508 | Ga0587117_065611 | 3300059627 | Bacteria | 633 |
| 509 | Ga0587062_053140 | 3300059639 | Bacteria | 691 |
| 510 | Ga0587062_065269 | 3300059639 | Bacteria | 647 |
| 511 | Ga0587067_023222 | 3300059640 | Bacteria | 1086 |
| 512 | Ga0587069_037409 | 3300059642 | Bacteria | 814 |
| 513 | Ga0587069_038156 | 3300059642 | Bacteria | 809 |
| 514 | Ga0587072_021851 | 3300059643 | Bacteria | 1139 |
| 515 | Ga0587076_048041 | 3300059645 | Bacteria | 822 |
| 516 | Ga0587076_084636 | 3300059645 | Unclassified | 683 |
| 517 | Ga0587078_007699 | 3300059646 | Bacteria | 1196 |
| 518 | Ga0587079_001936 | 3300059647 | Bacteria | 2431 |
| 519 | Ga0587100_033367 | 3300059648 | Bacteria | 555 |
| 520 | Ga0587102_044485 | 3300059649 | Bacteria | 582 |
| 521 | Ga0587107_024791 | 3300059652 | Bacteria | 868 |
| 522 | Ga0587108_007574 | 3300059653 | Bacteria | 865 |
| 523 | Ga0587110_022011 | 3300059654 | Bacteria | 728 |
| 524 | Ga0587071_002128 | 3300060344 | Bacteria | 2632 |
| 525 | Ga0587071_166826 | 3300060344 | Bacteria | 557 |
| 526 | Ga0587111_0002351 | 3300060346 | Bacteria | 2504 |
| 527 | Ga0587111_0046074 | 3300060346 | Bacteria | 947 |
| 528 | Ga0530510_0095465 | 3300061734 | Bacteria | 2172 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059653 | Ga0587108_007574 | Ga0587108_007574_189_701 | 152 |
| 2 | 3300025934 | Ga0207686_10001331 | Ga0207686_100013312 | 155 |
| 3 | 3300009147 | Ga0114129_10147944 | Ga0114129_101479444 | 156 |
| 4 | 3300046460 | Ga0495638_0301060 | Ga0495638_0301060_43_543 | 157 |
| 5 | 3300046660 | Ga0495625_0071161 | Ga0495625_0071161_548_1048 | 157 |
| 6 | 3300047472 | Ga0495686_0256478 | Ga0495686_0256478_346_846 | 157 |
| 7 | 3300053134 | Ga0500658_0046436 | Ga0500658_0046436_713_1213 | 157 |
| 8 | 3300053151 | Ga0500604_0035392 | Ga0500604_0035392_167_667 | 157 |
| 9 | 3300005290 | Ga0065712_10411832 | Ga0065712_104118321 | 159 |
| 10 | 3300005293 | Ga0065715_10330366 | Ga0065715_103303661 | 159 |
| 11 | 3300005543 | Ga0070672_101027865 | Ga0070672_1010278651 | 159 |
| 12 | 3300009148 | Ga0105243_10000199 | Ga0105243_1000019931 | 159 |
| 13 | 3300025945 | Ga0207679_11151091 | Ga0207679_111510911 | 159 |
| 14 | 3300005445 | Ga0070708_100946285 | Ga0070708_1009462852 | 160 |
| 15 | 3300006871 | Ga0075434_100665995 | Ga0075434_1006659951 | 160 |
| 16 | 3300005367 | Ga0070667_100014321 | Ga0070667_1000143214 | 161 |
| 17 | 3300005548 | Ga0070665_100000179 | Ga0070665_10000017935 | 161 |
| 18 | 3300009176 | Ga0105242_10001700 | Ga0105242_100017002 | 161 |
| 19 | 3300025986 | Ga0207658_10001796 | Ga0207658_1000179616 | 161 |
| 20 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000012370 | 161 |
| 21 | 3300028381 | Ga0268264_10006136 | Ga0268264_100061369 | 161 |
| 22 | 3300053153 | Ga0500616_0003753 | Ga0500616_0003753_5614_6114 | 161 |
| 23 | iso_pu_bacteria | 2509276022 | 2509393812 | 161 |
| 24 | iso_pu_bacteria | 3000135777 | 3000137595 | 161 |
| 25 | 3300006038 | Ga0075365_10697418 | Ga0075365_106974182 | 162 |
| 26 | 3300009093 | Ga0105240_10474545 | Ga0105240_104745452 | 162 |
| 27 | 3300009147 | Ga0114129_10269750 | Ga0114129_102697503 | 162 |
| 28 | 3300009551 | Ga0105238_10083955 | Ga0105238_100839553 | 162 |
| 29 | 3300010375 | Ga0105239_10030365 | Ga0105239_100303656 | 162 |
| 30 | 3300013104 | Ga0157370_10208733 | Ga0157370_102087332 | 162 |
| 31 | 3300025911 | Ga0207654_10044055 | Ga0207654_100440553 | 162 |
| 32 | 3300025913 | Ga0207695_10219796 | Ga0207695_102197963 | 162 |
| 33 | 3300025924 | Ga0207694_10098316 | Ga0207694_100983162 | 162 |
| 34 | 3300032002 | Ga0307416_100104981 | Ga0307416_1001049812 | 162 |
| 35 | 3300050492 | nmdc:mga0yw44_461361_c1 | nmdc:mga0yw44_461361_c1_27_527 | 162 |
| 36 | 3300050507 | nmdc:mga05p37_200535_c1 | nmdc:mga05p37_200535_c1_1574_2071 | 162 |
| 37 | iso_pu_bacteria | 2513237351 | 2514585820 | 162 |
| 38 | 2162886006 | SwRhRL3b_contig_650789 | SwRhRL3b_0049.00001650 | 163 |
| 39 | 3300005288 | Ga0065714_10239774 | Ga0065714_102397741 | 163 |
| 40 | 3300005289 | Ga0065704_10108146 | Ga0065704_101081462 | 163 |
| 41 | 3300005290 | Ga0065712_10090625 | Ga0065712_100906252 | 163 |
| 42 | 3300005290 | Ga0065712_10447132 | Ga0065712_104471321 | 163 |
| 43 | 3300005293 | Ga0065715_10117657 | Ga0065715_101176571 | 163 |
| 44 | 3300005295 | Ga0065707_10104343 | Ga0065707_101043431 | 163 |
| 45 | 3300005295 | Ga0065707_10386472 | Ga0065707_103864721 | 163 |
| 46 | 3300005327 | Ga0070658_10028381 | Ga0070658_100283811 | 163 |
| 47 | 3300005329 | Ga0070683_100082585 | Ga0070683_1000825852 | 163 |
| 48 | 3300005330 | Ga0070690_100096855 | Ga0070690_1000968552 | 163 |
| 49 | 3300005335 | Ga0070666_10024395 | Ga0070666_100243952 | 163 |
| 50 | 3300005336 | Ga0070680_100024813 | Ga0070680_1000248132 | 163 |
| 51 | 3300005336 | Ga0070680_100065153 | Ga0070680_1000651532 | 163 |
| 52 | 3300005337 | Ga0070682_101409476 | Ga0070682_1014094761 | 163 |
| 53 | 3300005339 | Ga0070660_100166718 | Ga0070660_1001667181 | 163 |
