F460171

General Info

Members Datasets Scaffolds Average Seq Length
531 253 1062 88

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_2433424|Ga0466967_2433424_39_308
Length 89
Sequence MARDCTHFHEVDAARAGNTRGCEECLKTGDTWVHLRVCLTCGHVGCCDDSKNKHATRHFHATDHPVIRSGEPGETWGWCYVDRVVKDPV

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
241 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 2842711865 Duganella sp. R-73148 Isolate Unclassified
251 2857553236 Duganella sp. R-74557 Isolate Unclassified
252 2857558681 Duganella sp. R-74565 Isolate Unclassified
253 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 1.69
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0.38
Rhizoplane 5.46
Rhizosphere 87.38
Stem 0
Stem Tuber 0
Unclassified 5.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_2433424 3300045976 Bacteria 519
2 rootL2_10141155 3300003322 Bacteria 10739
3 rootL2_10184046 3300003322 Bacteria 1067
4 rootH1_10031474 3300003323 Bacteria 2525
5 Ga0007409J51694_1068802 3300003575 Bacteria 649
6 Ga0007409J51694_1074084 3300003575 Bacteria 938
7 Ga0055542_1017903 3300003762 Bacteria 1086
8 Ga0055529_1000032 3300003763 Bacteria 255895
9 Ga0070658_10303124 3300005327 Bacteria 1362
10 Ga0070676_11471901 3300005328 Bacteria 524
11 Ga0070690_100009091 3300005330 Bacteria 5748
12 Ga0068869_100001925 3300005334 Bacteria 12454
13 Ga0070680_100046164 3300005336 Bacteria 3543
14 Ga0070680_100261390 3300005336 Unclassified 1464
15 Ga0070680_101256629 3300005336 Bacteria 641
16 Ga0070660_100032113 3300005339 Bacteria 3949
17 Ga0070660_100275245 3300005339 Bacteria 1377
18 Ga0070689_100000352 3300005340 Bacteria 26994
19 Ga0070691_10060920 3300005341 Bacteria 1815
20 Ga0070687_100061496 3300005343 Bacteria 1985
21 Ga0070661_100326974 3300005344 Bacteria 1198
22 Ga0070692_10017384 3300005345 Bacteria 3438
23 Ga0070674_100040958 3300005356 Bacteria 3136
24 Ga0070659_100108305 3300005366 Bacteria 2241
25 Ga0070714_100215003 3300005435 Bacteria 1764
26 Ga0070701_10002209 3300005438 Bacteria 7434
27 Ga0070705_100017959 3300005440 Bacteria 3699
28 Ga0070700_100000307 3300005441 Bacteria 25564
29 Ga0070694_100320618 3300005444 Bacteria 1192
30 Ga0070663_101763982 3300005455 Unclassified 554
31 Ga0070663_101972322 3300005455 Bacteria 525
32 Ga0070678_100007835 3300005456 Bacteria 6356
33 Ga0070662_100486711 3300005457 Bacteria 1028
34 Ga0070662_100855391 3300005457 Bacteria 775
35 Ga0070681_10364787 3300005458 Unclassified 1355
36 Ga0070681_10613609 3300005458 Bacteria 1002
37 Ga0068867_100002843 3300005459 Bacteria 12169
38 Ga0070698_100009476 3300005471 Bacteria 10430
39 Ga0070699_100259188 3300005518 Unclassified 1555
40 Ga0070679_100262634 3300005530 Bacteria 1682
41 Ga0070679_100339826 3300005530 Unclassified 1449
42 Ga0070679_100368729 3300005530 Bacteria 1383
43 Ga0070679_101754395 3300005530 Bacteria 569
44 Ga0070684_100144607 3300005535 Unclassified 2152
45 Ga0070686_100000623 3300005544 Bacteria 20716
46 Ga0070686_100499147 3300005544 Bacteria 944
47 Ga0070696_100028624 3300005546 Bacteria 3803
48 Ga0070693_100029354 3300005547 Bacteria 2999
49 Ga0070665_100074557 3300005548 Bacteria 3399
50 Ga0070665_101605554 3300005548 Bacteria 658
51 Ga0070704_100037691 3300005549 Bacteria 3305
52 Ga0068855_100096610 3300005563 Bacteria 3403
53 Ga0068855_101325897 3300005563 Bacteria 744
54 Ga0068855_101886035 3300005563 Bacteria 606
55 Ga0068855_102277042 3300005563 Bacteria 543
56 Ga0070664_100162912 3300005564 Bacteria 1974
57 Ga0070664_100362764 3300005564 Bacteria 1320
58 Ga0070664_100784108 3300005564 Bacteria 890
59 Ga0068857_101922368 3300005577 Bacteria 580
60 Ga0068854_100913161 3300005578 Bacteria 772
61 Ga0068856_102629266 3300005614 Bacteria 509
62 Ga0068852_100087257 3300005616 Bacteria 2783
63 Ga0068852_101961717 3300005616 Bacteria 608
64 Ga0068859_100014484 3300005617 Bacteria 7916
65 Ga0068866_10000668 3300005718 Bacteria 15554
66 Ga0068861_100044819 3300005719 Bacteria 3328
67 Ga0068870_10034876 3300005840 Bacteria 2577
68 Ga0068860_100343642 3300005843 Bacteria 1468
69 Ga0070717_11340558 3300006028 Unclassified 650
70 Ga0075364_10073044 3300006051 Bacteria 2261
71 Ga0075364_11249329 3300006051 Bacteria 503
72 Ga0075362_10143227 3300006177 Bacteria 1143
73 Ga0068871_100051464 3300006358 Bacteria 3334
74 Ga0068865_100001688 3300006881 Bacteria 12938
75 Ga0097620_100014487 3300006931 Bacteria 7916
76 Ga0097620_102733394 3300006931 Bacteria 542
77 Ga0079104_1004163 3300006946 Bacteria 6320
78 Ga0099795_10122642 3300007788 Bacteria 1041
79 Ga0105244_10007241 3300009036 Bacteria 7070
80 Ga0105245_10002543 3300009098 Bacteria 16442
81 Ga0105243_10002271 3300009148 Bacteria 16137
82 Ga0105241_10011083 3300009174 Bacteria 6616
83 Ga0105242_10001426 3300009176 Bacteria 18840
84 Ga0105242_10061016 3300009176 Bacteria 3100
85 Ga0105237_11577449 3300009545 Bacteria 663
86 Ga0105249_10030095 3300009553 Bacteria 4905