| 54 | 3300005343 | Ga0070687_100228588 | Ga0070687_1002285882 | 163 |
| 55 | 3300005344 | Ga0070661_100164699 | Ga0070661_1001646992 | 163 |
| 56 | 3300005344 | Ga0070661_100412066 | Ga0070661_1004120661 | 163 |
| 57 | 3300005353 | Ga0070669_100965698 | Ga0070669_1009656981 | 163 |
| 58 | 3300005355 | Ga0070671_101381393 | Ga0070671_1013813931 | 163 |
| 59 | 3300005367 | Ga0070667_100057474 | Ga0070667_1000574743 | 163 |
| 60 | 3300005441 | Ga0070700_100001026 | Ga0070700_10000102611 | 163 |
| 61 | 3300005457 | Ga0070662_100086598 | Ga0070662_1000865982 | 163 |
| 62 | 3300005458 | Ga0070681_10383241 | Ga0070681_103832413 | 163 |
| 63 | 3300005530 | Ga0070679_100122652 | Ga0070679_1001226524 | 163 |
| 64 | 3300005535 | Ga0070684_100007385 | Ga0070684_1000073854 | 163 |
| 65 | 3300005539 | Ga0068853_100502288 | Ga0068853_1005022882 | 163 |
| 66 | 3300005539 | Ga0068853_100687326 | Ga0068853_1006873262 | 163 |
| 67 | 3300005563 | Ga0068855_101144714 | Ga0068855_1011447141 | 163 |
| 68 | 3300005564 | Ga0070664_100039012 | Ga0070664_1000390122 | 163 |
| 69 | 3300005577 | Ga0068857_100021714 | Ga0068857_1000217142 | 163 |
| 70 | 3300005578 | Ga0068854_100311304 | Ga0068854_1003113042 | 163 |
| 71 | 3300005615 | Ga0070702_100541303 | Ga0070702_1005413031 | 163 |
| 72 | 3300005616 | Ga0068852_100093549 | Ga0068852_1000935491 | 163 |
| 73 | 3300005617 | Ga0068859_102404944 | Ga0068859_1024049441 | 163 |
| 74 | 3300005834 | Ga0068851_10024362 | Ga0068851_100243622 | 163 |
| 75 | 3300005840 | Ga0068870_11049059 | Ga0068870_110490591 | 163 |
| 76 | 3300005841 | Ga0068863_101492096 | Ga0068863_1014920961 | 163 |
| 77 | 3300005842 | Ga0068858_100059763 | Ga0068858_1000597632 | 163 |
| 78 | 3300005842 | Ga0068858_100340487 | Ga0068858_1003404872 | 163 |
| 79 | 3300005843 | Ga0068860_100037539 | Ga0068860_1000375394 | 163 |
| 80 | 3300005843 | Ga0068860_100069039 | Ga0068860_1000690392 | 163 |
| 81 | 3300006038 | Ga0075365_10034113 | Ga0075365_100341132 | 163 |
| 82 | 3300006051 | Ga0075364_10088908 | Ga0075364_100889084 | 163 |
| 83 | 3300006178 | Ga0075367_10815190 | Ga0075367_108151901 | 163 |
| 84 | 3300006237 | Ga0097621_100411609 | Ga0097621_1004116092 | 163 |
| 85 | 3300006852 | Ga0075433_10068170 | Ga0075433_100681704 | 163 |
| 86 | 3300006881 | Ga0068865_100130514 | Ga0068865_1001305143 | 163 |
| 87 | 3300006931 | Ga0097620_102404899 | Ga0097620_1024048991 | 163 |
| 88 | 3300009093 | Ga0105240_10014904 | Ga0105240_100149047 | 163 |
| 89 | 3300009093 | Ga0105240_10136075 | Ga0105240_101360752 | 163 |
| 90 | 3300009093 | Ga0105240_11904852 | Ga0105240_119048521 | 163 |
| 91 | 3300009094 | Ga0111539_10436007 | Ga0111539_104360072 | 163 |
| 92 | 3300009098 | Ga0105245_10115983 | Ga0105245_101159833 | 163 |
| 93 | 3300009101 | Ga0105247_10018366 | Ga0105247_100183662 | 163 |
| 94 | 3300009174 | Ga0105241_10012655 | Ga0105241_100126552 | 163 |
| 95 | 3300009177 | Ga0105248_10015792 | Ga0105248_100157923 | 163 |
| 96 | 3300009177 | Ga0105248_10046365 | Ga0105248_100463654 | 163 |
| 97 | 3300009545 | Ga0105237_10195599 | Ga0105237_101955992 | 163 |
| 98 | 3300009545 | Ga0105237_10236756 | Ga0105237_102367562 | 163 |
| 99 | 3300009551 | Ga0105238_10032774 | Ga0105238_100327742 | 163 |
| 100 | 3300009551 | Ga0105238_10043005 | Ga0105238_100430052 | 163 |
| 101 | 3300009551 | Ga0105238_10077418 | Ga0105238_100774183 | 163 |
| 102 | 3300009553 | Ga0105249_10308074 | Ga0105249_103080743 | 163 |
| 103 | 3300010375 | Ga0105239_10049441 | Ga0105239_100494412 | 163 |
| 104 | 3300010375 | Ga0105239_10070561 | Ga0105239_100705612 | 163 |
| 105 | 3300011119 | Ga0105246_10091418 | Ga0105246_100914182 | 163 |
| 106 | 3300013100 | Ga0157373_10584551 | Ga0157373_105845511 | 163 |
| 107 | 3300013104 | Ga0157370_10144125 | Ga0157370_101441252 | 163 |
| 108 | 3300013105 | Ga0157369_10023529 | Ga0157369_100235292 | 163 |
| 109 | 3300013306 | Ga0163162_10131057 | Ga0163162_101310572 | 163 |
| 110 | 3300013306 | Ga0163162_10487052 | Ga0163162_104870522 | 163 |
| 111 | 3300013307 | Ga0157372_10072927 | Ga0157372_100729274 | 163 |
| 112 | 3300014745 | Ga0157377_10283366 | Ga0157377_102833661 | 163 |
| 113 | 3300014968 | Ga0157379_10107042 | Ga0157379_101070421 | 163 |
| 114 | 3300025900 | Ga0207710_10062205 | Ga0207710_100622051 | 163 |
| 115 | 3300025903 | Ga0207680_10156441 | Ga0207680_101564413 | 163 |
| 116 | 3300025909 | Ga0207705_10127716 | Ga0207705_101277161 | 163 |
| 117 | 3300025911 | Ga0207654_10011244 | Ga0207654_100112442 | 163 |
| 118 | 3300025912 | Ga0207707_10147173 | Ga0207707_101471733 | 163 |
| 119 | 3300025913 | Ga0207695_10045760 | Ga0207695_100457602 | 163 |
| 120 | 3300025913 | Ga0207695_10406815 | Ga0207695_104068151 | 163 |
| 121 | 3300025913 | Ga0207695_11371240 | Ga0207695_113712401 | 163 |
| 122 | 3300025914 | Ga0207671_10040072 | Ga0207671_100400722 | 163 |
| 123 | 3300025917 | Ga0207660_10023034 | Ga0207660_100230342 | 163 |