87 Ga0105239_10072829 3300010375 Bacteria 3777
88 Ga0105246_10141980 3300011119 Bacteria 1807
89 Ga0105246_10512328 3300011119 Bacteria 1021
90 Ga0157373_10410616 3300013100 Bacteria 971
91 Ga0157371_10732998 3300013102 Unclassified 741
92 Ga0157370_10341821 3300013104 Unclassified 1379
93 Ga0157370_10571696 3300013104 Bacteria 1036
94 Ga0157370_10820563 3300013104 Bacteria 846
95 Ga0157369_10132935 3300013105 Unclassified 2636
96 Ga0157369_10458381 3300013105 Unclassified 1320
97 Ga0157369_10761644 3300013105 Bacteria 996
98 Ga0157374_10486122 3300013296 Bacteria 1238
99 Ga0157378_10334657 3300013297 Bacteria 1474
100 Ga0163162_10045345 3300013306 Bacteria 4405
101 Ga0157372_10264708 3300013307 Bacteria 1996
102 Ga0157372_12381446 3300013307 Bacteria 608
103 Ga0157372_12602506 3300013307 Bacteria 581
104 Ga0157375_10219141 3300013308 Bacteria 2061
105 Ga0163163_10079931 3300014325 Bacteria 3268
106 Ga0157380_10028196 3300014326 Bacteria 4278
107 Ga0157379_10058033 3300014968 Bacteria 3459
108 Ga0157376_10200664 3300014969 Unclassified 1835
109 Ga0182006_1000054 3300015261 Bacteria 174021
110 Ga0197907_10037180 3300020069 Bacteria 606
111 Ga0206355_1428240 3300020076 Unclassified 507
112 Ga0206350_11361961 3300020080 Bacteria 861
113 Ga0213872_10064375 3300021361 Bacteria 1656
114 Ga0224712_10311587 3300022467 Bacteria 738
115 Ga0224712_10673516 3300022467 Bacteria 508
116 Ga0209437_101493 3300025233 Bacteria 5588
117 Ga0209026_1027131 3300025250 Bacteria 859
118 Ga0209148_1000540 3300025254 Bacteria 36402
119 Ga0209455_1000043 3300025272 Bacteria 413928
120 Ga0207655_1047229 3300025728 Bacteria 1778
121 Ga0207642_10019726 3300025899 Bacteria 2617
122 Ga0207643_10035060 3300025908 Bacteria 2812
123 Ga0207705_10002628 3300025909 Bacteria 13774
124 Ga0207684_10349922 3300025910 Bacteria 1272
125 Ga0207654_10001339 3300025911 Bacteria 13071
126 Ga0207707_10359806 3300025912 Bacteria 1253
127 Ga0207707_11414544 3300025912 Unclassified 554
128 Ga0207660_10072216 3300025917 Bacteria 2513
129 Ga0207660_10149505 3300025917 Bacteria 1793
130 Ga0207662_10036713 3300025918 Bacteria 2865
131 Ga0207657_10008422 3300025919 Bacteria 10467
132 Ga0207657_10090154 3300025919 Bacteria 2559
133 Ga0207652_10225612 3300025921 Unclassified 1688
134 Ga0207652_11372929 3300025921 Unclassified 610
135 Ga0207694_10296225 3300025924 Bacteria 1331
136 Ga0207687_10004630 3300025927 Bacteria 9150
137 Ga0207664_11456471 3300025929 Bacteria 606
138 Ga0207690_10211871 3300025932 Bacteria 1478
139 Ga0207706_10833512 3300025933 Bacteria 782
140 Ga0207706_10875239 3300025933 Bacteria 760
141 Ga0207706_11060374 3300025933 Bacteria 679
142 Ga0207686_10003292 3300025934 Bacteria 8686
143 Ga0207686_10050771 3300025934 Bacteria 2581
144 Ga0207686_10108600 3300025934 Bacteria 1867
145 Ga0207709_10086885 3300025935 Bacteria 2032
146 Ga0207669_10036940 3300025937 Bacteria 2797
147 Ga0207704_10017647 3300025938 Bacteria 3706
148 Ga0207689_10001688 3300025942 Bacteria 20979
149 Ga0207689_10933275 3300025942 Bacteria 732
150 Ga0207679_10141499 3300025945 Bacteria 1945
151 Ga0207679_10395920 3300025945 Bacteria 1214
152 Ga0207679_11553223 3300025945 Bacteria 607
153 Ga0207667_10106694 3300025949 Bacteria 2889
154 Ga0207667_10619817 3300025949 Unclassified 1090
155 Ga0207667_10645022 3300025949 Bacteria 1065
156 Ga0207667_10706632 3300025949 Bacteria 1010
157 Ga0207667_10900057 3300025949 Bacteria 877
158 Ga0207712_10123716 3300025961 Bacteria 1961
159 Ga0207639_11012117 3300026041 Bacteria 778
160 Ga0207678_11038661 3300026067 Bacteria 725
161 Ga0207708_10001448 3300026075 Bacteria 17783
162 Ga0207648_10000178 3300026089 Bacteria 66611
163 Ga0207648_11207441 3300026089 Bacteria 710
164 Ga0207674_10399523 3300026116 Bacteria 1328
165 Ga0207675_100001081 3300026118 Bacteria 27001
166 Ga0207675_100402239 3300026118 Bacteria 1349
167 Ga0207683_10061163 3300026121 Bacteria 3314
168 Ga0207698_10104105 3300026142 Bacteria 2361
169 Ga0207698_10105331 3300026142 Bacteria 2350
170 Ga0209281_1003549 3300027111 Bacteria 5091
171 Ga0268266_10010281 3300028379 Bacteria 8192
172 Ga0268266_11582496 3300028379 Bacteria 631
173 Ga0268264_10241117 3300028381 Bacteria 1674
174 Ga0316181_1247882 3300030744 Bacteria 3322
175 Ga0316576_10046459 3300031727 Bacteria 3143
176 Ga0316576_10915177 3300031727 Unclassified 628
177 Ga0316576_10979909 3300031727 Bacteria 603
178 Ga0316576_11131815 3300031727 Bacteria 554
179 Ga0316578_10356649 3300031728 Bacteria 870
180 Ga0307416_102061466 3300032002 Bacteria 673
181 Ga0307415_101078390 3300032126 Bacteria 751
182 Ga0316574_0231038 3300035398 Bacteria 1184
183 Ga0316574_0688221 3300035398 Unclassified 628
184 Ga0395899_0014881 3300037312 Bacteria 5936
185 Ga0395899_0026315 3300037312 Bacteria 4389
186 Ga0395899_0051671 3300037312 Unclassified 3049
187 Ga0395899_0062501 3300037312 Bacteria 2742
188 Ga0395899_0266983 3300037312 Bacteria 1168