| 124 | 3300025918 | Ga0207662_10047362 | Ga0207662_100473622 | 163 |
| 125 | 3300025919 | Ga0207657_10010088 | Ga0207657_100100882 | 163 |
| 126 | 3300025920 | Ga0207649_10866037 | Ga0207649_108660371 | 163 |
| 127 | 3300025921 | Ga0207652_10260222 | Ga0207652_102602223 | 163 |
| 128 | 3300025924 | Ga0207694_10132881 | Ga0207694_101328812 | 163 |
| 129 | 3300025927 | Ga0207687_10076778 | Ga0207687_100767783 | 163 |
| 130 | 3300025931 | Ga0207644_10253875 | Ga0207644_102538752 | 163 |
| 131 | 3300025933 | Ga0207706_10081254 | Ga0207706_100812542 | 163 |
| 132 | 3300025938 | Ga0207704_10172092 | Ga0207704_101720922 | 163 |
| 133 | 3300025941 | Ga0207711_10005433 | Ga0207711_100054335 | 163 |
| 134 | 3300025941 | Ga0207711_10312244 | Ga0207711_103122442 | 163 |
| 135 | 3300025942 | Ga0207689_10764104 | Ga0207689_107641041 | 163 |
| 136 | 3300025944 | Ga0207661_10120760 | Ga0207661_101207603 | 163 |
| 137 | 3300025945 | Ga0207679_10042462 | Ga0207679_100424623 | 163 |
| 138 | 3300025945 | Ga0207679_10052072 | Ga0207679_100520721 | 163 |
| 139 | 3300025949 | Ga0207667_10037455 | Ga0207667_100374552 | 163 |
| 140 | 3300025961 | Ga0207712_10250798 | Ga0207712_102507981 | 163 |
| 141 | 3300025981 | Ga0207640_10277330 | Ga0207640_102773302 | 163 |
| 142 | 3300025981 | Ga0207640_10367710 | Ga0207640_103677102 | 163 |
| 143 | 3300025986 | Ga0207658_10058611 | Ga0207658_100586112 | 163 |
| 144 | 3300026035 | Ga0207703_10165044 | Ga0207703_101650441 | 163 |
| 145 | 3300026035 | Ga0207703_10215123 | Ga0207703_102151231 | 163 |
| 146 | 3300026035 | Ga0207703_10716195 | Ga0207703_107161952 | 163 |
| 147 | 3300026041 | Ga0207639_10154401 | Ga0207639_101544011 | 163 |
| 148 | 3300026041 | Ga0207639_10458477 | Ga0207639_104584772 | 163 |
| 149 | 3300026075 | Ga0207708_10001475 | Ga0207708_1000147513 | 163 |
| 150 | 3300026078 | Ga0207702_10591176 | Ga0207702_105911761 | 163 |
| 151 | 3300026088 | Ga0207641_10676812 | Ga0207641_106768122 | 163 |
| 152 | 3300026116 | Ga0207674_10010522 | Ga0207674_100105223 | 163 |
| 153 | 3300026118 | Ga0207675_100559706 | Ga0207675_1005597062 | 163 |
| 154 | 3300027907 | Ga0207428_10236161 | Ga0207428_102361613 | 163 |
| 155 | 3300028379 | Ga0268266_10135966 | Ga0268266_101359662 | 163 |
| 156 | 3300028381 | Ga0268264_10044462 | Ga0268264_100444622 | 163 |
| 157 | 3300028381 | Ga0268264_10127792 | Ga0268264_101277922 | 163 |
| 158 | 3300031548 | Ga0307408_100246931 | Ga0307408_1002469311 | 163 |
| 159 | 3300031852 | Ga0307410_10490671 | Ga0307410_104906712 | 163 |
| 160 | 3300032002 | Ga0307416_100291356 | Ga0307416_1002913563 | 163 |
| 161 | 3300032002 | Ga0307416_100852966 | Ga0307416_1008529662 | 163 |
| 162 | 3300037471 | Ga0395905_0384878 | Ga0395905_0384878_110_610 | 163 |
| 163 | 3300046683 | Ga0495658_0265975 | Ga0495658_0265975_229_735 | 163 |
| 164 | 3300050491 | nmdc:mga00v17_68129_c1 | nmdc:mga00v17_68129_c1_485_982 | 163 |
| 165 | 3300050492 | nmdc:mga0yw44_3298_c1 | nmdc:mga0yw44_3298_c1_3102_3599 | 163 |
| 166 | 3300050515 | nmdc:mga0a205_68467_c1 | nmdc:mga0a205_68467_c1_1204_1704 | 163 |
| 167 | 3300059607 | Ga0587125_029693 | Ga0587125_029693_16_516 | 163 |
| 168 | 3300059624 | Ga0587109_012662 | Ga0587109_012662_705_1205 | 163 |
| 169 | 3300059645 | Ga0587076_084636 | Ga0587076_084636_172_669 | 163 |
| 170 | 3300003323 | rootH1_10276648 | rootH1_102766482 | 164 |
| 171 | 3300005334 | Ga0068869_100098134 | Ga0068869_1000981343 | 164 |
| 172 | 3300005336 | Ga0070680_100400861 | Ga0070680_1004008611 | 164 |
| 173 | 3300005353 | Ga0070669_100031760 | Ga0070669_1000317603 | 164 |
| 174 | 3300005440 | Ga0070705_100156895 | Ga0070705_1001568952 | 164 |
| 175 | 3300005578 | Ga0068854_100116804 | Ga0068854_1001168041 | 164 |
| 176 | 3300005616 | Ga0068852_100210627 | Ga0068852_1002106272 | 164 |
| 177 | 3300005840 | Ga0068870_10021098 | Ga0068870_100210984 | 164 |
| 178 | 3300005843 | Ga0068860_100623305 | Ga0068860_1006233052 | 164 |
| 179 | 3300005844 | Ga0068862_100006996 | Ga0068862_1000069965 | 164 |
| 180 | 3300006048 | Ga0075363_100048850 | Ga0075363_1000488501 | 164 |
| 181 | 3300006173 | Ga0070716_100291333 | Ga0070716_1002913332 | 164 |
| 182 | 3300006178 | Ga0075367_10003744 | Ga0075367_100037442 | 164 |
| 183 | 3300006353 | Ga0075370_10560728 | Ga0075370_105607282 | 164 |
| 184 | 3300006844 | Ga0075428_100055948 | Ga0075428_1000559485 | 164 |
| 185 | 3300006846 | Ga0075430_100095047 | Ga0075430_1000950473 | 164 |
| 186 | 3300006847 | Ga0075431_100333914 | Ga0075431_1003339141 | 164 |
| 187 | 3300006880 | Ga0075429_100024991 | Ga0075429_1000249913 | 164 |
| 188 | 3300009147 | Ga0114129_10200216 | Ga0114129_102002163 | 164 |
| 189 | 3300009148 | Ga0105243_10368309 | Ga0105243_103683091 | 164 |
| 190 | 3300009177 | Ga0105248_10582781 | Ga0105248_105827812 | 164 |
| 191 | 3300009553 | Ga0105249_10764513 | Ga0105249_107645132 | 164 |
| 192 | 3300011119 | Ga0105246_10202672 | Ga0105246_102026722 | 164 |
| 193 | 3300013100 | Ga0157373_10003863 | Ga0157373_100038635 | 164 |
| 194 | 3300025254 | Ga0209148_1000111 | Ga0209148_1000111107 | 164 |
| 195 | 3300025272 | Ga0209455_1000201 | Ga0209455_100020123 | 164 |
| 196 | 3300025904 | Ga0207647_10096611 | Ga0207647_100966111 | 164 |
| 197 | 3300025908 | Ga0207643_10011131 | Ga0207643_100111316 | 164 |
| 198 | 3300025917 | Ga0207660_10681530 | Ga0207660_106815301 | 164 |
| 199 | 3300025923 | Ga0207681_10006643 | Ga0207681_100066435 | 164 |
| 200 | 3300025925 | Ga0207650_10244212 | Ga0207650_102442122 | 164 |
| 201 | 3300025939 | Ga0207665_10332868 | Ga0207665_103328681 | 164 |
| 202 | 3300025941 | Ga0207711_10236136 | Ga0207711_102361362 | 164 |
| 203 | 3300025942 | Ga0207689_10188618 | Ga0207689_101886182 | 164 |
| 204 | 3300025981 | Ga0207640_10220455 | Ga0207640_102204553 | 164 |
| 205 | 3300026075 | Ga0207708_10042120 | Ga0207708_100421206 | 164 |
| 206 | 3300026118 | Ga0207675_100109547 | Ga0207675_1001095474 | 164 |
| 207 | 3300026142 | Ga0207698_10127504 | Ga0207698_101275042 | 164 |
| 208 | 3300028380 | Ga0268265_10086988 | Ga0268265_100869882 | 164 |
| 209 | 3300030732 | Ga0316176_1020679 | Ga0316176_10206792 | 164 |
| 210 | 3300030733 | Ga0314311_1060014 | Ga0314311_10600141 | 164 |
| 211 | 3300030735 | Ga0316178_1008711 | Ga0316178_10087111 | 164 |
| 212 | 3300031548 | Ga0307408_100002168 | Ga0307408_10000216812 | 164 |
| 213 | 3300031852 | Ga0307410_10095814 | Ga0307410_100958141 | 164 |
| 214 | 3300031901 | Ga0307406_10000010 | Ga0307406_1000001067 | 164 |
| 215 | 3300031911 | Ga0307412_10542792 | Ga0307412_105427921 | 164 |
| 216 | 3300031995 | Ga0307409_100000918 | Ga0307409_1000009184 | 164 |
| 217 | 3300048909 | Ga0496106_0008702 | Ga0496106_0008702_6203_6703 | 164 |
| 218 | 3300048910 | Ga0496107_0092270 | Ga0496107_0092270_832_1332 | 164 |
| 219 | 3300050494 | nmdc:mga06z11_8029_c1 | nmdc:mga06z11_8029_c1_2113_2616 | 164 |
| 220 | 3300050507 | nmdc:mga05p37_234374_c1 | nmdc:mga05p37_234374_c1_901_1401 | 164 |
| 221 | 3300050508 | nmdc:mga09592_70405_c1 | nmdc:mga09592_70405_c1_2060_2560 | 164 |
| 222 | 3300050510 | nmdc:mga06r32_134314_c1 | nmdc:mga06r32_134314_c1_1227_1727 | 164 |
| 223 | 3300059477 | Ga0587084_045996 | Ga0587084_045996_80_580 | 164 |
| 224 | 3300059507 | Ga0587086_031880 | Ga0587086_031880_183_683 | 164 |
| 225 | 3300059511 | Ga0587091_052582 | Ga0587091_052582_176_676 | 164 |
| 226 | 3300059642 | Ga0587069_038156 | Ga0587069_038156_176_676 | 164 |
| 227 | 3300005288 | Ga0065714_10100667 | Ga0065714_101006673 | 165 |
| 228 | 3300005290 | Ga0065712_10069481 | Ga0065712_100694814 | 165 |
| 229 | 3300005293 | Ga0065715_10003195 | Ga0065715_100031955 | 165 |
| 230 | 3300005295 | Ga0065707_10247949 | Ga0065707_102479492 | 165 |
| 231 | 3300005337 | Ga0070682_101005799 | Ga0070682_1010057991 | 165 |
| 232 | 3300005343 | Ga0070687_100071084 | Ga0070687_1000710841 | 165 |
| 233 | 3300005345 | Ga0070692_10024409 | Ga0070692_100244094 | 165 |
| 234 | 3300005364 | Ga0070673_100021792 | Ga0070673_1000217924 | 165 |
| 235 | 3300005438 | Ga0070701_10042363 | Ga0070701_100423634 | 165 |
| 236 | 3300005440 | Ga0070705_100000033 | Ga0070705_1000000338 | 165 |
| 237 | 3300005441 | Ga0070700_100752887 | Ga0070700_1007528871 | 165 |
| 238 | 3300005455 | Ga0070663_100507783 | Ga0070663_1005077831 | 165 |
| 239 | 3300005456 | Ga0070678_100269162 | Ga0070678_1002691621 | 165 |
| 240 | 3300005459 | Ga0068867_101652894 | Ga0068867_1016528941 | 165 |
| 241 | 3300005518 | Ga0070699_100144356 | Ga0070699_1001443563 | 165 |
| 242 | 3300005539 | Ga0068853_100059812 | Ga0068853_1000598124 | 165 |
| 243 | 3300005544 | Ga0070686_100451969 | Ga0070686_1004519692 | 165 |
| 244 | 3300005545 | Ga0070695_100589073 | Ga0070695_1005890731 | 165 |
| 245 | 3300005547 | Ga0070693_100001821 | Ga0070693_1000018215 | 165 |
| 246 | 3300005564 | Ga0070664_100140599 | Ga0070664_1001405994 | 165 |
| 247 | 3300005577 | Ga0068857_100092164 | Ga0068857_1000921643 | 165 |
| 248 | 3300005617 | Ga0068859_100024145 | Ga0068859_1000241454 | 165 |
| 249 | 3300005617 | Ga0068859_100994750 | Ga0068859_1009947502 | 165 |
| 250 | 3300005618 | Ga0068864_100060116 | Ga0068864_1000601164 | 165 |
| 251 | 3300005618 | Ga0068864_100362595 | Ga0068864_1003625951 | 165 |
| 252 | 3300005842 | Ga0068858_100016768 | Ga0068858_1000167684 | 165 |
| 253 | 3300005842 | Ga0068858_100125763 | Ga0068858_1001257633 | 165 |
| 254 | 3300005843 | Ga0068860_100059880 | Ga0068860_1000598803 | 165 |
| 255 | 3300006844 | Ga0075428_100144434 | Ga0075428_1001444344 | 165 |
| 256 | 3300006846 | Ga0075430_100155616 | Ga0075430_1001556161 | 165 |
| 257 | 3300006847 | Ga0075431_100195262 | Ga0075431_1001952621 | 165 |
| 258 | 3300006852 | Ga0075433_10249529 | Ga0075433_102495292 | 165 |
| 259 | 3300006852 | Ga0075433_10645829 | Ga0075433_106458292 | 165 |
| 260 | 3300006871 | Ga0075434_100134297 | Ga0075434_1001342971 | 165 |
| 261 | 3300006880 | Ga0075429_100095944 | Ga0075429_1000959444 | 165 |