189 Ga0395899_0276219 3300037312 Bacteria 1144
190 Ga0395899_0425226 3300037312 Bacteria 874
191 Ga0395899_0629081 3300037312 Bacteria 680
192 Ga0395899_0650289 3300037312 Bacteria 666
193 Ga0395899_0997218 3300037312 Bacteria 505
194 Ga0395900_0001983 3300037418 Bacteria 23113
195 Ga0395900_0004330 3300037418 Bacteria 15054
196 Ga0395900_0061620 3300037418 Bacteria 3857
197 Ga0395900_0139766 3300037418 Bacteria 2480
198 Ga0395900_0183998 3300037418 Bacteria 2121
199 Ga0395900_0267704 3300037418 Bacteria 1704
200 Ga0395900_0391115 3300037418 Bacteria 1356
201 Ga0395900_0405512 3300037418 Bacteria 1326
202 Ga0395900_0511034 3300037418 Bacteria 1150
203 Ga0395900_0541705 3300037418 Bacteria 1109
204 Ga0395900_0825999 3300037418 Bacteria 853
205 Ga0395898_0026216 3300037466 Bacteria 5867
206 Ga0395898_0049981 3300037466 Bacteria 4094
207 Ga0395898_0119329 3300037466 Bacteria 2526
208 Ga0395898_0184108 3300037466 Bacteria 1996
209 Ga0395898_0238768 3300037466 Bacteria 1733
210 Ga0395898_0502973 3300037466 Bacteria 1152
211 Ga0395898_0566353 3300037466 Bacteria 1078
212 Ga0395898_1165527 3300037466 Bacteria 702
213 Ga0395898_1195790 3300037466 Bacteria 691
214 Ga0395898_1455977 3300037466 Bacteria 612
215 Ga0395898_1584261 3300037466 Bacteria 579
216 Ga0395905_0111285 3300037471 Bacteria 2571
217 Ga0395905_0152014 3300037471 Bacteria 2177
218 Ga0395905_0167110 3300037471 Bacteria 2067
219 Ga0395905_0218641 3300037471 Bacteria 1783
220 Ga0395905_0240320 3300037471 Bacteria 1692
221 Ga0395905_0278299 3300037471 Bacteria 1559
222 Ga0395905_1414914 3300037471 Bacteria 599
223 Ga0395905_1537731 3300037471 Bacteria 570
224 Ga0436364_0500499 3300037853 Bacteria 2272
225 Ga0436364_0505738 3300037853 Bacteria 688
226 Ga0395901_0005695 3300038443 Bacteria 12606
227 Ga0395901_0066065 3300038443 Bacteria 3767
228 Ga0395901_0121532 3300038443 Bacteria 2744
229 Ga0395901_0221091 3300038443 Bacteria 1979
230 Ga0395901_0455105 3300038443 Bacteria 1308
231 Ga0395901_0550455 3300038443 Bacteria 1169
232 Ga0395901_0583205 3300038443 Bacteria 1129
233 Ga0395901_0652496 3300038443 Bacteria 1055
234 Ga0395901_1008408 3300038443 Bacteria 808
235 Ga0395901_1142749 3300038443 Bacteria 747
236 Ga0395901_1169795 3300038443 Bacteria 736
237 Ga0395901_1654179 3300038443 Bacteria 592
238 Ga0436361_0188289 3300039447 Bacteria 5410
239 Ga0439445_0068863 3300042004 Bacteria 977
240 Ga0439448_0047296 3300042005 Bacteria 1403
241 Ga0439448_0158878 3300042005 Bacteria 786
242 Ga0439448_0326091 3300042005 Bacteria 546
243 Ga0439450_216739 3300042008 Bacteria 515
244 Ga0439455_0005954 3300042012 Bacteria 2505
245 Ga0439455_0061747 3300042012 Bacteria 995
246 Ga0466969_0065849 3300044656 Bacteria 1751
247 Ga0466969_0268055 3300044656 Bacteria 773
248 Ga0466969_0292573 3300044656 Bacteria 737
249 Ga0466972_0001460 3300044658 Bacteria 11498
250 Ga0466972_0156773 3300044658 Bacteria 1070
251 Ga0466972_0256624 3300044658 Bacteria 817
252 Ga0466965_0005682 3300044683 Bacteria 5628
253 Ga0466965_0039101 3300044683 Bacteria 2331
254 Ga0466965_0255735 3300044683 Bacteria 940
255 Ga0466966_0010138 3300044684 Bacteria 6250
256 Ga0466966_0016521 3300044684 Bacteria 4873
257 Ga0466966_0018191 3300044684 Bacteria 4637
258 Ga0466966_0029924 3300044684 Bacteria 3540
259 Ga0466966_0114550 3300044684 Unclassified 1660
260 Ga0466966_0304609 3300044684 Bacteria 957
261 Ga0466961_0095838 3300044693 Bacteria 1871
262 Ga0466961_0114070 3300044693 Bacteria 1699
263 Ga0466964_0054421 3300044706 Bacteria 1649
264 Ga0466971_0077315 3300044719 Bacteria 1515
265 Ga0466971_0092626 3300044719 Bacteria 1384
266 Ga0466968_0000650 3300044735 Bacteria 11870
267 Ga0466968_0105041 3300044735 Bacteria 1265
268 Ga0466970_0206638 3300044765 Bacteria 1093
269 Ga0466970_0249398 3300044765 Bacteria 994
270 Ga0466970_0301206 3300044765 Bacteria 904
271 Ga0466957_0032357 3300044842 Bacteria 3131
272 Ga0466957_0044643 3300044842 Bacteria 2686
273 Ga0466957_0432416 3300044842 Bacteria 904
274 Ga0466957_0635676 3300044842 Bacteria 749
275 Ga0466957_0643530 3300044842 Bacteria 745
276 Ga0466960_0025761 3300044901 Bacteria 2665
277 Ga0466959_0030088 3300045049 Bacteria 4021
278 Ga0466959_0105440 3300045049 Bacteria 2015
279 Ga0466959_0199911 3300045049 Bacteria 1392
280 Ga0466959_0306361 3300045049 Bacteria 1087
281 Ga0466959_0334724 3300045049 Bacteria 1033
282 Ga0466959_0367145 3300045049 Bacteria 980
283 Ga0466958_0075395 3300045836 Bacteria 2069
284 Ga0466958_0387531 3300045836 Bacteria 901
285 Ga0466958_0639514 3300045836 Bacteria 692
286 Ga0466958_0690154 3300045836 Bacteria 665
287 Ga0466958_0754465 3300045836 Bacteria 634
288 Ga0466967_0118978 3300045976 Bacteria 2437
289 Ga0466967_1113779 3300045976 Bacteria 787
290 Ga0495617_000008 3300046452 Bacteria 340369
291 Ga0495627_000007 3300046453 Bacteria 575915
292 Ga0495627_000812 3300046453 Bacteria 22811
293 Ga0495627_027666 3300046453 Bacteria 1817