| 262 | 3300006881 | Ga0068865_100487985 | Ga0068865_1004879851 | 165 |
| 263 | 3300006931 | Ga0097620_100024143 | Ga0097620_1000241434 | 165 |
| 264 | 3300006931 | Ga0097620_100994588 | Ga0097620_1009945882 | 165 |
| 265 | 3300009094 | Ga0111539_10071593 | Ga0111539_100715936 | 165 |
| 266 | 3300009094 | Ga0111539_12764582 | Ga0111539_127645821 | 165 |
| 267 | 3300009101 | Ga0105247_10004407 | Ga0105247_100044074 | 165 |
| 268 | 3300009101 | Ga0105247_10997783 | Ga0105247_109977831 | 165 |
| 269 | 3300009147 | Ga0114129_11599846 | Ga0114129_115998462 | 165 |
| 270 | 3300009148 | Ga0105243_10674275 | Ga0105243_106742752 | 165 |
| 271 | 3300009176 | Ga0105242_10219117 | Ga0105242_102191173 | 165 |
| 272 | 3300009177 | Ga0105248_10008640 | Ga0105248_100086405 | 165 |
| 273 | 3300009177 | Ga0105248_10055045 | Ga0105248_100550455 | 165 |
| 274 | 3300009545 | Ga0105237_10143445 | Ga0105237_101434453 | 165 |
| 275 | 3300010375 | Ga0105239_10196727 | Ga0105239_101967274 | 165 |
| 276 | 3300010375 | Ga0105239_10339837 | Ga0105239_103398372 | 165 |
| 277 | 3300011119 | Ga0105246_10272364 | Ga0105246_102723642 | 165 |
| 278 | 3300013100 | Ga0157373_10007782 | Ga0157373_100077824 | 165 |
| 279 | 3300013296 | Ga0157374_10544366 | Ga0157374_105443662 | 165 |
| 280 | 3300013297 | Ga0157378_10081313 | Ga0157378_100813131 | 165 |
| 281 | 3300013306 | Ga0163162_10325400 | Ga0163162_103254002 | 165 |
| 282 | 3300013306 | Ga0163162_11838934 | Ga0163162_118389341 | 165 |
| 283 | 3300014325 | Ga0163163_10021718 | Ga0163163_100217185 | 165 |
| 284 | 3300014326 | Ga0157380_10533537 | Ga0157380_105335372 | 165 |
| 285 | 3300014968 | Ga0157379_10048201 | Ga0157379_100482015 | 165 |
| 286 | 3300014968 | Ga0157379_10232138 | Ga0157379_102321382 | 165 |
| 287 | 3300014968 | Ga0157379_10256369 | Ga0157379_102563692 | 165 |
| 288 | 3300017792 | Ga0163161_10108358 | Ga0163161_101083583 | 165 |
| 289 | 3300025900 | Ga0207710_10004482 | Ga0207710_100044823 | 165 |
| 290 | 3300025900 | Ga0207710_10116558 | Ga0207710_101165581 | 165 |
| 291 | 3300025912 | Ga0207707_10133881 | Ga0207707_101338811 | 165 |
| 292 | 3300025914 | Ga0207671_10155180 | Ga0207671_101551802 | 165 |
| 293 | 3300025918 | Ga0207662_10059619 | Ga0207662_100596193 | 165 |
| 294 | 3300025920 | Ga0207649_10236192 | Ga0207649_102361921 | 165 |
| 295 | 3300025924 | Ga0207694_10005564 | Ga0207694_100055645 | 165 |
| 296 | 3300025927 | Ga0207687_11257785 | Ga0207687_112577852 | 165 |
| 297 | 3300025935 | Ga0207709_10554514 | Ga0207709_105545142 | 165 |
| 298 | 3300025938 | Ga0207704_10295877 | Ga0207704_102958772 | 165 |
| 299 | 3300025941 | Ga0207711_10007485 | Ga0207711_100074855 | 165 |
| 300 | 3300025941 | Ga0207711_10025400 | Ga0207711_100254005 | 165 |
| 301 | 3300025944 | Ga0207661_10920371 | Ga0207661_109203711 | 165 |
| 302 | 3300025945 | Ga0207679_10313722 | Ga0207679_103137221 | 165 |
| 303 | 3300025960 | Ga0207651_10037058 | Ga0207651_100370585 | 165 |
| 304 | 3300025960 | Ga0207651_10835717 | Ga0207651_108357171 | 165 |
| 305 | 3300025961 | Ga0207712_10576269 | Ga0207712_105762692 | 165 |
| 306 | 3300025981 | Ga0207640_10432663 | Ga0207640_104326631 | 165 |
| 307 | 3300025981 | Ga0207640_10893317 | Ga0207640_108933171 | 165 |
| 308 | 3300026035 | Ga0207703_10016093 | Ga0207703_100160935 | 165 |
| 309 | 3300026067 | Ga0207678_10506638 | Ga0207678_105066382 | 165 |
| 310 | 3300026075 | Ga0207708_11252157 | Ga0207708_112521572 | 165 |
| 311 | 3300026088 | Ga0207641_10268618 | Ga0207641_102686181 | 165 |
| 312 | 3300026088 | Ga0207641_10773373 | Ga0207641_107733732 | 165 |
| 313 | 3300026116 | Ga0207674_10039647 | Ga0207674_100396474 | 165 |
| 314 | 3300026121 | Ga0207683_10260558 | Ga0207683_102605583 | 165 |
| 315 | 3300028380 | Ga0268265_10105480 | Ga0268265_101054802 | 165 |
| 316 | 3300028380 | Ga0268265_10672265 | Ga0268265_106722652 | 165 |
| 317 | 3300028381 | Ga0268264_10018818 | Ga0268264_100188184 | 165 |
| 318 | 3300031548 | Ga0307408_100013461 | Ga0307408_1000134615 | 165 |
| 319 | 3300031548 | Ga0307408_100333373 | Ga0307408_1003333732 | 165 |
| 320 | 3300031852 | Ga0307410_11385322 | Ga0307410_113853221 | 165 |
| 321 | 3300031911 | Ga0307412_10172188 | Ga0307412_101721882 | 165 |
| 322 | 3300032005 | Ga0307411_10102888 | Ga0307411_101028882 | 165 |
| 323 | 3300032126 | Ga0307415_101767007 | Ga0307415_1017670071 | 165 |
| 324 | 3300041460 | Ga0451802_1946418 | Ga0451802_1946418_149_649 | 165 |
| 325 | 3300044712 | Ga0453684_0000548 | Ga0453684_0000548_63874_64377 | 165 |
| 326 | 3300044712 | Ga0453684_0081068 | Ga0453684_0081068_2316_2831 | 165 |
| 327 | 3300044712 | Ga0453684_0225520 | Ga0453684_0225520_1529_2029 | 165 |
| 328 | 3300044712 | Ga0453684_0868459 | Ga0453684_0868459_325_825 | 165 |
| 329 | 3300046460 | Ga0495638_0034323 | Ga0495638_0034323_1857_2357 | 165 |
| 330 | 3300046515 | Ga0495620_0000378 | Ga0495620_0000378_22826_23332 | 165 |
| 331 | 3300048905 | Ga0496102_1040173 | Ga0496102_1040173_74_574 | 165 |