294 Ga0495603_0049141 3300046455 Bacteria 2511
295 Ga0495590_0217418 3300046457 Bacteria 705
296 Ga0495638_0082568 3300046460 Bacteria 1949
297 Ga0495638_0193922 3300046460 Bacteria 1151
298 Ga0495653_0586026 3300046463 Bacteria 687
299 Ga0495650_0000097 3300046471 Bacteria 216051
300 Ga0495605_0000083 3300046474 Bacteria 124953
301 Ga0495605_0000237 3300046474 Bacteria 66607
302 Ga0495605_0017599 3300046474 Bacteria 3843
303 Ga0495605_0098203 3300046474 Bacteria 1349
304 Ga0495605_0211168 3300046474 Bacteria 842
305 Ga0495584_0001125 3300046491 Bacteria 16574
306 Ga0495584_0019610 3300046491 Bacteria 3435
307 Ga0495584_0058910 3300046491 Bacteria 1932
308 Ga0495585_0002256 3300046492 Bacteria 13935
309 Ga0495585_0014871 3300046492 Bacteria 4526
310 Ga0495585_0233160 3300046492 Bacteria 924
311 Ga0495585_0386255 3300046492 Bacteria 676
312 Ga0495585_0475931 3300046492 Bacteria 595
313 Ga0495596_0001966 3300046500 Bacteria 11343
314 Ga0495596_0007400 3300046500 Bacteria 4954
315 Ga0495596_0045654 3300046500 Bacteria 1722
316 Ga0495596_0064529 3300046500 Bacteria 1424
317 Ga0495607_0001272 3300046501 Bacteria 22537
318 Ga0495607_0005692 3300046501 Bacteria 8880
319 Ga0495607_0046384 3300046501 Bacteria 2552
320 Ga0495607_0122725 3300046501 Bacteria 1361
321 Ga0495607_0324469 3300046501 Bacteria 717
322 Ga0495583_0001390 3300046506 Bacteria 24725
323 Ga0495583_0005925 3300046506 Bacteria 8120
324 Ga0495583_0019194 3300046506 Bacteria 3575
325 Ga0495583_0032899 3300046506 Bacteria 2499
326 Ga0495606_0002328 3300046507 Bacteria 22395
327 Ga0495606_0002614 3300046507 Bacteria 20565
328 Ga0495606_0029323 3300046507 Bacteria 3866
329 Ga0495606_0070837 3300046507 Bacteria 2197
330 Ga0495606_0323481 3300046507 Bacteria 828
331 Ga0495606_0409983 3300046507 Bacteria 703
332 Ga0495610_0011778 3300046512 Bacteria 5313
333 Ga0495610_0017107 3300046512 Bacteria 4144
334 Ga0495610_0105129 3300046512 Bacteria 1258
335 Ga0495610_0168152 3300046512 Bacteria 922
336 Ga0495616_0002355 3300046513 Bacteria 12586
337 Ga0495616_0002368 3300046513 Bacteria 12560
338 Ga0495616_0012719 3300046513 Bacteria 4766
339 Ga0495616_0013365 3300046513 Bacteria 4631
340 Ga0495616_0065663 3300046513 Bacteria 1767
341 Ga0495616_0074524 3300046513 Bacteria 1635
342 Ga0495631_0010034 3300046518 Bacteria 4704
343 Ga0495631_0011265 3300046518 Bacteria 4402
344 Ga0495631_0100391 3300046518 Bacteria 1245
345 Ga0495632_0000413 3300046519 Bacteria 40473
346 Ga0495632_0000499 3300046519 Bacteria 36966
347 Ga0495637_0290008 3300046520 Unclassified 582
348 Ga0495643_0000099 3300046522 Bacteria 145425
349 Ga0495643_0006148 3300046522 Bacteria 7975
350 Ga0495643_0011268 3300046522 Bacteria 5455
351 Ga0495643_0051427 3300046522 Bacteria 2215
352 Ga0495643_0097424 3300046522 Bacteria 1511
353 Ga0495644_0055938 3300046523 Bacteria 1482
354 Ga0495644_0227214 3300046523 Bacteria 722
355 Ga0495648_0002936 3300046524 Bacteria 15301
356 Ga0495648_0003566 3300046524 Bacteria 13618
357 Ga0495648_0027505 3300046524 Bacteria 3805
358 Ga0495642_0000496 3300046528 Bacteria 20192
359 Ga0495642_0000547 3300046528 Bacteria 18912
360 Ga0495642_0001020 3300046528 Bacteria 13014
361 Ga0495642_0011315 3300046528 Bacteria 3426
362 Ga0495642_0080491 3300046528 Bacteria 1371
363 Ga0495642_0114118 3300046528 Bacteria 1156
364 Ga0495642_0169145 3300046528 Bacteria 949
365 Ga0495654_0002638 3300046530 Bacteria 11407
366 Ga0495609_0000039 3300046538 Bacteria 179384
367 Ga0495609_0001302 3300046538 Bacteria 17020
368 Ga0495609_0033002 3300046538 Bacteria 2350
369 Ga0495597_0000690 3300046542 Bacteria 27246
370 Ga0495597_0151220 3300046542 Bacteria 952
371 Ga0495645_0136639 3300046543 Bacteria 1714
372 Ga0495633_0000117 3300046558 Bacteria 108053
373 Ga0495633_0324468 3300046558 Bacteria 698
374 Ga0495656_0015456 3300046615 Bacteria 2881
375 Ga0495656_0115279 3300046615 Bacteria 1262
376 Ga0495656_0196425 3300046615 Bacteria 999
377 Ga0495668_0007802 3300046616 Bacteria 6785
378 Ga0495668_0010168 3300046616 Bacteria 5719
379 Ga0495668_0119658 3300046616 Bacteria 1440
380 Ga0495668_0227777 3300046616 Bacteria 1020
381 Ga0495668_0446830 3300046616 Bacteria 711
382 Ga0495611_0025124 3300046648 Bacteria 2594
383 Ga0495625_0003442 3300046660 Bacteria 15787
384 Ga0495625_0008666 3300046660 Bacteria 8645
385 Ga0495625_0041501 3300046660 Bacteria 3349
386 Ga0495661_0000638 3300046665 Bacteria 35563
387 Ga0495661_0000893 3300046665 Bacteria 27549
388 Ga0495661_0001460 3300046665 Bacteria 19792
389 Ga0495661_0081937 3300046665 Bacteria 1858
390 Ga0495661_0090470 3300046665 Bacteria 1742
391 Ga0495661_0112591 3300046665 Bacteria 1514
392 Ga0495661_0227734 3300046665 Bacteria 962
393 Ga0495588_0000055 3300046674 Bacteria 280059
394 Ga0495669_0000309 3300046684 Bacteria 26974
395 Ga0495669_0044133 3300046684 Bacteria 1985
396 Ga0495670_0045327 3300046691 Bacteria 2195
397 Ga0495670_0067656 3300046691 Bacteria 1803
398 Ga0495670_0079788 3300046691 Bacteria 1666
399 Ga0495671_0001079 3300046692 Bacteria 18889
400 Ga0495671_0002612 3300046692 Bacteria 11331
401 Ga0495671_0178193 3300046692 Bacteria 1032
402 Ga0495649_0019135 3300046694 Bacteria 3848
403 Ga0495649_0296803 3300046694 Bacteria 823
404 Ga0495649_0390444 3300046694 Bacteria 699
405 Ga0495589_0000097 3300046794 Bacteria 84037
406 Ga0495589_0000596 3300046794 Bacteria 24656
407 Ga0495589_0001279 3300046794 Bacteria 14890
408 Ga0495589_0036938 3300046794 Bacteria 2448
409 Ga0495660_0000107 3300046810 Bacteria 89427
410 Ga0495660_0000191 3300046810 Bacteria 64407
411 Ga0495660_0000245 3300046810 Bacteria 53011
412 Ga0495660_0020168 3300046810 Bacteria 3822
413 Ga0495660_0031029 3300046810 Bacteria 3007
414 Ga0495660_0092321 3300046810 Bacteria 1571
415 Ga0495660_0143350 3300046810 Bacteria 1186
416 Ga0495660_0331525 3300046810 Bacteria 681
417 Ga0495660_0427577 3300046810 Unclassified 576
418 Ga0495672_0000277 3300047320 Bacteria 71082
419 Ga0495672_0004878 3300047320 Bacteria 10790
420 Ga0495680_0924646 3300047322 Bacteria 562
421 Ga0495683_0045514 3300047323 Bacteria 2205
422 Ga0495683_0144697 3300047323 Bacteria 1111
423 Ga0495683_0194130 3300047323 Bacteria 919
424 Ga0495683_0378812 3300047323 Bacteria 592
425 Ga0495687_000059 3300047443 Bacteria 179357
426 Ga0495687_000189 3300047443 Bacteria 89686
427 Ga0495687_001606 3300047443 Bacteria 20392
428 Ga0495687_002661 3300047443 Bacteria 13919
429 Ga0495687_207753 3300047443 Bacteria 616
430 Ga0495677_0000006 3300047445 Bacteria 199230
431 Ga0495677_0002600 3300047445 Bacteria 7061
432 Ga0495677_0005945 3300047445 Bacteria 4621
433 Ga0495677_0020849 3300047445 Bacteria 2376
434 Ga0495677_0122500 3300047445 Bacteria 992
435 Ga0495677_0176847 3300047445 Bacteria 826
436 Ga0495677_0284904 3300047445 Bacteria 648
437 Ga0495679_011690 3300047446 Bacteria 3373
438 Ga0495685_177734 3300047447 Bacteria 686
439 Ga0495685_210414 3300047447 Bacteria 622
440 Ga0495681_0000842 3300047470 Bacteria 23620
441 Ga0495681_0002516 3300047470 Bacteria 13054
442 Ga0495681_0019012 3300047470 Bacteria 3765
443 Ga0495681_0043749 3300047470 Bacteria 2157
444 Ga0495686_0000967 3300047472 Bacteria 35382
445 Ga0495686_0062504 3300047472 Bacteria 2309
446 Ga0495626_0000121 3300048091 Bacteria 102193
447 Ga0495626_0002632 3300048091 Bacteria 12204
448 Ga0495626_0031353 3300048091 Bacteria 2559
449 Ga0495626_0083287 3300048091 Bacteria 1417
450 Ga0496101_0589117 3300048904 Bacteria 879
451 Ga0496102_0000645 3300048905 Bacteria 35369
452 Ga0496102_0007732 3300048905 Bacteria 9185
453 Ga0496102_0115411 3300048905 Bacteria 2505
454 Ga0496102_0137053 3300048905 Bacteria 2294
455 Ga0496102_0183731 3300048905 Bacteria 1970
456 Ga0496102_0205074 3300048905 Bacteria 1859
457 Ga0496103_0001589 3300048906 Bacteria 14964
458 Ga0496103_0188370 3300048906 Bacteria 1326
459 Ga0496103_0292582 3300048906 Bacteria 1048
460 Ga0496103_0858659 3300048906 Bacteria 570
461 Ga0496105_0280815 3300048908 Bacteria 1343
462 Ga0496105_0748293 3300048908 Bacteria 747
463 Ga0496106_0067509 3300048909 Bacteria 2726
464 Ga0496106_1163510 3300048909 Bacteria 603
465 Ga0496107_0043276 3300048910 Bacteria 3235
466 Ga0496107_0065502 3300048910 Bacteria 2634
467 Ga0496108_0643833 3300048911 Bacteria 922
468 Ga0496109_0305310 3300048912 Bacteria 1501
469 Ga0496109_0447011 3300048912 Bacteria 1221
470 Ga0496110_0000001 3300048913 Bacteria 232652
471 Ga0496110_0601247 3300048913 Bacteria 998
472 Ga0496110_0880425 3300048913 Bacteria 801
473 Ga0496111_0440813 3300048914 Bacteria 961
474 Ga0496111_1175016 3300048914 Bacteria 545
475 Ga0496112_0285497 3300048915 Bacteria 1597
476 Ga0496112_1650948 3300048915 Bacteria 554
477 Ga0496113_0001620 3300048916 Bacteria 12670
478 Ga0496113_0490485 3300048916 Bacteria 987
479 Ga0496116_0066152 3300048919 Bacteria 2314
480 Ga0496121_0642312 3300048924 Bacteria 648
481 Ga0496122_0003300 3300048925 Bacteria 21355
482 Ga0496122_0012483 3300048925 Bacteria 8449
483 Ga0496123_0003071 3300048926 Bacteria 19182
484 Ga0496123_0033697 3300048926 Bacteria 3680
485 Ga0496124_0008117 3300048927 Bacteria 11024
486 Ga0496124_0013707 3300048927 Bacteria 7894
487 Ga0496124_0021821 3300048927 Bacteria 5889
488 Ga0496124_0059608 3300048927 Bacteria 3205
489 Ga0496124_0063110 3300048927 Bacteria 3097
490 Ga0496124_0087679 3300048927 Bacteria 2545
491 Ga0496124_0113520 3300048927 Bacteria 2177
492 Ga0496125_0073567 3300048928 Bacteria 2656
493 Ga0496125_0579145 3300048928 Bacteria 617
494 Ga0496126_0421645 3300048929 Bacteria 1079
495 Ga0495678_000004 3300049459 Bacteria 532920
496 Ga0495678_000165 3300049459 Bacteria 77667
497 Ga0495678_001020 3300049459 Bacteria 23851
498 Ga0495678_001126 3300049459 Bacteria 22215
499 Ga0495682_0002495 3300049460 Bacteria 8699
500 Ga0495682_0003061 3300049460 Bacteria 7600
501 Ga0501033_0342386 3300049570 Bacteria 1048