| 332 | 3300048912 | Ga0496109_0080162 | Ga0496109_0080162_1176_1676 | 165 |
| 333 | 3300048913 | Ga0496110_0052660 | Ga0496110_0052660_109_609 | 165 |
| 334 | 3300048914 | Ga0496111_0224109 | Ga0496111_0224109_219_719 | 165 |
| 335 | 3300048915 | Ga0496112_0246555 | Ga0496112_0246555_207_707 | 165 |
| 336 | 3300048918 | Ga0496115_0392467 | Ga0496115_0392467_151_651 | 165 |
| 337 | 3300049128 | Ga0501308_004366 | Ga0501308_004366_110_613 | 165 |
| 338 | 3300049130 | Ga0501310_004317 | Ga0501310_004317_768_1268 | 165 |
| 339 | 3300049160 | Ga0501304_000795 | Ga0501304_000795_1149_1649 | 165 |
| 340 | 3300049162 | Ga0501307_013459 | Ga0501307_013459_335_835 | 165 |
| 341 | 3300049514 | Ga0501291_000365 | Ga0501291_000365_2577_3077 | 165 |
| 342 | 3300049515 | Ga0501292_002158 | Ga0501292_002158_394_894 | 165 |
| 343 | 3300049519 | Ga0501296_000708 | Ga0501296_000708_2332_2832 | 165 |
| 344 | 3300049521 | Ga0501298_001374 | Ga0501298_001374_2723_3223 | 165 |
| 345 | 3300049523 | Ga0501300_003609 | Ga0501300_003609_1570_2070 | 165 |
| 346 | 3300049527 | Ga0501311_014912 | Ga0501311_014912_161_661 | 165 |
| 347 | 3300049536 | Ga0501320_005314 | Ga0501320_005314_160_660 | 165 |
| 348 | 3300049537 | Ga0501321_001740 | Ga0501321_001740_156_656 | 165 |
| 349 | 3300049539 | Ga0501323_005052 | Ga0501323_005052_150_650 | 165 |
| 350 | 3300049651 | Ga0501201_001940 | Ga0501201_001940_859_1359 | 165 |
| 351 | 3300049660 | Ga0501216_001073 | Ga0501216_001073_2333_2833 | 165 |
| 352 | 3300049661 | Ga0501217_011917 | Ga0501217_011917_1044_1544 | 165 |
| 353 | 3300049668 | Ga0501233_004273 | Ga0501233_004273_1817_2317 | 165 |
| 354 | 3300049669 | Ga0501235_002450 | Ga0501235_002450_1902_2402 | 165 |
| 355 | 3300049673 | Ga0501240_008580 | Ga0501240_008580_414_914 | 165 |
| 356 | 3300049679 | Ga0501249_003401 | Ga0501249_003401_76_576 | 165 |
| 357 | 3300049685 | Ga0501256_008126 | Ga0501256_008126_37_537 | 165 |
| 358 | 3300049686 | Ga0501257_013460 | Ga0501257_013460_958_1461 | 165 |
| 359 | 3300049686 | Ga0501257_017957 | Ga0501257_017957_195_698 | 165 |
| 360 | 3300049687 | Ga0501258_013173 | Ga0501258_013173_374_874 | 165 |
| 361 | 3300049689 | Ga0501260_000609 | Ga0501260_000609_1692_2192 | 165 |
| 362 | 3300049690 | Ga0501261_005441 | Ga0501261_005441_61_561 | 165 |
| 363 | 3300049705 | Ga0501225_0005013 | Ga0501225_0005013_3214_3714 | 165 |
| 364 | 3300049761 | Ga0501264_004974 | Ga0501264_004974_473_973 | 165 |
| 365 | 3300049763 | Ga0501266_035568 | Ga0501266_035568_184_687 | 165 |
| 366 | 3300049767 | Ga0501270_000988 | Ga0501270_000988_476_976 | 165 |
| 367 | 3300049769 | Ga0501272_008306 | Ga0501272_008306_414_914 | 165 |
| 368 | 3300049775 | Ga0501279_010964 | Ga0501279_010964_365_865 | 165 |
| 369 | 3300049776 | Ga0501280_005003 | Ga0501280_005003_1370_1873 | 165 |
| 370 | 3300049779 | Ga0501283_001376 | Ga0501283_001376_1488_1988 | 165 |
| 371 | 3300049851 | Ga0501212_041169 | Ga0501212_041169_108_608 | 165 |
| 372 | 3300050507 | nmdc:mga05p37_1306623_c1 | nmdc:mga05p37_1306623_c1_23_523 | 165 |
| 373 | 3300050508 | nmdc:mga09592_4728_c1 | nmdc:mga09592_4728_c1_2026_2526 | 165 |
| 374 | 3300050509 | nmdc:mga0qj67_159412_c1 | nmdc:mga0qj67_159412_c1_68_568 | 165 |
| 375 | 3300050510 | nmdc:mga06r32_19372_c1 | nmdc:mga06r32_19372_c1_68_568 | 165 |
| 376 | 3300050511 | nmdc:mga08y16_142879_c1 | nmdc:mga08y16_142879_c1_1099_1599 | 165 |
| 377 | 3300050512 | nmdc:mga0n895_90216_c1 | nmdc:mga0n895_90216_c1_1900_2400 | 165 |
| 378 | 3300050515 | nmdc:mga0a205_101602_c1 | nmdc:mga0a205_101602_c1_1222_1722 | 165 |
| 379 | 3300059490 | Ga0587066_044669 | Ga0587066_044669_179_679 | 165 |
| 380 | 3300059511 | Ga0587091_102011 | Ga0587091_102011_17_526 | 165 |
| 381 | 3300059639 | Ga0587062_053140 | Ga0587062_053140_164_673 | 165 |
| 382 | 3300060344 | Ga0587071_166826 | Ga0587071_166826_16_516 | 165 |
| 383 | 3300060346 | Ga0587111_0046074 | Ga0587111_0046074_33_533 | 165 |
| 384 | 3300005440 | Ga0070705_100761275 | Ga0070705_1007612751 | 166 |
| 385 | 3300005615 | Ga0070702_100957626 | Ga0070702_1009576261 | 166 |
| 386 | 3300005840 | Ga0068870_10798400 | Ga0068870_107984001 | 166 |
| 387 | 3300005981 | Ga0081538_10049220 | Ga0081538_100492202 | 166 |
| 388 | 3300005985 | Ga0081539_10053872 | Ga0081539_100538722 | 166 |
| 389 | 3300006852 | Ga0075433_10592096 | Ga0075433_105920962 | 166 |
| 390 | 3300006871 | Ga0075434_100899200 | Ga0075434_1008992001 | 166 |
| 391 | 3300013308 | Ga0157375_10025205 | Ga0157375_100252053 | 166 |
| 392 | 3300014325 | Ga0163163_10428262 | Ga0163163_104282623 | 166 |
| 393 | 3300025935 | Ga0207709_10871581 | Ga0207709_108715811 | 166 |
| 394 | 3300025936 | Ga0207670_10626618 | Ga0207670_106266182 | 166 |
| 395 | 3300031824 | Ga0307413_10945039 | Ga0307413_109450392 | 166 |
| 396 | 3300032002 | Ga0307416_101626981 | Ga0307416_1016269812 | 166 |
| 397 | 3300041486 | Ga0451807_1784760 | Ga0451807_1784760_98_610 | 166 |
| 398 | 3300042156 | Ga0439446_0012471 | Ga0439446_0012471_1145_1648 | 166 |