502 Ga0501034_0008394 3300049571 Bacteria 10917
503 Ga0501037_0330939 3300049573 Bacteria 1053
504 Ga0501038_0075230 3300049574 Bacteria 2855
505 Ga0501043_0049498 3300049579 Bacteria 3304
506 Ga0501046_0482546 3300049580 Bacteria 889
507 Ga0501046_0648696 3300049580 Unclassified 746
508 Ga0501047_0007387 3300049581 Bacteria 10336
509 Ga0501070_0073746 3300049586 Bacteria 2824
510 Ga0501071_0976769 3300049587 Bacteria 654
511 Ga0501071_1014627 3300049587 Unclassified 641
512 Ga0501073_0069187 3300049589 Bacteria 2460
513 Ga0501074_1149028 3300049590 Unclassified 545
514 Ga0501075_1394454 3300049591 Unclassified 531
515 Ga0501249_202655 3300049679 Bacteria 521
516 Ga0501080_1762446 3300049742 Unclassified 521
517 Ga0501269_000296 3300049766 Bacteria 13571
518 Ga0501279_051444 3300049775 Bacteria 654
519 Ga0501035_0010475 3300049822 Bacteria 8592
520 Ga0501044_0004495 3300049823 Bacteria 15597
521 nmdc:mga03683_414667_c1 3300050489 Bacteria 644
522 nmdc:mga03683_73347_c1 3300050489 Bacteria 1467
523 nmdc:mga00v17_322469_c1 3300050491 Bacteria 1004
524 Ga0587067_078068 3300059640 Bacteria 728
525 Ga0587072_090274 3300059643 Bacteria 674
526 Ga0501082_0197697 3300060353 Bacteria 1749
527 Ga0466962_0605892 3300061719 Bacteria 558
528 2842715680 2842711865 Bacteria 7155354
529 2857554672 2857553236 Bacteria 6166726
530 2857561719 2857558681 Bacteria 6617694
531 2904425612 2904424332 Bacteria 7633521
532 Ga0466967_2433424
533 rootL2_10141155
534 rootL2_10184046
535 rootH1_10031474
536 Ga0007409J51694_1068802
537 Ga0007409J51694_1074084
538 Ga0055542_1017903
539 Ga0055529_1000032
540 Ga0070658_10303124
541 Ga0070676_11471901
542 Ga0070690_100009091
543 Ga0068869_100001925
544 Ga0070680_100046164
545 Ga0070680_100261390
546 Ga0070680_101256629
547 Ga0070660_100032113
548 Ga0070660_100275245
549 Ga0070689_100000352
550 Ga0070691_10060920
551 Ga0070687_100061496
552 Ga0070661_100326974
553 Ga0070692_10017384
554 Ga0070674_100040958
555 Ga0070659_100108305
556 Ga0070714_100215003
557 Ga0070701_10002209
558 Ga0070705_100017959
559 Ga0070700_100000307
560 Ga0070694_100320618
561 Ga0070663_101763982
562 Ga0070663_101972322
563 Ga0070678_100007835
564 Ga0070662_100486711
565 Ga0070662_100855391
566 Ga0070681_10364787
567 Ga0070681_10613609
568 Ga0068867_100002843
569 Ga0070698_100009476
570 Ga0070699_100259188
571 Ga0070679_100262634
572 Ga0070679_100339826
573 Ga0070679_100368729
574 Ga0070679_101754395
575 Ga0070684_100144607
576 Ga0070686_100000623
577 Ga0070686_100499147
578 Ga0070696_100028624
579 Ga0070693_100029354
580 Ga0070665_100074557
581 Ga0070665_101605554
582 Ga0070704_100037691
583 Ga0068855_100096610
584 Ga0068855_101325897
585 Ga0068855_101886035
586 Ga0068855_102277042
587 Ga0070664_100162912
588 Ga0070664_100362764
589 Ga0070664_100784108
590 Ga0068857_101922368
591 Ga0068854_100913161
592 Ga0068856_102629266
593 Ga0068852_100087257
594 Ga0068852_101961717
595 Ga0068859_100014484
596 Ga0068866_10000668
597 Ga0068861_100044819
598 Ga0068870_10034876
599 Ga0068860_100343642
600 Ga0070717_11340558
601 Ga0075364_10073044
602 Ga0075364_11249329
603 Ga0075362_10143227
604 Ga0068871_100051464
605 Ga0068865_100001688
606 Ga0097620_100014487
607 Ga0097620_102733394
608 Ga0079104_1004163
609 Ga0099795_10122642
610 Ga0105244_10007241
611 Ga0105245_10002543
612 Ga0105243_10002271
613 Ga0105241_10011083
614 Ga0105242_10001426
615 Ga0105242_10061016
616 Ga0105237_11577449
617 Ga0105249_10030095
618 Ga0105239_10072829
619 Ga0105246_10141980
620 Ga0105246_10512328
621 Ga0157373_10410616
622 Ga0157371_10732998
623 Ga0157370_10341821
624 Ga0157370_10571696
625 Ga0157370_10820563
626 Ga0157369_10132935
627 Ga0157369_10458381
628 Ga0157369_10761644
629 Ga0157374_10486122
630 Ga0157378_10334657
631 Ga0163162_10045345
632 Ga0157372_10264708
633 Ga0157372_12381446
634 Ga0157372_12602506
635 Ga0157375_10219141
636 Ga0163163_10079931
637 Ga0157380_10028196
638 Ga0157379_10058033
639 Ga0157376_10200664
640 Ga0182006_1000054
641 Ga0197907_10037180
642 Ga0206355_1428240
643 Ga0206350_11361961
644 Ga0213872_10064375
645 Ga0224712_10311587
646 Ga0224712_10673516
647 Ga0209437_101493
648 Ga0209026_1027131
649 Ga0209148_1000540
650 Ga0209455_1000043
651 Ga0207655_1047229
652 Ga0207642_10019726
653 Ga0207643_10035060
654 Ga0207705_10002628
655 Ga0207684_10349922
656 Ga0207654_10001339
657 Ga0207707_10359806
658 Ga0207707_11414544
659 Ga0207660_10072216
660 Ga0207660_10149505
661 Ga0207662_10036713
662 Ga0207657_10008422
663 Ga0207657_10090154
664 Ga0207652_10225612
665 Ga0207652_11372929
666 Ga0207694_10296225
667 Ga0207687_10004630
668 Ga0207664_11456471
669 Ga0207690_10211871
670 Ga0207706_10833512
671 Ga0207706_10875239
672 Ga0207706_11060374
673 Ga0207686_10003292
674 Ga0207686_10050771
675 Ga0207686_10108600
676 Ga0207709_10086885
677 Ga0207669_10036940
678 Ga0207704_10017647
679 Ga0207689_10001688
680 Ga0207689_10933275
681 Ga0207679_10141499
682 Ga0207679_10395920
683 Ga0207679_11553223
684 Ga0207667_10106694
685 Ga0207667_10619817
686 Ga0207667_10645022
687 Ga0207667_10706632
688 Ga0207667_10900057
689 Ga0207712_10123716
690 Ga0207639_11012117
691 Ga0207678_11038661
692 Ga0207708_10001448
693 Ga0207648_10000178
694 Ga0207648_11207441
695 Ga0207674_10399523
696 Ga0207675_100001081
697 Ga0207675_100402239
698 Ga0207683_10061163
699 Ga0207698_10104105
700 Ga0207698_10105331
701 Ga0209281_1003549
702 Ga0268266_10010281
703 Ga0268266_11582496
704 Ga0268264_10241117
705 Ga0316181_1247882
706 Ga0316576_10046459
707 Ga0316576_10915177
708 Ga0316576_10979909
709 Ga0316576_11131815
710 Ga0316578_10356649
711 Ga0307416_102061466
712 Ga0307415_101078390
713 Ga0316574_0231038
714 Ga0316574_0688221
715 Ga0395899_0014881
716 Ga0395899_0026315
717 Ga0395899_0051671
718 Ga0395899_0062501
719 Ga0395899_0266983
720 Ga0395899_0276219
721 Ga0395899_0425226
722 Ga0395899_0629081
723 Ga0395899_0650289
724 Ga0395899_0997218
725 Ga0395900_0001983
726 Ga0395900_0004330
727 Ga0395900_0061620
728 Ga0395900_0139766
729 Ga0395900_0183998
730 Ga0395900_0267704
731 Ga0395900_0391115
732 Ga0395900_0405512
733 Ga0395900_0511034
734 Ga0395900_0541705
735 Ga0395900_0825999
736 Ga0395898_0026216
737 Ga0395898_0049981
738 Ga0395898_0119329
739 Ga0395898_0184108
740 Ga0395898_0238768
741 Ga0395898_0502973
742 Ga0395898_0566353
743 Ga0395898_1165527
744 Ga0395898_1195790
745 Ga0395898_1455977
746 Ga0395898_1584261
747 Ga0395905_0111285
748 Ga0395905_0152014
749 Ga0395905_0167110
750 Ga0395905_0218641
751 Ga0395905_0240320
752 Ga0395905_0278299
753 Ga0395905_1414914
754 Ga0395905_1537731
755 Ga0436364_0500499
756 Ga0436364_0505738
757 Ga0395901_0005695
758 Ga0395901_0066065
759 Ga0395901_0121532
760 Ga0395901_0221091
761 Ga0395901_0455105
762 Ga0395901_0550455
763 Ga0395901_0583205
764 Ga0395901_0652496
765 Ga0395901_1008408
766 Ga0395901_1142749
767 Ga0395901_1169795
768 Ga0395901_1654179
769 Ga0436361_0188289
770 Ga0439445_0068863
771 Ga0439448_0047296
772 Ga0439448_0158878
773 Ga0439448_0326091
774 Ga0439450_216739
775 Ga0439455_0005954
776 Ga0439455_0061747
777 Ga0466969_0065849
778 Ga0466969_0268055
779 Ga0466969_0292573
780 Ga0466972_0001460
781 Ga0466972_0156773
782 Ga0466972_0256624
783 Ga0466965_0005682
784 Ga0466965_0039101
785 Ga0466965_0255735
786 Ga0466966_0010138
787 Ga0466966_0016521
788 Ga0466966_0018191
789 Ga0466966_0029924
790 Ga0466966_0114550
791 Ga0466966_0304609
792 Ga0466961_0095838
793 Ga0466961_0114070
794 Ga0466964_0054421
795 Ga0466971_0077315
796 Ga0466971_0092626
797 Ga0466968_0000650
798 Ga0466968_0105041
799 Ga0466970_0206638
800 Ga0466970_0249398
801 Ga0466970_0301206
802 Ga0466957_0032357
803 Ga0466957_0044643
804 Ga0466957_0432416
805 Ga0466957_0635676
806 Ga0466957_0643530
807 Ga0466960_0025761
808 Ga0466959_0030088
809 Ga0466959_0105440
810 Ga0466959_0199911
811 Ga0466959_0306361
812 Ga0466959_0334724
813 Ga0466959_0367145
814 Ga0466958_0075395
815 Ga0466958_0387531
816 Ga0466958_0639514
817 Ga0466958_0690154
818 Ga0466958_0754465
819 Ga0466967_0118978
820 Ga0466967_1113779
821 Ga0495617_000008
822 Ga0495627_000007
823 Ga0495627_000812
824 Ga0495627_027666
825 Ga0495603_0049141
826 Ga0495590_0217418
827 Ga0495638_0082568
828 Ga0495638_0193922
829 Ga0495653_0586026
830 Ga0495650_0000097
831 Ga0495605_0000083
832 Ga0495605_0000237
833 Ga0495605_0017599
834 Ga0495605_0098203
835 Ga0495605_0211168
836 Ga0495584_0001125
837 Ga0495584_0019610
838 Ga0495584_0058910
839 Ga0495585_0002256
840 Ga0495585_0014871
841 Ga0495585_0233160
842 Ga0495585_0386255
843 Ga0495585_0475931
844 Ga0495596_0001966
845 Ga0495596_0007400
846 Ga0495596_0045654
847 Ga0495596_0064529
848 Ga0495607_0001272
849 Ga0495607_0005692
850 Ga0495607_0046384
851 Ga0495607_0122725
852 Ga0495607_0324469
853 Ga0495583_0001390
854 Ga0495583_0005925
855 Ga0495583_0019194
856 Ga0495583_0032899
857 Ga0495606_0002328
858 Ga0495606_0002614
859 Ga0495606_0029323
860 Ga0495606_0070837
861 Ga0495606_0323481
862 Ga0495606_0409983
863 Ga0495610_0011778
864 Ga0495610_0017107
865 Ga0495610_0105129
866 Ga0495610_0168152
867 Ga0495616_0002355
868 Ga0495616_0002368
869 Ga0495616_0012719
870 Ga0495616_0013365
871 Ga0495616_0065663
872 Ga0495616_0074524
873 Ga0495631_0010034
874 Ga0495631_0011265
875 Ga0495631_0100391
876 Ga0495632_0000413
877 Ga0495632_0000499
878 Ga0495637_0290008
879 Ga0495643_0000099
880 Ga0495643_0006148
881 Ga0495643_0011268
882 Ga0495643_0051427
883 Ga0495643_0097424
884 Ga0495644_0055938
885 Ga0495644_0227214
886 Ga0495648_0002936
887 Ga0495648_0003566
888 Ga0495648_0027505
889 Ga0495642_0000496
890 Ga0495642_0000547
891 Ga0495642_0001020
892 Ga0495642_0011315
893 Ga0495642_0080491
894 Ga0495642_0114118
895 Ga0495642_0169145
896 Ga0495654_0002638
897 Ga0495609_0000039
898 Ga0495609_0001302
899 Ga0495609_0033002
900 Ga0495597_0000690
901 Ga0495597_0151220
902 Ga0495645_0136639
903 Ga0495633_0000117
904 Ga0495633_0324468
905 Ga0495656_0015456
906 Ga0495656_0115279
907 Ga0495656_0196425
908 Ga0495668_0007802
909 Ga0495668_0010168
910 Ga0495668_0119658
911 Ga0495668_0227777
912 Ga0495668_0446830
913 Ga0495611_0025124
914 Ga0495625_0003442
915 Ga0495625_0008666
916 Ga0495625_0041501
917 Ga0495661_0000638
918 Ga0495661_0000893
919 Ga0495661_0001460
920 Ga0495661_0081937
921 Ga0495661_0090470
922 Ga0495661_0112591
923 Ga0495661_0227734
924 Ga0495588_0000055
925 Ga0495669_0000309
926 Ga0495669_0044133
927 Ga0495670_0045327
928 Ga0495670_0067656
929 Ga0495670_0079788
930 Ga0495671_0001079
931 Ga0495671_0002612
932 Ga0495671_0178193
933 Ga0495649_0019135
934 Ga0495649_0296803
935 Ga0495649_0390444
936 Ga0495589_0000097
937 Ga0495589_0000596
938 Ga0495589_0001279
939 Ga0495589_0036938
940 Ga0495660_0000107
941 Ga0495660_0000191
942 Ga0495660_0000245
943 Ga0495660_0020168
944 Ga0495660_0031029
945 Ga0495660_0092321
946 Ga0495660_0143350
947 Ga0495660_0331525
948 Ga0495660_0427577
949 Ga0495672_0000277
950 Ga0495672_0004878
951 Ga0495680_0924646
952 Ga0495683_0045514
953 Ga0495683_0144697
954 Ga0495683_0194130
955 Ga0495683_0378812
956 Ga0495687_000059
957 Ga0495687_000189
958 Ga0495687_001606
959 Ga0495687_002661
960 Ga0495687_207753
961 Ga0495677_0000006
962 Ga0495677_0002600
963 Ga0495677_0005945
964 Ga0495677_0020849
965 Ga0495677_0122500
966 Ga0495677_0176847
967 Ga0495677_0284904
968 Ga0495679_011690
969 Ga0495685_177734
970 Ga0495685_210414
971 Ga0495681_0000842
972 Ga0495681_0002516
973 Ga0495681_0019012
974 Ga0495681_0043749
975 Ga0495686_0000967
976 Ga0495686_0062504
977 Ga0495626_0000121
978 Ga0495626_0002632
979 Ga0495626_0031353
980 Ga0495626_0083287
981 Ga0496101_0589117
982 Ga0496102_0000645
983 Ga0496102_0007732
984 Ga0496102_0115411
985 Ga0496102_0137053
986 Ga0496102_0183731
987 Ga0496102_0205074
988 Ga0496103_0001589
989 Ga0496103_0188370
990 Ga0496103_0292582
991 Ga0496103_0858659
992 Ga0496105_0280815
993 Ga0496105_0748293
994 Ga0496106_0067509
995 Ga0496106_1163510
996 Ga0496107_0043276
997 Ga0496107_0065502
998 Ga0496108_0643833
999 Ga0496109_0305310
1000 Ga0496109_0447011
1001 Ga0496110_0000001
1002 Ga0496110_0601247
1003 Ga0496110_0880425
1004 Ga0496111_0440813
1005 Ga0496111_1175016
1006 Ga0496112_0285497
1007 Ga0496112_1650948
1008 Ga0496113_0001620
1009 Ga0496113_0490485
1010 Ga0496116_0066152
1011 Ga0496121_0642312
1012 Ga0496122_0003300
1013 Ga0496122_0012483
1014 Ga0496123_0003071
1015 Ga0496123_0033697
1016 Ga0496124_0008117
1017 Ga0496124_0013707
1018 Ga0496124_0021821
1019 Ga0496124_0059608
1020 Ga0496124_0063110
1021 Ga0496124_0087679
1022 Ga0496124_0113520
1023 Ga0496125_0073567
1024 Ga0496125_0579145
1025 Ga0496126_0421645
1026 Ga0495678_000004
1027 Ga0495678_000165
1028 Ga0495678_001020
1029 Ga0495678_001126
1030 Ga0495682_0002495
1031 Ga0495682_0003061
1032 Ga0501033_0342386
1033 Ga0501034_0008394
1034 Ga0501037_0330939
1035 Ga0501038_0075230
1036 Ga0501043_0049498
1037 Ga0501046_0482546
1038 Ga0501046_0648696
1039 Ga0501047_0007387
1040 Ga0501070_0073746
1041 Ga0501071_0976769
1042 Ga0501071_1014627
1043 Ga0501073_0069187
1044 Ga0501074_1149028
1045 Ga0501075_1394454
1046 Ga0501249_202655
1047 Ga0501080_1762446
1048 Ga0501269_000296
1049 Ga0501279_051444
1050 Ga0501035_0010475
1051 Ga0501044_0004495
1052 nmdc:mga03683_414667_c1
1053 nmdc:mga03683_73347_c1
1054 nmdc:mga00v17_322469_c1
1055 Ga0587067_078068
1056 Ga0587072_090274
1057 Ga0501082_0197697
1058 Ga0466962_0605892
1059 2842715680
1060 2857554672
1061 2857561719
1062 2904425612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

22

88

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8624 1 86
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8358 1 86
3phd-assembly1.cif.gz_D crystal structure of human hdac6 in complex with ubiquitin 0.7685 4 88
7zyu-assembly1.cif.gz_A hdac6 znf domain inhibitor - darpin (designed ankyrin repeat protein) f10 0.7635 4 84
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.7572 4 84
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8567 1 88 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8263 18 85 3.30.40.10
af_Q09738_3_112_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8078 33 84 3.30.40.10
af_A4HRG6_422_490_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8022 16 84 3.30.40.10
af_P38748_276_364_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8018 17 88 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A7W9U847-F1-model_v4 deleted 0.9794 53 85
AF-A0A534F3K5-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9162 51 88 GO:0008270
AF-A0A1H3IX77-F1-model_v4 Ubiquitin-hydrolase Zn-finger-containing protein 0.9111 33 85 GO:0008270
GO:0016787
AF-A0A536JFN2-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9103 34 85 GO:0008270
AF-A0A2L0NFQ1-F1-model_v4 UBP-type domain-containing protein 0.9094 35 88 GO:0008270

Map