| 399 | 3300042876 | Ga0451577_0006115 | Ga0451577_0006115_3250_3753 | 166 |
| 400 | 3300044712 | Ga0453684_0030647 | Ga0453684_0030647_5869_6372 | 166 |
| 401 | 3300049587 | Ga0501071_1048446 | Ga0501071_1048446_70_573 | 166 |
| 402 | 3300059477 | Ga0587084_000788 | Ga0587084_000788_1713_2216 | 166 |
| 403 | 3300059478 | Ga0587093_022428 | Ga0587093_022428_291_794 | 166 |
| 404 | 3300059491 | Ga0587070_004038 | Ga0587070_004038_973_1476 | 166 |
| 405 | 3300059492 | Ga0587073_0100067 | Ga0587073_0100067_23_526 | 166 |
| 406 | 3300059493 | Ga0587077_020798 | Ga0587077_020798_175_678 | 166 |
| 407 | 3300059503 | Ga0587080_071696 | Ga0587080_071696_165_668 | 166 |
| 408 | 3300059504 | Ga0587082_038055 | Ga0587082_038055_328_831 | 166 |
| 409 | 3300059505 | Ga0587083_0003545 | Ga0587083_0003545_544_1047 | 166 |
| 410 | 3300059506 | Ga0587085_006608 | Ga0587085_006608_408_911 | 166 |
| 411 | 3300059507 | Ga0587086_041830 | Ga0587086_041830_168_671 | 166 |
| 412 | 3300059508 | Ga0587088_027312 | Ga0587088_027312_31_534 | 166 |
| 413 | 3300059511 | Ga0587091_110524 | Ga0587091_110524_17_520 | 166 |
| 414 | 3300059512 | Ga0587092_012392 | Ga0587092_012392_37_540 | 166 |
| 415 | 3300059513 | Ga0587094_017026 | Ga0587094_017026_489_992 | 166 |
| 416 | 3300059605 | Ga0587106_029306 | Ga0587106_029306_27_530 | 166 |
| 417 | 3300059607 | Ga0587125_015939 | Ga0587125_015939_16_519 | 166 |
| 418 | 3300059623 | Ga0587101_036472 | Ga0587101_036472_146_652 | 166 |
| 419 | 3300059623 | Ga0587101_123331 | Ga0587101_123331_19_522 | 166 |
| 420 | 3300059627 | Ga0587117_065611 | Ga0587117_065611_67_570 | 166 |
| 421 | 3300059639 | Ga0587062_065269 | Ga0587062_065269_96_599 | 166 |
| 422 | 3300059640 | Ga0587067_023222 | Ga0587067_023222_500_1009 | 166 |
| 423 | 3300059642 | Ga0587069_037409 | Ga0587069_037409_19_522 | 166 |
| 424 | 3300059643 | Ga0587072_021851 | Ga0587072_021851_597_1100 | 166 |
| 425 | 3300059645 | Ga0587076_048041 | Ga0587076_048041_50_553 | 166 |
| 426 | 3300059646 | Ga0587078_007699 | Ga0587078_007699_653_1156 | 166 |
| 427 | 3300059647 | Ga0587079_001936 | Ga0587079_001936_502_1005 | 166 |
| 428 | 3300059648 | Ga0587100_033367 | Ga0587100_033367_13_516 | 166 |
| 429 | 3300059649 | Ga0587102_044485 | Ga0587102_044485_31_534 | 166 |
| 430 | 3300059652 | Ga0587107_024791 | Ga0587107_024791_31_534 | 166 |
| 431 | 3300059654 | Ga0587110_022011 | Ga0587110_022011_176_679 | 166 |
| 432 | 3300060344 | Ga0587071_002128 | Ga0587071_002128_686_1189 | 166 |
| 433 | 3300060346 | Ga0587111_0002351 | Ga0587111_0002351_1083_1586 | 166 |
| 434 | 3300061734 | Ga0530510_0095465 | Ga0530510_0095465_496_999 | 166 |
| 435 | 2124908026 | MRS1a_Contig_146 | MRS1a_00008900 | 167 |
| 436 | 2162886011 | MRS1b_contig_3936707 | MRS1b_0752.00000090 | 167 |
| 437 | 3300005288 | Ga0065714_10002185 | Ga0065714_10002185140 | 167 |
| 438 | 3300005290 | Ga0065712_10016338 | Ga0065712_100163381 | 167 |
| 439 | 3300005290 | Ga0065712_10067734 | Ga0065712_1006773422 | 167 |
| 440 | 3300005290 | Ga0065712_10123424 | Ga0065712_101234242 | 167 |
| 441 | 3300005293 | Ga0065715_10089642 | Ga0065715_100896422 | 167 |
| 442 | 3300005293 | Ga0065715_10155088 | Ga0065715_101550882 | 167 |
| 443 | 3300005328 | Ga0070676_10009244 | Ga0070676_100092442 | 167 |
| 444 | 3300005331 | Ga0070670_100040328 | Ga0070670_1000403282 | 167 |
| 445 | 3300005340 | Ga0070689_100004561 | Ga0070689_1000045617 | 167 |
| 446 | 3300005340 | Ga0070689_100696239 | Ga0070689_1006962392 | 167 |
| 447 | 3300005354 | Ga0070675_100331981 | Ga0070675_1003319813 | 167 |
| 448 | 3300005365 | Ga0070688_100249604 | Ga0070688_1002496042 | 167 |
| 449 | 3300005444 | Ga0070694_100148372 | Ga0070694_1001483721 | 167 |
| 450 | 3300005445 | Ga0070708_100429241 | Ga0070708_1004292412 | 167 |
| 451 | 3300005518 | Ga0070699_100008853 | Ga0070699_1000088534 | 167 |
| 452 | 3300005536 | Ga0070697_100224016 | Ga0070697_1002240161 | 167 |
| 453 | 3300005545 | Ga0070695_100657646 | Ga0070695_1006576461 | 167 |
| 454 | 3300005549 | Ga0070704_100056839 | Ga0070704_1000568393 | 167 |
| 455 | 3300005617 | Ga0068859_100103525 | Ga0068859_1001035251 | 167 |
| 456 | 3300005842 | Ga0068858_101597237 | Ga0068858_1015972372 | 167 |
| 457 | 3300006038 | Ga0075365_10022649 | Ga0075365_100226492 | 167 |
| 458 | 3300006048 | Ga0075363_100138484 | Ga0075363_1001384842 | 167 |
| 459 | 3300006051 | Ga0075364_10015888 | Ga0075364_100158882 | 167 |
| 460 | 3300006353 | Ga0075370_10006444 | Ga0075370_100064442 | 167 |
| 461 | 3300006844 | Ga0075428_100316599 | Ga0075428_1003165992 | 167 |
| 462 | 3300006852 | Ga0075433_10040420 | Ga0075433_100404204 | 167 |
| 463 | 3300006931 | Ga0097620_100103523 | Ga0097620_1001035231 | 167 |
| 464 | 3300009094 | Ga0111539_10033293 | Ga0111539_100332937 | 167 |
| 465 | 3300009094 | Ga0111539_10060846 | Ga0111539_100608465 | 167 |
| 466 | 3300009101 | Ga0105247_10021665 | Ga0105247_100216652 | 167 |
| 467 | 3300009176 | Ga0105242_10000105 | Ga0105242_100001056 | 167 |
| 468 | 3300009553 | Ga0105249_10992031 | Ga0105249_109920312 | 167 |
| 469 | 3300010375 | Ga0105239_10977716 | Ga0105239_109777161 | 167 |
| 470 | 3300013308 | Ga0157375_11712218 | Ga0157375_117122181 | 167 |
| 471 | 3300014968 | Ga0157379_10830756 | Ga0157379_108307562 | 167 |
| 472 | 3300021358 | Ga0213873_10000004 | Ga0213873_10000004572 | 167 |
| 473 | 3300021384 | Ga0213876_10000007 | Ga0213876_10000007572 | 167 |
| 474 | 3300021384 | Ga0213876_10000620 | Ga0213876_1000062021 | 167 |
| 475 | 3300021388 | Ga0213875_10446114 | Ga0213875_104461141 | 167 |
| 476 | 3300025900 | Ga0207710_10016777 | Ga0207710_100167772 | 167 |
| 477 | 3300025907 | Ga0207645_10053795 | Ga0207645_100537951 | 167 |
| 478 | 3300025925 | Ga0207650_10045011 | Ga0207650_100450114 | 167 |
| 479 | 3300025925 | Ga0207650_10807856 | Ga0207650_108078561 | 167 |
| 480 | 3300025926 | Ga0207659_10266158 | Ga0207659_102661583 | 167 |
| 481 | 3300025934 | Ga0207686_10000064 | Ga0207686_1000006445 | 167 |
| 482 | 3300025935 | Ga0207709_10000150 | Ga0207709_1000015045 | 167 |
| 483 | 3300025941 | Ga0207711_10055203 | Ga0207711_100552031 | 167 |
| 484 | 3300025942 | Ga0207689_10581299 | Ga0207689_105812992 | 167 |
| 485 | 3300025986 | Ga0207658_10248920 | Ga0207658_102489202 | 167 |
| 486 | 3300027907 | Ga0207428_10046485 | Ga0207428_100464854 | 167 |
| 487 | 3300031903 | Ga0307407_10000463 | Ga0307407_100004636 | 167 |
| 488 | 3300031911 | Ga0307412_10000046 | Ga0307412_10000046145 | 167 |
| 489 | 3300032002 | Ga0307416_100002604 | Ga0307416_1000026044 | 167 |
| 490 | 3300032005 | Ga0307411_10146292 | Ga0307411_101462923 | 167 |
| 491 | 3300035115 | Ga0373941_0153321 | Ga0373941_0153321_293_796 | 167 |
| 492 | 3300035207 | Ga0373942_0009185 | Ga0373942_0009185_1655_2158 | 167 |
| 493 | 3300037853 | Ga0436364_0443686 | Ga0436364_0443686_92_607 | 167 |
| 494 | 3300039437 | Ga0436365_0748815 | Ga0436365_0748815_49894_50412 | 167 |
| 495 | 3300039437 | Ga0436365_1010975 | Ga0436365_1010975_10582_11091 | 167 |
| 496 | 3300039453 | Ga0436362_0290430 | Ga0436362_0290430_128432_128941 | 167 |
| 497 | 3300041408 | Ga0439453_0003316 | Ga0439453_0003316_1473_1979 | 167 |
| 498 | 3300042127 | Ga0450890_000006 | Ga0450890_000006_50189_50695 | 167 |
| 499 | 3300042129 | Ga0450891_000537 | Ga0450891_000537_1377_1883 | 167 |
| 500 | 3300042130 | Ga0450892_000002 | Ga0450892_000002_8284_8790 | 167 |
| 501 | 3300042532 | Ga0450893_0000217 | Ga0450893_0000217_4807_5313 | 167 |
| 502 | 3300042532 | Ga0450893_0000426 | Ga0450893_0000426_981_1487 | 167 |
| 503 | 3300042876 | Ga0451577_0001523 | Ga0451577_0001523_23145_23648 | 167 |
| 504 | 3300044712 | Ga0453684_0001943 | Ga0453684_0001943_6732_7235 | 167 |
| 505 | 3300044712 | Ga0453684_1002923 | Ga0453684_1002923_208_714 | 167 |
| 506 | 3300045051 | Ga0451576_0322975 | Ga0451576_0322975_70_573 | 167 |
| 507 | 3300048916 | Ga0496113_0108926 | Ga0496113_0108926_1509_2015 | 167 |
| 508 | 3300049571 | Ga0501034_0057650 | Ga0501034_0057650_971_1477 | 167 |
| 509 | 3300049571 | Ga0501034_0316207 | Ga0501034_0316207_444_956 | 167 |
| 510 | 3300049575 | Ga0501039_0084860 | Ga0501039_0084860_1012_1518 | 167 |
| 511 | 3300049579 | Ga0501043_0118002 | Ga0501043_0118002_645_1151 | 167 |
| 512 | 3300049583 | Ga0501067_0037433 | Ga0501067_0037433_690_1196 | 167 |
| 513 | 3300049583 | Ga0501067_0563058 | Ga0501067_0563058_104_610 | 167 |
| 514 | 3300049584 | Ga0501068_0015655 | Ga0501068_0015655_110_616 | 167 |
| 515 | 3300049584 | Ga0501068_0203783 | Ga0501068_0203783_24_530 | 167 |
| 516 | 3300049585 | Ga0501069_0009215 | Ga0501069_0009215_2012_2518 | 167 |
| 517 | 3300049586 | Ga0501070_0034481 | Ga0501070_0034481_2791_3297 | 167 |
| 518 | 3300049586 | Ga0501070_0175622 | Ga0501070_0175622_831_1337 | 167 |
| 519 | 3300049588 | Ga0501072_0301172 | Ga0501072_0301172_679_1185 | 167 |
| 520 | 3300049742 | Ga0501080_0148550 | Ga0501080_0148550_1035_1541 | 167 |
| 521 | 3300049742 | Ga0501080_0314265 | Ga0501080_0314265_817_1329 | 167 |
| 522 | 3300049744 | Ga0501083_0317153 | Ga0501083_0317153_140_652 | 167 |
| 523 | 3300050489 | nmdc:mga03683_114049_c1 | nmdc:mga03683_114049_c1_134_646 | 167 |
| 524 | 3300050490 | nmdc:mga03n38_121502_c1 | nmdc:mga03n38_121502_c1_63_569 | 167 |
| 525 | 3300050491 | nmdc:mga00v17_8931_c1 | nmdc:mga00v17_8931_c1_2201_2707 | 167 |
| 526 | 3300050492 | nmdc:mga0yw44_30110_c1 | nmdc:mga0yw44_30110_c1_1806_2312 | 167 |
| 527 | 3300050496 | nmdc:mga07m45_6620_c1 | nmdc:mga07m45_6620_c1_1808_2314 | 167 |
| 528 | 3300050508 | nmdc:mga09592_538451_c1 | nmdc:mga09592_538451_c1_223_729 | 167 |
| 529 | 3300050511 | nmdc:mga08y16_131786_c1 | nmdc:mga08y16_131786_c1_608_1114 | 167 |
| 530 | 3300050511 | nmdc:mga08y16_18309_c1 | nmdc:mga08y16_18309_c1_1221_1727 | 167 |
| 531 | 3300050515 | nmdc:mga0a205_84437_c1 | nmdc:mga0a205_84437_c1_1776_2282 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar