F460176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 531 | 299 | 531 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300046559|Ga0495667_0276740|Ga0495667_0276740_198_692 |
| Length | 150 |
| Sequence | MGRGCHARPSRRTTGVDANQRGGLRADRYAVEDFPYHFDARGRTAEVDYDGHIRDLIEQVLFTSPGERVNRPDFGSGLLRLVFAPNSSELAATTQYLVQGSLQQYLGDLIQVDAVDVTSEDSTLRVSVRYLVRQTQTLQTAEFTKGVPTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 197 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 202 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 203 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 259 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 261 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 263 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 264 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 266 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 269 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 271 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 273 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 277 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 280 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 295 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 296 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.51 |
| Nodule | 0 |
| Rhizoplane | 5.46 |
| Rhizosphere | 90.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J14986_100666 | 3300001432 | Bacteria | 2020 |
| 2 | JGI24746J21847_1034850 | 3300001977 | Unclassified | 695 |
| 3 | JGI24748J21848_1000002 | 3300002074 | Bacteria | 426946 |
| 4 | JGI24034J26672_10000004 | 3300002239 | Bacteria | 426946 |
| 5 | JGI25406J46586_10037876 | 3300003203 | Bacteria | 1734 |
| 6 | rootH2_10256832 | 3300003320 | Unclassified | 1932 |
| 7 | rootL2_10257985 | 3300003322 | Unclassified | 2208 |
| 8 | Ga0065712_10003716 | 3300005290 | Bacteria | 4962 |
| 9 | Ga0065715_10013740 | 3300005293 | Unclassified | 3339 |
| 10 | Ga0065715_11125805 | 3300005293 | Bacteria | 514 |
| 11 | Ga0070676_10001365 | 3300005328 | Bacteria | 12295 |
| 12 | Ga0070676_11037161 | 3300005328 | Bacteria | 617 |
| 13 | Ga0070683_100316280 | 3300005329 | Bacteria | 1485 |
| 14 | Ga0070690_100001967 | 3300005330 | Bacteria | 10937 |
| 15 | Ga0070690_100823741 | 3300005330 | Bacteria | 721 |
| 16 | Ga0070670_100006479 | 3300005331 | Bacteria | 9906 |
| 17 | Ga0070670_100316144 | 3300005331 | Bacteria | 1367 |
| 18 | Ga0070677_10007163 | 3300005333 | Bacteria | 3719 |
| 19 | Ga0068869_100279860 | 3300005334 | Bacteria | 1341 |
| 20 | Ga0070680_100033253 | 3300005336 | Bacteria | 4155 |
| 21 | Ga0068868_100183959 | 3300005338 | Bacteria | 1735 |
| 22 | Ga0068868_100992340 | 3300005338 | Unclassified | 768 |
| 23 | Ga0068868_101530638 | 3300005338 | Bacteria | 625 |
| 24 | Ga0068868_102260975 | 3300005338 | Unclassified | 518 |
| 25 | Ga0070660_100124956 | 3300005339 | Bacteria | 2055 |
| 26 | Ga0070689_100016478 | 3300005340 | Bacteria | 5408 |
| 27 | Ga0070689_100852580 | 3300005340 | Unclassified | 804 |
| 28 | Ga0070689_101922173 | 3300005340 | Bacteria | 540 |
| 29 | Ga0070689_102200758 | 3300005340 | Unclassified | 505 |
| 30 | Ga0070691_10030696 | 3300005341 | Bacteria | 2518 |
| 31 | Ga0070687_100001554 | 3300005343 | Bacteria | 8146 |
| 32 | Ga0070687_100128892 | 3300005343 | Bacteria | 1458 |
| 33 | Ga0070687_100251155 | 3300005343 | Bacteria | 1099 |
| 34 | Ga0070687_100567447 | 3300005343 | Bacteria | 775 |
| 35 | Ga0070692_10127752 | 3300005345 | Bacteria | 1425 |
| 36 | Ga0070668_100085699 | 3300005347 | Unclassified | 2476 |
| 37 | Ga0070669_100013242 | 3300005353 | Bacteria | 5862 |
| 38 | Ga0070669_100020637 | 3300005353 | Bacteria | 4705 |
| 39 | Ga0070669_100035699 | 3300005353 | Bacteria | 3602 |
| 40 | Ga0070669_100114782 | 3300005353 | Unclassified | 2048 |
| 41 | Ga0070675_100001838 | 3300005354 | Bacteria | 15687 |
| 42 | Ga0070675_100004173 | 3300005354 | Bacteria | 10972 |
| 43 | Ga0070675_100026234 | 3300005354 | Bacteria | 4675 |
| 44 | Ga0070675_100100022 | 3300005354 | Bacteria | 2442 |
| 45 | Ga0070671_100015497 | 3300005355 | Bacteria | 6159 |
| 46 | Ga0070671_100082296 | 3300005355 | Bacteria | 2691 |
| 47 | Ga0070674_100020446 | 3300005356 | Bacteria | 4230 |
| 48 | Ga0070674_100214152 | 3300005356 | Bacteria | 1495 |
| 49 | Ga0070673_100073674 | 3300005364 | Bacteria | 2749 |
| 50 | Ga0070673_100677866 | 3300005364 | Unclassified | 945 |
| 51 | Ga0070673_101002897 | 3300005364 | Bacteria | 777 |
| 52 | Ga0070688_100008040 | 3300005365 | Bacteria | 5709 |
| 53 | Ga0070688_100086866 | 3300005365 | Bacteria | 2036 |
| 54 | Ga0070688_100179262 | 3300005365 | Bacteria | 1468 |
| 55 | Ga0070659_100063339 | 3300005366 | Bacteria | 2925 |
| 56 | Ga0070667_100011622 | 3300005367 | Bacteria | 7279 |
| 57 | Ga0070667_100017551 | 3300005367 | Bacteria | 5932 |
| 58 | Ga0070667_100117872 | 3300005367 | Bacteria | 2307 |
| 59 | Ga0070703_10000028 | 3300005406 | Bacteria | 70844 |
| 60 | Ga0070703_10142371 | 3300005406 | Unclassified | 892 |
| 61 | Ga0070714_100034209 | 3300005435 | Unclassified | 4254 |
| 62 | Ga0070713_100009503 | 3300005436 | Bacteria | 6966 |
| 63 | Ga0070713_100016390 | 3300005436 | Bacteria | 5571 |
| 64 | Ga0070710_10028354 | 3300005437 | Bacteria | 2994 |
| 65 | Ga0070701_10575934 | 3300005438 | Bacteria | 742 |
| 66 | Ga0070711_100059933 | 3300005439 | Unclassified | 2644 |
| 67 | Ga0070711_100805808 | 3300005439 | Bacteria | 797 |
| 68 | Ga0070705_100767600 | 3300005440 | Unclassified | 764 |
| 69 | Ga0070700_100006039 | 3300005441 | Bacteria | 6448 |
| 70 | Ga0070700_100150489 | 3300005441 | Bacteria | 1591 |
| 71 | Ga0070694_100073264 | 3300005444 | Bacteria | 2365 |
| 72 | Ga0070694_100101608 | 3300005444 | Bacteria | 2035 |
| 73 | Ga0070694_100623497 | 3300005444 | Bacteria | 870 |
| 74 | Ga0070708_100084280 | 3300005445 | Bacteria | 2883 |
| 75 | Ga0070663_100059127 | 3300005455 | Bacteria | 2755 |
| 76 | Ga0070663_100487212 | 3300005455 | Bacteria | 1022 |
| 77 | Ga0070678_100195213 | 3300005456 | Bacteria | 1667 |
| 78 | Ga0070678_100256899 | 3300005456 | Bacteria | 1467 |
| 79 | Ga0070662_100395686 | 3300005457 | Bacteria | 1139 |
| 80 | Ga0070681_10021075 | 3300005458 | Bacteria | 6530 |
| 81 | Ga0070681_10325744 | 3300005458 | Bacteria | 1446 |
| 82 | Ga0070685_10020774 | 3300005466 | Bacteria | 3558 |
| 83 | Ga0070706_100010342 | 3300005467 | Bacteria | 8668 |
| 84 | Ga0070706_100386337 | 3300005467 | Bacteria | 1303 |
| 85 | Ga0070706_100527300 | 3300005467 | Bacteria | 1099 |
| 86 | Ga0070706_100707609 | 3300005467 | Unclassified | 934 |
| 87 | Ga0070707_100000677 | 3300005468 | Bacteria | 33786 |
| 88 | Ga0070698_100247589 | 3300005471 | Bacteria | 1715 |
| 89 | Ga0070698_100252628 | 3300005471 | Unclassified | 1695 |
| 90 | Ga0070698_101344631 | 3300005471 | Bacteria | 665 |
| 91 | Ga0070699_100005249 | 3300005518 | Bacteria | 11376 |
| 92 | Ga0070699_100084071 | 3300005518 | Viruses | 2777 |
| 93 | Ga0070699_100096482 | 3300005518 | Viruses | 2589 |
| 94 | Ga0070699_100901264 | 3300005518 | Bacteria | 810 |
| 95 | Ga0070679_100034533 | 3300005530 | Bacteria | 5013 |
| 96 | Ga0070679_100517025 | 3300005530 | Bacteria | 1138 |
| 97 | Ga0070684_100320759 | 3300005535 | Bacteria | 1423 |
| 98 | Ga0070697_100000542 | 3300005536 | Bacteria | 28399 |
| 99 | Ga0070697_100209542 | 3300005536 | Bacteria | 1659 |
| 100 | Ga0068853_100778756 | 3300005539 | Bacteria | 915 |
| 101 | Ga0070672_100041276 | 3300005543 | Bacteria | 3546 |
| 102 | Ga0070672_100070292 | 3300005543 | Bacteria | 2781 |
| 103 | Ga0070686_100103885 | 3300005544 | Bacteria | 1924 |
| 104 | Ga0070695_100036695 | 3300005545 | Bacteria | 3085 |
| 105 | Ga0070695_100128826 | 3300005545 | Bacteria | 1742 |
| 106 | Ga0070695_100335822 | 3300005545 | Unclassified | 1128 |
| 107 | Ga0070695_100494532 | 3300005545 | Unclassified | 945 |
| 108 | Ga0070695_101509184 | 3300005545 | Unclassified | 559 |
| 109 | Ga0070696_100038160 | 3300005546 | Bacteria | 3314 |
| 110 | Ga0070696_100713004 | 3300005546 | Viruses | 819 |
| 111 | Ga0070696_101046366 | 3300005546 | Bacteria | 684 |
| 112 | Ga0070696_101099534 | 3300005546 | Unclassified | 668 |
| 113 | Ga0070693_100012949 | 3300005547 | Bacteria | 4236 |
| 114 | Ga0070693_101072797 | 3300005547 | Unclassified | 613 |
| 115 | Ga0070665_100276841 | 3300005548 | Unclassified | 1680 |
| 116 | Ga0070704_100194128 | 3300005549 | Bacteria | 1634 |
| 117 | Ga0070704_100243365 | 3300005549 | Unclassified | 1473 |
| 118 | Ga0070704_100434567 | 3300005549 | Bacteria | 1127 |
| 119 | Ga0068855_100096198 | 3300005563 | Bacteria | 3412 |
| 120 | Ga0068855_100585072 | 3300005563 | Bacteria | 1205 |
| 121 | Ga0070664_100013944 | 3300005564 | Bacteria | 6553 |
| 122 | Ga0070664_100021201 | 3300005564 | Bacteria | 5353 |
| 123 | Ga0070664_100034015 | 3300005564 | Bacteria | 4274 |
| 124 | Ga0068857_100057187 | 3300005577 | Bacteria | 3462 |
| 125 | Ga0068854_100010313 | 3300005578 | Bacteria | 6056 |
| 126 | Ga0068854_100124664 | 3300005578 | Bacteria | 1960 |
| 127 | Ga0068854_100654585 | 3300005578 | Unclassified | 902 |
| 128 | Ga0068856_100078468 | 3300005614 | Bacteria | 3274 |
| 129 | Ga0070702_100413557 | 3300005615 | Unclassified | 968 |
| 130 | Ga0068859_100003211 | 3300005617 | Bacteria | 16645 |
| 131 | Ga0068859_100013203 | 3300005617 | Bacteria | 8291 |
| 132 | Ga0068859_100040385 | 3300005617 | Bacteria | 4683 |
| 133 | Ga0068859_100391782 | 3300005617 | Bacteria | 1485 |
| 134 | Ga0068859_100701645 | 3300005617 | Bacteria | 1103 |
| 135 | Ga0068866_10056606 | 3300005718 | Bacteria | 2017 |
| 136 | Ga0068861_101487504 | 3300005719 | Bacteria | 664 |
| 137 | Ga0068863_100065955 | 3300005841 | Bacteria | 3425 |
| 138 | Ga0068863_100408514 | 3300005841 | Bacteria | 1329 |
| 139 | Ga0068863_101029225 | 3300005841 | Bacteria | 827 |
| 140 | Ga0068858_101162995 | 3300005842 | Bacteria | 758 |
| 141 | Ga0068860_100065339 | 3300005843 | Bacteria | 3455 |
| 142 | Ga0068860_100613528 | 3300005843 | Bacteria | 1094 |
| 143 | Ga0068860_101897346 | 3300005843 | Bacteria | 617 |
| 144 | Ga0068862_100008674 | 3300005844 | Bacteria | 8408 |
| 145 | Ga0068862_100220408 | 3300005844 | Bacteria | 1717 |
| 146 | Ga0081455_10000418 | 3300005937 | Bacteria | 55929 |
| 147 | Ga0081455_10331710 | 3300005937 | Bacteria | 1080 |
| 148 | Ga0081539_10000346 | 3300005985 | Bacteria | 101962 |
| 149 | Ga0081539_10003337 | 3300005985 | Bacteria | 19955 |
| 150 | Ga0070717_10011421 | 3300006028 | Bacteria | 6744 |
| 151 | Ga0070717_10192232 | 3300006028 | Bacteria | 1783 |
| 152 | Ga0070716_100018531 | 3300006173 | Bacteria | 3629 |
| 153 | Ga0070716_100235579 | 3300006173 | Unclassified | 1238 |
| 154 | Ga0070716_101463951 | 3300006173 | Unclassified | 557 |
| 155 | Ga0070712_100006993 | 3300006175 | Bacteria | 7033 |
| 156 | Ga0070712_100083329 | 3300006175 | Bacteria | 2322 |
| 157 | Ga0070712_100085384 | 3300006175 | Bacteria | 2298 |
| 158 | Ga0075370_10004194 | 3300006353 | Bacteria | 6958 |
| 159 | Ga0068871_100884720 | 3300006358 | Bacteria | 827 |
| 160 | Ga0075430_100025943 | 3300006846 | Viruses | 4987 |
| 161 | Ga0075431_100004811 | 3300006847 | Bacteria | 13295 |
| 162 | Ga0075431_100105862 | 3300006847 | Unclassified | 2902 |
| 163 | Ga0075434_100022420 | 3300006871 | Bacteria | 6151 |
| 164 | Ga0075434_100259198 | 3300006871 | Unclassified | 1758 |
| 165 | Ga0075429_101103038 | 3300006880 | Bacteria | 693 |
| 166 | Ga0068865_100284671 | 3300006881 | Bacteria | 1317 |
| 167 | Ga0068865_100455234 | 3300006881 | Bacteria | 1059 |
| 168 | Ga0075436_100034783 | 3300006914 | Bacteria | 3475 |
| 169 | Ga0075436_100377736 | 3300006914 | Unclassified | 1024 |
| 170 | Ga0075436_101107564 | 3300006914 | Bacteria | 596 |
| 171 | Ga0097620_100003211 | 3300006931 | Bacteria | 16645 |
| 172 | Ga0097620_100013203 | 3300006931 | Bacteria | 8291 |
| 173 | Ga0097620_100040388 | 3300006931 | Bacteria | 4683 |
| 174 | Ga0097620_100391765 | 3300006931 | Bacteria | 1485 |
| 175 | Ga0097620_100701673 | 3300006931 | Bacteria | 1103 |
| 176 | Ga0075435_100043004 | 3300007076 | Bacteria | 3616 |
| 177 | Ga0075435_100310939 | 3300007076 | Unclassified | 1348 |
| 178 | Ga0075435_100318447 | 3300007076 | Bacteria | 1331 |
| 179 | Ga0075435_100394520 | 3300007076 | Bacteria | 1190 |
| 180 | Ga0105240_10163923 | 3300009093 | Bacteria | 2638 |
| 181 | Ga0111539_10060572 | 3300009094 | Bacteria | 4485 |
| 182 | Ga0105245_10502328 | 3300009098 | Unclassified | 1229 |
| 183 | Ga0105245_10895590 | 3300009098 | Unclassified | 929 |
| 184 | Ga0105247_10064908 | 3300009101 | Unclassified | 2270 |
| 185 | Ga0105247_10435517 | 3300009101 | Bacteria | 942 |
| 186 | Ga0114129_10000925 | 3300009147 | Bacteria | 38300 |
| 187 | Ga0114129_10560851 | 3300009147 | Bacteria | 1484 |
| 188 | Ga0114129_10828683 | 3300009147 | Unclassified | 1178 |
| 189 | Ga0114129_10837032 | 3300009147 | Bacteria | 1171 |
| 190 | Ga0114129_11471129 | 3300009147 | Bacteria | 838 |
| 191 | Ga0114129_13302790 | 3300009147 | Unclassified | 522 |
| 192 | Ga0105243_10000996 | 3300009148 | Bacteria | 26244 |
| 193 | Ga0105243_10047982 | 3300009148 | Bacteria | 3365 |
| 194 | Ga0105241_10141772 | 3300009174 | Bacteria | 1958 |
| 195 | Ga0105242_10322426 | 3300009176 | Bacteria | 1417 |
| 196 | Ga0105242_10435053 | 3300009176 | Unclassified | 1233 |
| 197 | Ga0105242_10766905 | 3300009176 | Bacteria | 951 |
| 198 | Ga0105242_11449483 | 3300009176 | Unclassified | 716 |
| 199 | Ga0105248_10003342 | 3300009177 | Bacteria | 17833 |
| 200 | Ga0105248_11121967 | 3300009177 | Unclassified | 889 |
| 201 | Ga0105238_10000453 | 3300009551 | Bacteria | 43016 |
| 202 | Ga0105238_10015271 | 3300009551 | Bacteria | 7777 |
| 203 | Ga0105238_10883052 | 3300009551 | Bacteria | 912 |
| 204 | Ga0105249_10100889 | 3300009553 | Bacteria | 2714 |
| 205 | Ga0105249_10214317 | 3300009553 | Bacteria | 1892 |
| 206 | Ga0105249_10257651 | 3300009553 | Bacteria | 1732 |
| 207 | Ga0105239_10005799 | 3300010375 | Bacteria | 14408 |
| 208 | Ga0105239_12130245 | 3300010375 | Unclassified | 652 |
| 209 | Ga0105246_10020900 | 3300011119 | Bacteria | 4204 |
| 210 | Ga0105246_10104300 | 3300011119 | Unclassified | 2070 |
| 211 | Ga0105246_11937632 | 3300011119 | Bacteria | 567 |
| 212 | Ga0157371_10095319 | 3300013102 | Bacteria | 2109 |
| 213 | Ga0157369_10914132 | 3300013105 | Unclassified | 900 |
| 214 | Ga0157374_10015332 | 3300013296 | Bacteria | 6722 |
| 215 | Ga0157374_10809308 | 3300013296 | Unclassified | 953 |
| 216 | Ga0157378_10000015 | 3300013297 | Bacteria | 143601 |
| 217 | Ga0157378_10066555 | 3300013297 | Unclassified | 3227 |
| 218 | Ga0157378_10192643 | 3300013297 | Unclassified | 1924 |
| 219 | Ga0157378_11283965 | 3300013297 | Bacteria | 773 |
| 220 | Ga0157378_11303248 | 3300013297 | Bacteria | 767 |
| 221 | Ga0157378_11757263 | 3300013297 | Unclassified | 668 |
| 222 | Ga0157378_12375159 | 3300013297 | Unclassified | 582 |
| 223 | Ga0163162_10050774 | 3300013306 | Bacteria | 4159 |
| 224 | Ga0163162_11953080 | 3300013306 | Unclassified | 672 |
| 225 | Ga0157372_10032933 | 3300013307 | Bacteria | 5688 |
| 226 | Ga0157372_10053296 | 3300013307 | Bacteria | 4508 |
| 227 | Ga0157372_11858954 | 3300013307 | Bacteria | 692 |
| 228 | Ga0157375_10191789 | 3300013308 | Bacteria | 2198 |
| 229 | Ga0157375_10377520 | 3300013308 | Bacteria | 1584 |
| 230 | Ga0157375_11014638 | 3300013308 | Bacteria | 969 |
| 231 | Ga0157375_12487289 | 3300013308 | Bacteria | 618 |
| 232 | Ga0157375_12580182 | 3300013308 | Unclassified | 607 |
| 233 | Ga0163163_10096287 | 3300014325 | Unclassified | 2980 |
| 234 | Ga0163163_10115414 | 3300014325 | Bacteria | 2717 |
| 235 | Ga0163163_10331350 | 3300014325 | Bacteria | 1577 |
| 236 | Ga0163163_11423705 | 3300014325 | Bacteria | 755 |
| 237 | Ga0163163_12610992 | 3300014325 | Bacteria | 563 |
| 238 | Ga0163163_13070614 | 3300014325 | Bacteria | 521 |
| 239 | Ga0157380_11754419 | 3300014326 | Bacteria | 679 |
| 240 | Ga0182008_10118981 | 3300014497 | Bacteria | 1312 |
| 241 | Ga0157377_10116578 | 3300014745 | Bacteria | 1613 |
| 242 | Ga0157377_10629509 | 3300014745 | Bacteria | 769 |
| 243 | Ga0157377_10928767 | 3300014745 | Bacteria | 653 |
| 244 | Ga0157376_10008932 | 3300014969 | Bacteria | 7256 |
| 245 | Ga0157376_10116132 | 3300014969 | Bacteria | 2364 |
| 246 | Ga0157376_11229459 | 3300014969 | Unclassified | 778 |
| 247 | Ga0207666_1030537 | 3300025271 | Unclassified | 824 |
| 248 | Ga0207697_10001859 | 3300025315 | Bacteria | 11285 |
| 249 | Ga0207697_10001865 | 3300025315 | Bacteria | 11253 |
| 250 | Ga0207653_10000047 | 3300025885 | Bacteria | 91340 |
| 251 | Ga0207682_10056831 | 3300025893 | Bacteria | 1630 |
| 252 | Ga0207692_10075734 | 3300025898 | Unclassified | 1786 |
| 253 | Ga0207692_10633053 | 3300025898 | Bacteria | 690 |
| 254 | Ga0207642_10045965 | 3300025899 | Bacteria | 1942 |
| 255 | Ga0207710_10000004 | 3300025900 | Bacteria | 846540 |
| 256 | Ga0207710_10127913 | 3300025900 | Unclassified | 1218 |
| 257 | Ga0207688_10034491 | 3300025901 | Bacteria | 2803 |
| 258 | Ga0207688_10569816 | 3300025901 | Unclassified | 712 |
| 259 | Ga0207680_10167098 | 3300025903 | Bacteria | 1479 |
| 260 | Ga0207645_10003342 | 3300025907 | Bacteria | 12230 |
| 261 | Ga0207645_10004181 | 3300025907 | Bacteria | 10718 |
| 262 | Ga0207645_10061525 | 3300025907 | Bacteria | 2398 |
| 263 | Ga0207643_10001177 | 3300025908 | Bacteria | 15527 |
| 264 | Ga0207684_10011572 | 3300025910 | Bacteria | 7711 |
| 265 | Ga0207684_10329809 | 3300025910 | Bacteria | 1315 |
| 266 | Ga0207684_10555190 | 3300025910 | Bacteria | 982 |
| 267 | Ga0207684_10774054 | 3300025910 | Bacteria | 812 |
| 268 | Ga0207684_11411507 | 3300025910 | Unclassified | 570 |
| 269 | Ga0207707_10555850 | 3300025912 | Unclassified | 975 |
| 270 | Ga0207707_10863292 | 3300025912 | Bacteria | 750 |
| 271 | Ga0207695_10401455 | 3300025913 | Unclassified | 1255 |
| 272 | Ga0207695_10413148 | 3300025913 | Unclassified | 1234 |
| 273 | Ga0207693_10010700 | 3300025915 | Bacteria | 7447 |
| 274 | Ga0207693_10222704 | 3300025915 | Bacteria | 1482 |
| 275 | Ga0207663_10041856 | 3300025916 | Unclassified | 2795 |
| 276 | Ga0207663_10436040 | 3300025916 | Bacteria | 1008 |
| 277 | Ga0207662_10019692 | 3300025918 | Unclassified | 3844 |
| 278 | Ga0207662_10048376 | 3300025918 | Bacteria | 2519 |
| 279 | Ga0207662_10817734 | 3300025918 | Unclassified | 657 |
| 280 | Ga0207657_10006391 | 3300025919 | Bacteria | 12237 |
| 281 | Ga0207649_10086454 | 3300025920 | Bacteria | 2043 |
| 282 | Ga0207652_10284592 | 3300025921 | Bacteria | 1491 |
| 283 | Ga0207646_10000550 | 3300025922 | Bacteria | 49383 |
| 284 | Ga0207681_10025343 | 3300025923 | Unclassified | 3814 |
| 285 | Ga0207681_10030921 | 3300025923 | Bacteria | 3494 |
| 286 | Ga0207681_10076001 | 3300025923 | Bacteria | 2357 |
| 287 | Ga0207681_10211174 | 3300025923 | Bacteria | 1496 |
| 288 | Ga0207694_10003055 | 3300025924 | Bacteria | 13419 |
| 289 | Ga0207694_10170679 | 3300025924 | Bacteria | 1761 |
| 290 | Ga0207650_10038064 | 3300025925 | Bacteria | 3509 |
| 291 | Ga0207650_10237763 | 3300025925 | Unclassified | 1471 |
| 292 | Ga0207659_10059210 | 3300025926 | Unclassified | 2752 |
| 293 | Ga0207659_10092391 | 3300025926 | Bacteria | 2262 |
| 294 | Ga0207659_10283266 | 3300025926 | Bacteria | 1356 |
| 295 | Ga0207659_10518755 | 3300025926 | Unclassified | 1010 |
| 296 | Ga0207687_10176672 | 3300025927 | Bacteria | 1651 |
| 297 | Ga0207664_10197518 | 3300025929 | Unclassified | 1735 |
| 298 | Ga0207644_10002425 | 3300025931 | Bacteria | 12009 |
| 299 | Ga0207644_10148250 | 3300025931 | Bacteria | 1813 |
| 300 | Ga0207644_10473992 | 3300025931 | Bacteria | 1030 |
| 301 | Ga0207690_10201492 | 3300025932 | Unclassified | 1512 |
| 302 | Ga0207706_10000999 | 3300025933 | Bacteria | 28802 |
| 303 | Ga0207706_10028863 | 3300025933 | Bacteria | 4952 |
| 304 | Ga0207706_10068096 | 3300025933 | Bacteria | 3133 |
| 305 | Ga0207706_10501378 | 3300025933 | Bacteria | 1048 |
| 306 | Ga0207686_10279619 | 3300025934 | Unclassified | 1231 |
| 307 | Ga0207686_10630113 | 3300025934 | Unclassified | 847 |
| 308 | Ga0207709_10001187 | 3300025935 | Bacteria | 18824 |
| 309 | Ga0207709_10596040 | 3300025935 | Bacteria | 874 |
| 310 | Ga0207669_10299931 | 3300025937 | Bacteria | 1221 |
| 311 | Ga0207704_10624163 | 3300025938 | Bacteria | 885 |
| 312 | Ga0207665_10002211 | 3300025939 | Bacteria | 13127 |
| 313 | Ga0207691_10008673 | 3300025940 | Bacteria | 9755 |
| 314 | Ga0207691_10026915 | 3300025940 | Bacteria | 5395 |
| 315 | Ga0207711_10006529 | 3300025941 | Bacteria | 9818 |
| 316 | Ga0207711_10467061 | 3300025941 | Bacteria | 1175 |
| 317 | Ga0207689_10001417 | 3300025942 | Bacteria | 22904 |
| 318 | Ga0207679_10024837 | 3300025945 | Bacteria | 4113 |
| 319 | Ga0207679_10787887 | 3300025945 | Unclassified | 866 |
| 320 | Ga0207667_10502672 | 3300025949 | Bacteria | 1229 |
| 321 | Ga0207712_10195838 | 3300025961 | Bacteria | 1598 |
| 322 | Ga0207668_10014858 | 3300025972 | Bacteria | 4826 |
| 323 | Ga0207658_10047257 | 3300025986 | Unclassified | 3149 |
| 324 | Ga0207658_10290299 | 3300025986 | Bacteria | 1405 |
| 325 | Ga0207658_10347951 | 3300025986 | Bacteria | 1290 |
| 326 | Ga0207658_10436553 | 3300025986 | Bacteria | 1157 |
| 327 | Ga0207677_10250654 | 3300026023 | Bacteria | 1438 |
| 328 | Ga0207677_10465063 | 3300026023 | Unclassified | 1087 |
| 329 | Ga0207703_10165442 | 3300026035 | Bacteria | 1940 |
| 330 | Ga0207639_10674148 | 3300026041 | Bacteria | 958 |
| 331 | Ga0207678_10093271 | 3300026067 | Bacteria | 2573 |
| 332 | Ga0207708_10025555 | 3300026075 | Bacteria | 4469 |
| 333 | Ga0207708_10064775 | 3300026075 | Bacteria | 2793 |
| 334 | Ga0207708_10216782 | 3300026075 | Bacteria | 1532 |
| 335 | Ga0207641_10329707 | 3300026088 | Bacteria | 1449 |
| 336 | Ga0207641_10503382 | 3300026088 | Bacteria | 1177 |
| 337 | Ga0207648_10393763 | 3300026089 | Bacteria | 1254 |
| 338 | Ga0207674_10044024 | 3300026116 | Bacteria | 4600 |
| 339 | Ga0207675_100014281 | 3300026118 | Bacteria | 7402 |
| 340 | Ga0207683_10001033 | 3300026121 | Bacteria | 25396 |
| 341 | Ga0207683_10300578 | 3300026121 | Bacteria | 1468 |
| 342 | Ga0207698_10527881 | 3300026142 | Bacteria | 1153 |
| 343 | Ga0268266_10359571 | 3300028379 | Unclassified | 1370 |
| 344 | Ga0268265_10060463 | 3300028380 | Bacteria | 2903 |
| 345 | Ga0268265_10284054 | 3300028380 | Unclassified | 1482 |
| 346 | Ga0268264_11047838 | 3300028381 | Bacteria | 823 |
| 347 | Ga0268264_11163453 | 3300028381 | Bacteria | 780 |
| 348 | Ga0307515_10000008 | 3300028794 | Bacteria | 663660 |
| 349 | Ga0265338_10525447 | 3300028800 | Unclassified | 831 |
| 350 | Ga0265765_1013133 | 3300030879 | Unclassified | 945 |
| 351 | Ga0307513_10200799 | 3300031456 | Bacteria | 1835 |
| 352 | Ga0307408_100924697 | 3300031548 | Unclassified | 800 |
| 353 | Ga0316579_10318330 | 3300031691 | Unclassified | 752 |
| 354 | Ga0307405_10023447 | 3300031731 | Bacteria | 3507 |
| 355 | Ga0307405_10311624 | 3300031731 | Bacteria | 1198 |
| 356 | Ga0307410_10009883 | 3300031852 | Bacteria | 5377 |
| 357 | Ga0307410_10811011 | 3300031852 | Unclassified | 797 |
| 358 | Ga0307410_11763947 | 3300031852 | Bacteria | 549 |
| 359 | Ga0307406_10022338 | 3300031901 | Bacteria | 3752 |
| 360 | Ga0307412_10058787 | 3300031911 | Bacteria | 2573 |
| 361 | Ga0307416_100016556 | 3300032002 | Bacteria | 5129 |
| 362 | Ga0307414_10006929 | 3300032004 | Bacteria | 6349 |
| 363 | Ga0307414_10690872 | 3300032004 | Unclassified | 923 |
| 364 | Ga0307411_10359936 | 3300032005 | Bacteria | 1189 |
| 365 | Ga0307411_10601877 | 3300032005 | Unclassified | 945 |
| 366 | Ga0307411_12358362 | 3300032005 | Unclassified | 500 |
| 367 | Ga0307415_100005575 | 3300032126 | Bacteria | 6699 |
| 368 | Ga0373945_0304019 | 3300035116 | Bacteria | 684 |
| 369 | Ga0373953_0053370 | 3300035117 | Bacteria | 1638 |
| 370 | Ga0373954_0137601 | 3300035118 | Bacteria | 1191 |
| 371 | Ga0373956_0430237 | 3300035119 | Unclassified | 630 |
| 372 | Ga0373943_0072420 | 3300035170 | Bacteria | 1748 |
| 373 | Ga0373924_0009892 | 3300035410 | Bacteria | 3507 |
| 374 | Ga0373935_0522089 | 3300035692 | Bacteria | 864 |
| 375 | Ga0373933_0011694 | 3300035724 | Bacteria | 4843 |
| 376 | Ga0373947_0252479 | 3300035725 | Bacteria | 1167 |
| 377 | Ga0373937_0002398 | 3300036401 | Bacteria | 15589 |
| 378 | Ga0373937_0222746 | 3300036401 | Bacteria | 1776 |
| 379 | Ga0373937_1018668 | 3300036401 | Unclassified | 777 |
| 380 | Ga0400490_38445 | 3300038726 | Bacteria | 13294 |
| 381 | Ga0400491_27425 | 3300038727 | Bacteria | 1319 |
| 382 | Ga0436360_0507637 | 3300039438 | Bacteria | 689 |
| 383 | Ga0436360_1307698 | 3300039438 | Bacteria | 767 |
| 384 | Ga0436362_1097775 | 3300039453 | Bacteria | 972 |
| 385 | Ga0451853_1505179 | 3300041512 | Bacteria | 531 |
| 386 | Ga0439458_0188334 | 3300042157 | Unclassified | 562 |
| 387 | Ga0439458_0206638 | 3300042157 | Unclassified | 538 |
| 388 | Ga0439435_0054705 | 3300042436 | Bacteria | 1150 |
| 389 | Ga0439459_0160735 | 3300042438 | Bacteria | 593 |
| 390 | Ga0451576_0751411 | 3300045051 | Unclassified | 1024 |
| 391 | Ga0495592_0137169 | 3300046454 | Unclassified | 1705 |
| 392 | Ga0495629_0280222 | 3300046459 | Bacteria | 1144 |
| 393 | Ga0495638_0638222 | 3300046460 | Bacteria | 519 |
| 394 | Ga0495653_0689580 | 3300046463 | Bacteria | 621 |
| 395 | Ga0495580_0147639 | 3300046472 | Bacteria | 1629 |
| 396 | Ga0495664_0226376 | 3300046477 | Unclassified | 1132 |
| 397 | Ga0495608_0279860 | 3300046511 | Unclassified | 1036 |
| 398 | Ga0495608_0395505 | 3300046511 | Bacteria | 846 |
| 399 | Ga0495628_0009589 | 3300046516 | Bacteria | 8265 |
| 400 | Ga0495630_0342556 | 3300046517 | Bacteria | 1144 |
| 401 | Ga0495630_0859365 | 3300046517 | Bacteria | 692 |
| 402 | Ga0495630_1128335 | 3300046517 | Viruses | 594 |
| 403 | Ga0495632_0147356 | 3300046519 | Bacteria | 1089 |
| 404 | Ga0495637_0009569 | 3300046520 | Bacteria | 4724 |
| 405 | Ga0495663_0051848 | 3300046525 | Bacteria | 1272 |
| 406 | Ga0495663_0150724 | 3300046525 | Bacteria | 793 |
| 407 | Ga0495652_0140516 | 3300046529 | Bacteria | 1899 |
| 408 | Ga0495652_0198552 | 3300046529 | Bacteria | 1524 |
| 409 | Ga0495587_0004194 | 3300046536 | Bacteria | 9544 |
| 410 | Ga0495587_0223241 | 3300046536 | Unclassified | 1062 |
| 411 | Ga0495645_0000820 | 3300046543 | Bacteria | 21250 |
| 412 | Ga0495645_0002759 | 3300046543 | Bacteria | 11939 |
| 413 | Ga0495667_0002410 | 3300046559 | Bacteria | 12483 |
| 414 | Ga0495667_0276740 | 3300046559 | Unclassified | 1066 |
| 415 | Ga0495625_0076225 | 3300046660 | Bacteria | 2345 |
| 416 | Ga0495635_0945050 | 3300046663 | Unclassified | 550 |
| 417 | Ga0495657_0108884 | 3300046675 | Bacteria | 1758 |
| 418 | Ga0495599_0012245 | 3300046678 | Bacteria | 5282 |
| 419 | Ga0495599_0021219 | 3300046678 | Bacteria | 4051 |
| 420 | Ga0495623_0001030 | 3300046679 | Bacteria | 18825 |
| 421 | Ga0495623_0113428 | 3300046679 | Bacteria | 1640 |
| 422 | Ga0495646_0601879 | 3300046680 | Viruses | 558 |
| 423 | Ga0495669_0049698 | 3300046684 | Bacteria | 1879 |
| 424 | Ga0495669_0307797 | 3300046684 | Bacteria | 764 |
| 425 | Ga0495600_0145983 | 3300046809 | Unclassified | 1533 |
| 426 | Ga0495604_0375459 | 3300047317 | Unclassified | 940 |
| 427 | Ga0495636_0152378 | 3300047318 | Bacteria | 1038 |
| 428 | Ga0495674_0162166 | 3300047319 | Bacteria | 1870 |
| 429 | Ga0495680_0108504 | 3300047322 | Unclassified | 2060 |
| 430 | Ga0495675_0001362 | 3300047444 | Bacteria | 14798 |
| 431 | Ga0495675_0033676 | 3300047444 | Bacteria | 3270 |
| 432 | Ga0495677_0036485 | 3300047445 | Bacteria | 1796 |
| 433 | Ga0495673_0291426 | 3300047469 | Bacteria | 587 |
| 434 | Ga0495684_0011322 | 3300047471 | Bacteria | 6887 |
| 435 | Ga0495684_0776527 | 3300047471 | Unclassified | 628 |
| 436 | Ga0495602_0066884 | 3300048088 | Bacteria | 3094 |
| 437 | Ga0495602_0961981 | 3300048088 | Viruses | 565 |
| 438 | Ga0495615_0073356 | 3300048090 | Bacteria | 926 |
| 439 | Ga0495626_0011025 | 3300048091 | Bacteria | 4795 |
| 440 | Ga0496100_0476942 | 3300048903 | Bacteria | 959 |
| 441 | Ga0496100_0652442 | 3300048903 | Unclassified | 819 |
| 442 | Ga0496101_0070442 | 3300048904 | Unclassified | 2561 |
| 443 | Ga0496101_0476625 | 3300048904 | Unclassified | 985 |
| 444 | Ga0496102_0027171 | 3300048905 | Bacteria | 5111 |
| 445 | Ga0496102_0030887 | 3300048905 | Bacteria | 4799 |
| 446 | Ga0496102_0747299 | 3300048905 | Unclassified | 901 |
| 447 | Ga0496103_0074171 | 3300048906 | Bacteria | 2132 |
| 448 | Ga0496103_0112306 | 3300048906 | Bacteria | 1732 |
| 449 | Ga0496105_0336006 | 3300048908 | Bacteria | 1209 |
| 450 | Ga0496105_0515090 | 3300048908 | Bacteria | 937 |
| 451 | Ga0496106_0124012 | 3300048909 | Bacteria | 2021 |
| 452 | Ga0496106_0391023 | 3300048909 | Bacteria | 1117 |
| 453 | Ga0496107_0207714 | 3300048910 | Bacteria | 1456 |
| 454 | Ga0496109_0006588 | 3300048912 | Bacteria | 9779 |
| 455 | Ga0496109_0433862 | 3300048912 | Bacteria | 1241 |
| 456 | Ga0496110_0011619 | 3300048913 | Bacteria | 7219 |
| 457 | Ga0496110_0827444 | 3300048913 | Bacteria | 831 |
| 458 | Ga0496111_0076220 | 3300048914 | Unclassified | 2444 |
| 459 | Ga0496112_0128667 | 3300048915 | Unclassified | 2503 |
| 460 | Ga0496112_0329301 | 3300048915 | Unclassified | 1471 |
| 461 | Ga0496112_0488824 | 3300048915 | Unclassified | 1167 |
| 462 | Ga0496113_0105891 | 3300048916 | Bacteria | 2184 |
| 463 | Ga0496113_0111964 | 3300048916 | Bacteria | 2126 |
| 464 | Ga0496114_0461409 | 3300048917 | Bacteria | 1124 |
| 465 | Ga0496114_0579917 | 3300048917 | Bacteria | 990 |
| 466 | Ga0496114_1060480 | 3300048917 | Unclassified | 695 |
| 467 | Ga0496114_1536164 | 3300048917 | Bacteria | 554 |
| 468 | Ga0496115_0012130 | 3300048918 | Bacteria | 6481 |
| 469 | Ga0496119_0069680 | 3300048922 | Bacteria | 2066 |
| 470 | Ga0496121_0016937 | 3300048924 | Bacteria | 7487 |
| 471 | Ga0496121_0096602 | 3300048924 | Bacteria | 2292 |
| 472 | Ga0496125_0024057 | 3300048928 | Bacteria | 5610 |
| 473 | Ga0496126_0065674 | 3300048929 | Bacteria | 3246 |
| 474 | Ga0496126_0977527 | 3300048929 | Bacteria | 637 |
| 475 | Ga0501292_136908 | 3300049515 | Unclassified | 510 |
| 476 | Ga0501076_0734613 | 3300049592 | Bacteria | 815 |
| 477 | Ga0501201_016083 | 3300049651 | Bacteria | 764 |
| 478 | Ga0501202_000507 | 3300049652 | Bacteria | 5592 |
| 479 | Ga0501216_013641 | 3300049660 | Bacteria | 1350 |
| 480 | Ga0501217_002038 | 3300049661 | Bacteria | 3908 |
| 481 | Ga0501223_014092 | 3300049663 | Bacteria | 1587 |
| 482 | Ga0501230_011931 | 3300049667 | Bacteria | 1383 |
| 483 | Ga0501233_005464 | 3300049668 | Bacteria | 2359 |
| 484 | Ga0501239_052103 | 3300049672 | Bacteria | 595 |
| 485 | Ga0501246_026658 | 3300049676 | Bacteria | 629 |
| 486 | Ga0501259_123981 | 3300049688 | Bacteria | 617 |
| 487 | Ga0501221_077878 | 3300049704 | Bacteria | 793 |
| 488 | Ga0501225_0004615 | 3300049705 | Bacteria | 4098 |
| 489 | Ga0501229_008713 | 3300049706 | Bacteria | 1270 |
| 490 | Ga0501245_069052 | 3300049708 | Bacteria | 662 |
| 491 | Ga0501079_0588647 | 3300049741 | Bacteria | 875 |
| 492 | Ga0501080_1796014 | 3300049742 | Bacteria | 515 |
| 493 | Ga0501273_005459 | 3300049770 | Bacteria | 1436 |
| 494 | Ga0501280_082445 | 3300049776 | Bacteria | 593 |
| 495 | Ga0501045_0595925 | 3300049824 | Bacteria | 818 |
| 496 | Ga0501204_011255 | 3300049850 | Bacteria | 1060 |
| 497 | nmdc:mga07m45_5826_c1 | 3300050496 | Bacteria | 1663 |
| 498 | nmdc:mga05p37_1194447_c1 | 3300050507 | Bacteria | 786 |
| 499 | nmdc:mga05p37_1360481_c1 | 3300050507 | Unclassified | 718 |
| 500 | nmdc:mga05p37_1651984_c1 | 3300050507 | Bacteria | 628 |
| 501 | nmdc:mga05p37_2141600_c1 | 3300050507 | Unclassified | 522 |
| 502 | nmdc:mga05p37_63_c1 | 3300050507 | Bacteria | 93704 |
| 503 | nmdc:mga05p37_983004_c1 | 3300050507 | Bacteria | 899 |
| 504 | nmdc:mga0qj67_112305_c1 | 3300050509 | Unclassified | 2200 |
| 505 | nmdc:mga06r32_62953_c1 | 3300050510 | Bacteria | 3574 |
| 506 | nmdc:mga06r32_687853_c1 | 3300050510 | Unclassified | 989 |
| 507 | nmdc:mga08y16_308323_c1 | 3300050511 | Bacteria | 1630 |
| 508 | nmdc:mga0n895_19806_c1 | 3300050512 | Bacteria | 6260 |
| 509 | nmdc:mga0n895_432885_c1 | 3300050512 | Bacteria | 1329 |
| 510 | nmdc:mga0n895_55054_c1 | 3300050512 | Bacteria | 3914 |
| 511 | nmdc:mga0n895_90213_c1 | 3300050512 | Bacteria | 3066 |
| 512 | nmdc:mga0rr50_1135260_c1 | 3300050513 | Bacteria | 664 |
| 513 | nmdc:mga0rr50_265172_c1 | 3300050513 | Unclassified | 1430 |
| 514 | nmdc:mga0rr50_74521_c1 | 3300050513 | Bacteria | 2598 |
| 515 | nmdc:mga08x19_127090_c1 | 3300050514 | Bacteria | 1712 |
| 516 | nmdc:mga08x19_669498_c1 | 3300050514 | Bacteria | 736 |
| 517 | nmdc:mga0a205_1388114_c1 | 3300050515 | Bacteria | 550 |
| 518 | Ga0495601_0177842 | 3300053077 | Unclassified | 1391 |
| 519 | Ga0495612_0024164 | 3300053078 | Bacteria | 2440 |
| 520 | Ga0495595_0231291 | 3300053084 | Bacteria | 924 |
| 521 | Ga0495619_0106607 | 3300053085 | Unclassified | 1911 |
| 522 | Ga0495619_0110832 | 3300053085 | Bacteria | 1875 |
| 523 | Ga0495619_0748908 | 3300053085 | Unclassified | 663 |
| 524 | Ga0500566_0460549 | 3300053094 | Unclassified | 555 |
| 525 | Ga0500555_160123 | 3300053103 | Bacteria | 549 |
| 526 | Ga0500562_003085 | 3300053108 | Bacteria | 4162 |
| 527 | Ga0500655_012776 | 3300053133 | Bacteria | 1528 |
| 528 | Ga0500627_0283775 | 3300053158 | Bacteria | 726 |
| 529 | Ga0500634_0276622 | 3300053161 | Bacteria | 680 |
| 530 | Ga0530510_0309470 | 3300061734 | Bacteria | 1183 |
| 531 | Ga0530510_0309928 | 3300061734 | Bacteria | 1182 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046684 | Ga0495669_0049698 | Ga0495669_0049698_657_1151 | 113 |
| 2 | 3300009176 | Ga0105242_10766905 | Ga0105242_107669052 | 118 |
| 3 | 3300030879 | Ga0265765_1013133 | Ga0265765_10131332 | 118 |
| 4 | 3300049824 | Ga0501045_0595925 | Ga0501045_0595925_158_661 | 118 |
| 5 | 3300005290 | Ga0065712_10003716 | Ga0065712_100037162 | 119 |
| 6 | 3300005293 | Ga0065715_10013740 | Ga0065715_100137404 | 119 |
| 7 | 3300005330 | Ga0070690_100001967 | Ga0070690_1000019679 | 119 |
| 8 | 3300005331 | Ga0070670_100006479 | Ga0070670_1000064794 | 119 |
| 9 | 3300005333 | Ga0070677_10007163 | Ga0070677_100071632 | 119 |
| 10 | 3300005334 | Ga0068869_100279860 | Ga0068869_1002798602 | 119 |
| 11 | 3300005336 | Ga0070680_100033253 | Ga0070680_1000332532 | 119 |
| 12 | 3300005339 | Ga0070660_100124956 | Ga0070660_1001249563 | 119 |
| 13 | 3300005340 | Ga0070689_100852580 | Ga0070689_1008525801 | 119 |
| 14 | 3300005341 | Ga0070691_10030696 | Ga0070691_100306963 | 119 |
| 15 | 3300005343 | Ga0070687_100128892 | Ga0070687_1001288922 | 119 |
| 16 | 3300005345 | Ga0070692_10127752 | Ga0070692_101277522 | 119 |
| 17 | 3300005353 | Ga0070669_100035699 | Ga0070669_1000356992 | 119 |
| 18 | 3300005354 | Ga0070675_100026234 | Ga0070675_1000262344 | 119 |
| 19 | 3300005355 | Ga0070671_100082296 | Ga0070671_1000822962 | 119 |
| 20 | 3300005356 | Ga0070674_100020446 | Ga0070674_1000204464 | 119 |
| 21 | 3300005365 | Ga0070688_100179262 | Ga0070688_1001792623 | 119 |
| 22 | 3300005366 | Ga0070659_100063339 | Ga0070659_1000633392 | 119 |
| 23 | 3300005367 | Ga0070667_100011622 | Ga0070667_1000116228 | 119 |
| 24 | 3300005440 | Ga0070705_100767600 | Ga0070705_1007676002 | 119 |
| 25 | 3300005444 | Ga0070694_100101608 | Ga0070694_1001016082 | 119 |
| 26 | 3300005455 | Ga0070663_100059127 | Ga0070663_1000591272 | 119 |
| 27 | 3300005457 | Ga0070662_100395686 | Ga0070662_1003956862 | 119 |
| 28 | 3300005458 | Ga0070681_10021075 | Ga0070681_100210754 | 119 |
| 29 | 3300005467 | Ga0070706_100707609 | Ga0070706_1007076093 | 119 |
| 30 | 3300005471 | Ga0070698_100252628 | Ga0070698_1002526283 | 119 |
| 31 | 3300005518 | Ga0070699_100096482 | Ga0070699_1000964822 | 119 |
| 32 | 3300005530 | Ga0070679_100034533 | Ga0070679_1000345332 | 119 |
| 33 | 3300005536 | Ga0070697_100000542 | Ga0070697_1000005423 | 119 |
| 34 | 3300005536 | Ga0070697_100209542 | Ga0070697_1002095421 | 119 |
| 35 | 3300005543 | Ga0070672_100070292 | Ga0070672_1000702923 | 119 |
| 36 | 3300005544 | Ga0070686_100103885 | Ga0070686_1001038853 | 119 |
| 37 | 3300005545 | Ga0070695_100036695 | Ga0070695_1000366954 | 119 |
| 38 | 3300005545 | Ga0070695_100494532 | Ga0070695_1004945322 | 119 |
| 39 | 3300005546 | Ga0070696_100038160 | Ga0070696_1000381602 | 119 |
| 40 | 3300005546 | Ga0070696_100713004 | Ga0070696_1007130042 | 119 |
| 41 | 3300005547 | Ga0070693_100012949 | Ga0070693_1000129492 | 119 |
| 42 | 3300005548 | Ga0070665_100276841 | Ga0070665_1002768412 | 119 |
| 43 | 3300005563 | Ga0068855_100096198 | Ga0068855_1000961982 | 119 |
| 44 | 3300005564 | Ga0070664_100021201 | Ga0070664_1000212017 | 119 |
| 45 | 3300005578 | Ga0068854_100010313 | Ga0068854_1000103133 | 119 |
| 46 | 3300005614 | Ga0068856_100078468 | Ga0068856_1000784682 | 119 |
| 47 | 3300005718 | Ga0068866_10056606 | Ga0068866_100566062 | 119 |
| 48 | 3300005842 | Ga0068858_101162995 | Ga0068858_1011629951 | 119 |
| 49 | 3300006871 | Ga0075434_100259198 | Ga0075434_1002591982 | 119 |
| 50 | 3300007076 | Ga0075435_100318447 | Ga0075435_1003184472 | 119 |
| 51 | 3300009093 | Ga0105240_10163923 | Ga0105240_101639232 | 119 |
| 52 | 3300009094 | Ga0111539_10060572 | Ga0111539_100605725 | 119 |
| 53 | 3300009098 | Ga0105245_10895590 | Ga0105245_108955901 | 119 |
| 54 | 3300009148 | Ga0105243_10047982 | Ga0105243_100479822 | 119 |
| 55 | 3300009174 | Ga0105241_10141772 | Ga0105241_101417722 | 119 |
| 56 | 3300009176 | Ga0105242_10322426 | Ga0105242_103224262 | 119 |
| 57 | 3300009177 | Ga0105248_11121967 | Ga0105248_111219671 | 119 |
| 58 | 3300009551 | Ga0105238_10883052 | Ga0105238_108830522 | 119 |
| 59 | 3300009553 | Ga0105249_10257651 | Ga0105249_102576513 | 119 |
| 60 | 3300010375 | Ga0105239_10005799 | Ga0105239_1000579910 | 119 |
| 61 | 3300011119 | Ga0105246_10020900 | Ga0105246_100209007 | 119 |
| 62 | 3300013102 | Ga0157371_10095319 | Ga0157371_100953192 | 119 |
| 63 | 3300013296 | Ga0157374_10015332 | Ga0157374_100153327 | 119 |
| 64 | 3300013297 | Ga0157378_12375159 | Ga0157378_123751592 | 119 |
| 65 | 3300013306 | Ga0163162_10050774 | Ga0163162_100507742 | 119 |
| 66 | 3300013307 | Ga0157372_10053296 | Ga0157372_100532964 | 119 |
| 67 | 3300013308 | Ga0157375_10191789 | Ga0157375_101917892 | 119 |
| 68 | 3300014325 | Ga0163163_10331350 | Ga0163163_103313501 | 119 |
| 69 | 3300014497 | Ga0182008_10118981 | Ga0182008_101189812 | 119 |
| 70 | 3300014745 | Ga0157377_10116578 | Ga0157377_101165782 | 119 |
| 71 | 3300014969 | Ga0157376_10008932 | Ga0157376_100089326 | 119 |
| 72 | 3300025315 | Ga0207697_10001865 | Ga0207697_100018652 | 119 |
| 73 | 3300025893 | Ga0207682_10056831 | Ga0207682_100568311 | 119 |
| 74 | 3300025899 | Ga0207642_10045965 | Ga0207642_100459652 | 119 |
| 75 | 3300025901 | Ga0207688_10034491 | Ga0207688_100344912 | 119 |
| 76 | 3300025907 | Ga0207645_10003342 | Ga0207645_100033423 | 119 |
| 77 | 3300025910 | Ga0207684_10774054 | Ga0207684_107740541 | 119 |
| 78 | 3300025912 | Ga0207707_10555850 | Ga0207707_105558502 | 119 |
| 79 | 3300025913 | Ga0207695_10413148 | Ga0207695_104131482 | 119 |
| 80 | 3300025918 | Ga0207662_10048376 | Ga0207662_100483762 | 119 |
| 81 | 3300025919 | Ga0207657_10006391 | Ga0207657_1000639110 | 119 |
| 82 | 3300025920 | Ga0207649_10086454 | Ga0207649_100864542 | 119 |
| 83 | 3300025921 | Ga0207652_10284592 | Ga0207652_102845922 | 119 |
| 84 | 3300025923 | Ga0207681_10076001 | Ga0207681_100760012 | 119 |
| 85 | 3300025925 | Ga0207650_10038064 | Ga0207650_100380642 | 119 |
| 86 | 3300025926 | Ga0207659_10518755 | Ga0207659_105187552 | 119 |
| 87 | 3300025931 | Ga0207644_10148250 | Ga0207644_101482502 | 119 |
| 88 | 3300025933 | Ga0207706_10000999 | Ga0207706_1000099915 | 119 |
| 89 | 3300025934 | Ga0207686_10279619 | Ga0207686_102796192 | 119 |
| 90 | 3300025940 | Ga0207691_10026915 | Ga0207691_100269152 | 119 |
| 91 | 3300025945 | Ga0207679_10787887 | Ga0207679_107878872 | 119 |
| 92 | 3300025949 | Ga0207667_10502672 | Ga0207667_105026723 | 119 |
| 93 | 3300025986 | Ga0207658_10290299 | Ga0207658_102902992 | 119 |
| 94 | 3300026067 | Ga0207678_10093271 | Ga0207678_100932712 | 119 |
| 95 | 3300026075 | Ga0207708_10216782 | Ga0207708_102167822 | 119 |
| 96 | 3300026121 | Ga0207683_10001033 | Ga0207683_1000103314 | 119 |
| 97 | 3300028794 | Ga0307515_10000008 | Ga0307515_10000008144 | 119 |
| 98 | 3300042157 | Ga0439458_0206638 | Ga0439458_0206638_127_492 | 119 |
| 99 | 3300045051 | Ga0451576_0751411 | Ga0451576_0751411_247_672 | 119 |
| 100 | 3300048906 | Ga0496103_0112306 | Ga0496103_0112306_944_1309 | 119 |
| 101 | 3300048910 | Ga0496107_0207714 | Ga0496107_0207714_795_1160 | 119 |
| 102 | 3300048915 | Ga0496112_0329301 | Ga0496112_0329301_573_938 | 119 |
| 103 | 3300048916 | Ga0496113_0111964 | Ga0496113_0111964_1436_1801 | 119 |
| 104 | 3300050511 | nmdc:mga08y16_308323_c1 | nmdc:mga08y16_308323_c1_531_896 | 119 |
| 105 | 3300050512 | nmdc:mga0n895_55054_c1 | nmdc:mga0n895_55054_c1_2874_3239 | 119 |
| 106 | 3300050514 | nmdc:mga08x19_127090_c1 | nmdc:mga08x19_127090_c1_589_954 | 119 |
| 107 | 3300001432 | JGI24034J14986_100666 | JGI24034J14986_1006662 | 120 |
| 108 | 3300001977 | JGI24746J21847_1034850 | JGI24746J21847_10348502 | 120 |
| 109 | 3300002074 | JGI24748J21848_1000002 | JGI24748J21848_1000002263 | 120 |
| 110 | 3300002239 | JGI24034J26672_10000004 | JGI24034J26672_10000004111 | 120 |
| 111 | 3300003203 | JGI25406J46586_10037876 | JGI25406J46586_100378762 | 120 |
| 112 | 3300003320 | rootH2_10256832 | rootH2_102568322 | 120 |
| 113 | 3300003322 | rootL2_10257985 | rootL2_102579854 | 120 |
| 114 | 3300005293 | Ga0065715_11125805 | Ga0065715_111258051 | 120 |
| 115 | 3300005328 | Ga0070676_10001365 | Ga0070676_1000136511 | 120 |
| 116 | 3300005328 | Ga0070676_11037161 | Ga0070676_110371612 | 120 |
| 117 | 3300005329 | Ga0070683_100316280 | Ga0070683_1003162802 | 120 |
| 118 | 3300005330 | Ga0070690_100823741 | Ga0070690_1008237412 | 120 |
| 119 | 3300005331 | Ga0070670_100316144 | Ga0070670_1003161442 | 120 |
| 120 | 3300005338 | Ga0068868_100183959 | Ga0068868_1001839592 | 120 |
| 121 | 3300005338 | Ga0068868_100992340 | Ga0068868_1009923402 | 120 |
| 122 | 3300005338 | Ga0068868_101530638 | Ga0068868_1015306381 | 120 |
| 123 | 3300005338 | Ga0068868_102260975 | Ga0068868_1022609751 | 120 |
| 124 | 3300005340 | Ga0070689_100016478 | Ga0070689_1000164787 | 120 |
| 125 | 3300005340 | Ga0070689_101922173 | Ga0070689_1019221732 | 120 |
| 126 | 3300005340 | Ga0070689_102200758 | Ga0070689_1022007581 | 120 |
| 127 | 3300005343 | Ga0070687_100001554 | Ga0070687_1000015547 | 120 |
| 128 | 3300005343 | Ga0070687_100251155 | Ga0070687_1002511552 | 120 |
| 129 | 3300005343 | Ga0070687_100567447 | Ga0070687_1005674472 | 120 |
| 130 | 3300005347 | Ga0070668_100085699 | Ga0070668_1000856994 | 120 |
| 131 | 3300005353 | Ga0070669_100013242 | Ga0070669_1000132424 | 120 |
| 132 | 3300005353 | Ga0070669_100020637 | Ga0070669_1000206376 | 120 |
| 133 | 3300005353 | Ga0070669_100114782 | Ga0070669_1001147824 | 120 |
| 134 | 3300005354 | Ga0070675_100001838 | Ga0070675_1000018382 | 120 |
| 135 | 3300005354 | Ga0070675_100004173 | Ga0070675_1000041739 | 120 |
| 136 | 3300005354 | Ga0070675_100100022 | Ga0070675_1001000224 | 120 |
| 137 | 3300005355 | Ga0070671_100015497 | Ga0070671_1000154972 | 120 |
| 138 | 3300005356 | Ga0070674_100214152 | Ga0070674_1002141522 | 120 |
| 139 | 3300005364 | Ga0070673_100073674 | Ga0070673_1000736742 | 120 |
| 140 | 3300005364 | Ga0070673_100677866 | Ga0070673_1006778662 | 120 |
| 141 | 3300005364 | Ga0070673_101002897 | Ga0070673_1010028972 | 120 |
| 142 | 3300005365 | Ga0070688_100008040 | Ga0070688_1000080403 | 120 |
| 143 | 3300005365 | Ga0070688_100086866 | Ga0070688_1000868664 | 120 |
| 144 | 3300005367 | Ga0070667_100017551 | Ga0070667_1000175514 | 120 |
| 145 | 3300005367 | Ga0070667_100117872 | Ga0070667_1001178722 | 120 |
| 146 | 3300005406 | Ga0070703_10000028 | Ga0070703_1000002834 | 120 |
| 147 | 3300005406 | Ga0070703_10142371 | Ga0070703_101423712 | 120 |
| 148 | 3300005435 | Ga0070714_100034209 | Ga0070714_1000342094 | 120 |
| 149 | 3300005436 | Ga0070713_100009503 | Ga0070713_1000095032 | 120 |
| 150 | 3300005436 | Ga0070713_100016390 | Ga0070713_1000163902 | 120 |
| 151 | 3300005437 | Ga0070710_10028354 | Ga0070710_100283544 | 120 |
| 152 | 3300005438 | Ga0070701_10575934 | Ga0070701_105759342 | 120 |
| 153 | 3300005439 | Ga0070711_100059933 | Ga0070711_1000599332 | 120 |
| 154 | 3300005439 | Ga0070711_100805808 | Ga0070711_1008058081 | 120 |
| 155 | 3300005441 | Ga0070700_100006039 | Ga0070700_1000060393 | 120 |
| 156 | 3300005441 | Ga0070700_100150489 | Ga0070700_1001504894 | 120 |
| 157 | 3300005444 | Ga0070694_100073264 | Ga0070694_1000732641 | 120 |
| 158 | 3300005444 | Ga0070694_100623497 | Ga0070694_1006234972 | 120 |
| 159 | 3300005445 | Ga0070708_100084280 | Ga0070708_1000842802 | 120 |
| 160 | 3300005455 | Ga0070663_100487212 | Ga0070663_1004872121 | 120 |
| 161 | 3300005456 | Ga0070678_100195213 | Ga0070678_1001952133 | 120 |
| 162 | 3300005456 | Ga0070678_100256899 | Ga0070678_1002568992 | 120 |
| 163 | 3300005458 | Ga0070681_10325744 | Ga0070681_103257442 | 120 |
| 164 | 3300005466 | Ga0070685_10020774 | Ga0070685_100207741 | 120 |
| 165 | 3300005467 | Ga0070706_100010342 | Ga0070706_1000103429 | 120 |
| 166 | 3300005467 | Ga0070706_100386337 | Ga0070706_1003863372 | 120 |
| 167 | 3300005467 | Ga0070706_100527300 | Ga0070706_1005273002 | 120 |
| 168 | 3300005468 | Ga0070707_100000677 | Ga0070707_10000067711 | 120 |
| 169 | 3300005471 | Ga0070698_100247589 | Ga0070698_1002475892 | 120 |
| 170 | 3300005471 | Ga0070698_101344631 | Ga0070698_1013446311 | 120 |
| 171 | 3300005518 | Ga0070699_100005249 | Ga0070699_1000052495 | 120 |
| 172 | 3300005518 | Ga0070699_100084071 | Ga0070699_1000840712 | 120 |
| 173 | 3300005518 | Ga0070699_100901264 | Ga0070699_1009012642 | 120 |
| 174 | 3300005530 | Ga0070679_100517025 | Ga0070679_1005170252 | 120 |
| 175 | 3300005535 | Ga0070684_100320759 | Ga0070684_1003207591 | 120 |
| 176 | 3300005539 | Ga0068853_100778756 | Ga0068853_1007787561 | 120 |
| 177 | 3300005543 | Ga0070672_100041276 | Ga0070672_1000412762 | 120 |
| 178 | 3300005545 | Ga0070695_100128826 | Ga0070695_1001288263 | 120 |
| 179 | 3300005545 | Ga0070695_100335822 | Ga0070695_1003358223 | 120 |
| 180 | 3300005545 | Ga0070695_101509184 | Ga0070695_1015091841 | 120 |
| 181 | 3300005546 | Ga0070696_101046366 | Ga0070696_1010463662 | 120 |
| 182 | 3300005546 | Ga0070696_101099534 | Ga0070696_1010995341 | 120 |
| 183 | 3300005547 | Ga0070693_101072797 | Ga0070693_1010727972 | 120 |
| 184 | 3300005549 | Ga0070704_100194128 | Ga0070704_1001941283 | 120 |
| 185 | 3300005549 | Ga0070704_100243365 | Ga0070704_1002433651 | 120 |
| 186 | 3300005549 | Ga0070704_100434567 | Ga0070704_1004345672 | 120 |
| 187 | 3300005563 | Ga0068855_100585072 | Ga0068855_1005850722 | 120 |
| 188 | 3300005564 | Ga0070664_100013944 | Ga0070664_1000139441 | 120 |
| 189 | 3300005564 | Ga0070664_100034015 | Ga0070664_1000340153 | 120 |
| 190 | 3300005577 | Ga0068857_100057187 | Ga0068857_1000571874 | 120 |
| 191 | 3300005578 | Ga0068854_100124664 | Ga0068854_1001246642 | 120 |
| 192 | 3300005578 | Ga0068854_100654585 | Ga0068854_1006545851 | 120 |
| 193 | 3300005615 | Ga0070702_100413557 | Ga0070702_1004135573 | 120 |
| 194 | 3300005617 | Ga0068859_100003211 | Ga0068859_10000321112 | 120 |
| 195 | 3300005617 | Ga0068859_100013203 | Ga0068859_1000132032 | 120 |
| 196 | 3300005617 | Ga0068859_100040385 | Ga0068859_1000403852 | 120 |
| 197 | 3300005617 | Ga0068859_100391782 | Ga0068859_1003917823 | 120 |
| 198 | 3300005617 | Ga0068859_100701645 | Ga0068859_1007016451 | 120 |
| 199 | 3300005719 | Ga0068861_101487504 | Ga0068861_1014875042 | 120 |
| 200 | 3300005841 | Ga0068863_100065955 | Ga0068863_1000659552 | 120 |
| 201 | 3300005841 | Ga0068863_100408514 | Ga0068863_1004085142 | 120 |
| 202 | 3300005841 | Ga0068863_101029225 | Ga0068863_1010292252 | 120 |
| 203 | 3300005843 | Ga0068860_100065339 | Ga0068860_1000653392 | 120 |
| 204 | 3300005843 | Ga0068860_100613528 | Ga0068860_1006135282 | 120 |
| 205 | 3300005843 | Ga0068860_101897346 | Ga0068860_1018973462 | 120 |
| 206 | 3300005844 | Ga0068862_100008674 | Ga0068862_1000086747 | 120 |
| 207 | 3300005844 | Ga0068862_100220408 | Ga0068862_1002204083 | 120 |
| 208 | 3300005937 | Ga0081455_10000418 | Ga0081455_100004189 | 120 |
| 209 | 3300005937 | Ga0081455_10331710 | Ga0081455_103317102 | 120 |
| 210 | 3300005985 | Ga0081539_10000346 | Ga0081539_100003468 | 120 |
| 211 | 3300005985 | Ga0081539_10003337 | Ga0081539_1000333710 | 120 |
| 212 | 3300006028 | Ga0070717_10011421 | Ga0070717_100114213 | 120 |
| 213 | 3300006028 | Ga0070717_10192232 | Ga0070717_101922322 | 120 |
| 214 | 3300006173 | Ga0070716_100018531 | Ga0070716_1000185312 | 120 |
| 215 | 3300006173 | Ga0070716_100235579 | Ga0070716_1002355791 | 120 |
| 216 | 3300006173 | Ga0070716_101463951 | Ga0070716_1014639511 | 120 |
| 217 | 3300006175 | Ga0070712_100006993 | Ga0070712_1000069933 | 120 |
| 218 | 3300006175 | Ga0070712_100083329 | Ga0070712_1000833294 | 120 |
| 219 | 3300006175 | Ga0070712_100085384 | Ga0070712_1000853844 | 120 |
| 220 | 3300006353 | Ga0075370_10004194 | Ga0075370_100041944 | 120 |
| 221 | 3300006358 | Ga0068871_100884720 | Ga0068871_1008847202 | 120 |
| 222 | 3300006846 | Ga0075430_100025943 | Ga0075430_1000259438 | 120 |
| 223 | 3300006847 | Ga0075431_100004811 | Ga0075431_1000048116 | 120 |
| 224 | 3300006847 | Ga0075431_100105862 | Ga0075431_1001058625 | 120 |
| 225 | 3300006871 | Ga0075434_100022420 | Ga0075434_1000224208 | 120 |
| 226 | 3300006880 | Ga0075429_101103038 | Ga0075429_1011030381 | 120 |
| 227 | 3300006881 | Ga0068865_100284671 | Ga0068865_1002846712 | 120 |
| 228 | 3300006881 | Ga0068865_100455234 | Ga0068865_1004552342 | 120 |
| 229 | 3300006914 | Ga0075436_100034783 | Ga0075436_1000347833 | 120 |
| 230 | 3300006914 | Ga0075436_100377736 | Ga0075436_1003777362 | 120 |
| 231 | 3300006914 | Ga0075436_101107564 | Ga0075436_1011075642 | 120 |
| 232 | 3300006931 | Ga0097620_100003211 | Ga0097620_1000032115 | 120 |
| 233 | 3300006931 | Ga0097620_100013203 | Ga0097620_1000132032 | 120 |
| 234 | 3300006931 | Ga0097620_100040388 | Ga0097620_1000403882 | 120 |
| 235 | 3300006931 | Ga0097620_100391765 | Ga0097620_1003917653 | 120 |
| 236 | 3300006931 | Ga0097620_100701673 | Ga0097620_1007016733 | 120 |
| 237 | 3300007076 | Ga0075435_100043004 | Ga0075435_1000430042 | 120 |
| 238 | 3300007076 | Ga0075435_100310939 | Ga0075435_1003109392 | 120 |
| 239 | 3300007076 | Ga0075435_100394520 | Ga0075435_1003945202 | 120 |
| 240 | 3300009098 | Ga0105245_10502328 | Ga0105245_105023281 | 120 |
| 241 | 3300009101 | Ga0105247_10064908 | Ga0105247_100649082 | 120 |
| 242 | 3300009101 | Ga0105247_10435517 | Ga0105247_104355172 | 120 |
| 243 | 3300009147 | Ga0114129_10000925 | Ga0114129_100009253 | 120 |
| 244 | 3300009147 | Ga0114129_10560851 | Ga0114129_105608511 | 120 |
| 245 | 3300009147 | Ga0114129_10828683 | Ga0114129_108286832 | 120 |
| 246 | 3300009147 | Ga0114129_10837032 | Ga0114129_108370322 | 120 |
| 247 | 3300009147 | Ga0114129_11471129 | Ga0114129_114711292 | 120 |
| 248 | 3300009147 | Ga0114129_13302790 | Ga0114129_133027901 | 120 |
| 249 | 3300009148 | Ga0105243_10000996 | Ga0105243_1000099624 | 120 |
| 250 | 3300009176 | Ga0105242_10435053 | Ga0105242_104350532 | 120 |
| 251 | 3300009176 | Ga0105242_11449483 | Ga0105242_114494832 | 120 |
| 252 | 3300009177 | Ga0105248_10003342 | Ga0105248_1000334210 | 120 |
| 253 | 3300009551 | Ga0105238_10000453 | Ga0105238_100004538 | 120 |
| 254 | 3300009551 | Ga0105238_10015271 | Ga0105238_100152714 | 120 |
| 255 | 3300009553 | Ga0105249_10100889 | Ga0105249_101008894 | 120 |
| 256 | 3300009553 | Ga0105249_10214317 | Ga0105249_102143172 | 120 |
| 257 | 3300010375 | Ga0105239_12130245 | Ga0105239_121302451 | 120 |
| 258 | 3300011119 | Ga0105246_10104300 | Ga0105246_101043002 | 120 |
| 259 | 3300011119 | Ga0105246_11937632 | Ga0105246_119376322 | 120 |
| 260 | 3300013105 | Ga0157369_10914132 | Ga0157369_109141322 | 120 |
| 261 | 3300013296 | Ga0157374_10809308 | Ga0157374_108093082 | 120 |
| 262 | 3300013297 | Ga0157378_10000015 | Ga0157378_10000015100 | 120 |
| 263 | 3300013297 | Ga0157378_10066555 | Ga0157378_100665551 | 120 |
| 264 | 3300013297 | Ga0157378_10192643 | Ga0157378_101926434 | 120 |
| 265 | 3300013297 | Ga0157378_11283965 | Ga0157378_112839652 | 120 |
| 266 | 3300013297 | Ga0157378_11303248 | Ga0157378_113032482 | 120 |
| 267 | 3300013297 | Ga0157378_11757263 | Ga0157378_117572632 | 120 |
| 268 | 3300013306 | Ga0163162_11953080 | Ga0163162_119530802 | 120 |
| 269 | 3300013307 | Ga0157372_10032933 | Ga0157372_100329337 | 120 |
| 270 | 3300013307 | Ga0157372_11858954 | Ga0157372_118589541 | 120 |
| 271 | 3300013308 | Ga0157375_10377520 | Ga0157375_103775202 | 120 |
| 272 | 3300013308 | Ga0157375_11014638 | Ga0157375_110146382 | 120 |
| 273 | 3300013308 | Ga0157375_12487289 | Ga0157375_124872892 | 120 |
| 274 | 3300013308 | Ga0157375_12580182 | Ga0157375_125801821 | 120 |
| 275 | 3300014325 | Ga0163163_10096287 | Ga0163163_100962872 | 120 |
| 276 | 3300014325 | Ga0163163_10115414 | Ga0163163_101154142 | 120 |
| 277 | 3300014325 | Ga0163163_11423705 | Ga0163163_114237052 | 120 |
| 278 | 3300014325 | Ga0163163_12610992 | Ga0163163_126109921 | 120 |
| 279 | 3300014325 | Ga0163163_13070614 | Ga0163163_130706142 | 120 |
| 280 | 3300014326 | Ga0157380_11754419 | Ga0157380_117544192 | 120 |
| 281 | 3300014745 | Ga0157377_10629509 | Ga0157377_106295092 | 120 |
| 282 | 3300014745 | Ga0157377_10928767 | Ga0157377_109287671 | 120 |
| 283 | 3300014969 | Ga0157376_10116132 | Ga0157376_101161322 | 120 |
| 284 | 3300014969 | Ga0157376_11229459 | Ga0157376_112294592 | 120 |
| 285 | 3300025271 | Ga0207666_1030537 | Ga0207666_10305372 | 120 |
| 286 | 3300025315 | Ga0207697_10001859 | Ga0207697_100018593 | 120 |
| 287 | 3300025885 | Ga0207653_10000047 | Ga0207653_1000004722 | 120 |
| 288 | 3300025898 | Ga0207692_10075734 | Ga0207692_100757344 | 120 |
| 289 | 3300025898 | Ga0207692_10633053 | Ga0207692_106330532 | 120 |
| 290 | 3300025900 | Ga0207710_10000004 | Ga0207710_10000004104 | 120 |
| 291 | 3300025900 | Ga0207710_10127913 | Ga0207710_101279132 | 120 |
| 292 | 3300025901 | Ga0207688_10569816 | Ga0207688_105698162 | 120 |
| 293 | 3300025903 | Ga0207680_10167098 | Ga0207680_101670982 | 120 |
| 294 | 3300025907 | Ga0207645_10004181 | Ga0207645_1000418112 | 120 |
| 295 | 3300025907 | Ga0207645_10061525 | Ga0207645_100615254 | 120 |
| 296 | 3300025908 | Ga0207643_10001177 | Ga0207643_100011775 | 120 |
| 297 | 3300025910 | Ga0207684_10011572 | Ga0207684_100115722 | 120 |
| 298 | 3300025910 | Ga0207684_10329809 | Ga0207684_103298092 | 120 |
| 299 | 3300025910 | Ga0207684_10555190 | Ga0207684_105551902 | 120 |
| 300 | 3300025910 | Ga0207684_11411507 | Ga0207684_114115071 | 120 |
| 301 | 3300025912 | Ga0207707_10863292 | Ga0207707_108632922 | 120 |
| 302 | 3300025913 | Ga0207695_10401455 | Ga0207695_104014552 | 120 |
| 303 | 3300025915 | Ga0207693_10010700 | Ga0207693_100107007 | 120 |
| 304 | 3300025915 | Ga0207693_10222704 | Ga0207693_102227042 | 120 |
| 305 | 3300025916 | Ga0207663_10041856 | Ga0207663_100418565 | 120 |
| 306 | 3300025916 | Ga0207663_10436040 | Ga0207663_104360403 | 120 |
| 307 | 3300025918 | Ga0207662_10019692 | Ga0207662_100196927 | 120 |
| 308 | 3300025918 | Ga0207662_10817734 | Ga0207662_108177342 | 120 |
| 309 | 3300025922 | Ga0207646_10000550 | Ga0207646_1000055014 | 120 |
| 310 | 3300025923 | Ga0207681_10025343 | Ga0207681_100253432 | 120 |
| 311 | 3300025923 | Ga0207681_10030921 | Ga0207681_100309213 | 120 |
| 312 | 3300025923 | Ga0207681_10211174 | Ga0207681_102111742 | 120 |
| 313 | 3300025924 | Ga0207694_10003055 | Ga0207694_1000305513 | 120 |
| 314 | 3300025924 | Ga0207694_10170679 | Ga0207694_101706793 | 120 |
| 315 | 3300025925 | Ga0207650_10237763 | Ga0207650_102377631 | 120 |
| 316 | 3300025926 | Ga0207659_10059210 | Ga0207659_100592104 | 120 |
| 317 | 3300025926 | Ga0207659_10092391 | Ga0207659_100923914 | 120 |
| 318 | 3300025926 | Ga0207659_10283266 | Ga0207659_102832662 | 120 |
| 319 | 3300025927 | Ga0207687_10176672 | Ga0207687_101766723 | 120 |
| 320 | 3300025929 | Ga0207664_10197518 | Ga0207664_101975182 | 120 |
| 321 | 3300025931 | Ga0207644_10002425 | Ga0207644_100024253 | 120 |
| 322 | 3300025931 | Ga0207644_10473992 | Ga0207644_104739922 | 120 |
| 323 | 3300025932 | Ga0207690_10201492 | Ga0207690_102014921 | 120 |
| 324 | 3300025933 | Ga0207706_10028863 | Ga0207706_100288632 | 120 |
| 325 | 3300025933 | Ga0207706_10068096 | Ga0207706_100680962 | 120 |
| 326 | 3300025933 | Ga0207706_10501378 | Ga0207706_105013781 | 120 |
| 327 | 3300025934 | Ga0207686_10630113 | Ga0207686_106301133 | 120 |
| 328 | 3300025935 | Ga0207709_10001187 | Ga0207709_100011872 | 120 |
| 329 | 3300025935 | Ga0207709_10596040 | Ga0207709_105960402 | 120 |
| 330 | 3300025937 | Ga0207669_10299931 | Ga0207669_102999312 | 120 |
| 331 | 3300025938 | Ga0207704_10624163 | Ga0207704_106241632 | 120 |
| 332 | 3300025939 | Ga0207665_10002211 | Ga0207665_100022115 | 120 |
| 333 | 3300025940 | Ga0207691_10008673 | Ga0207691_100086731 | 120 |
| 334 | 3300025941 | Ga0207711_10006529 | Ga0207711_1000652911 | 120 |
| 335 | 3300025941 | Ga0207711_10467061 | Ga0207711_104670612 | 120 |
| 336 | 3300025942 | Ga0207689_10001417 | Ga0207689_100014173 | 120 |
| 337 | 3300025945 | Ga0207679_10024837 | Ga0207679_100248373 | 120 |
| 338 | 3300025961 | Ga0207712_10195838 | Ga0207712_101958383 | 120 |
| 339 | 3300025972 | Ga0207668_10014858 | Ga0207668_100148583 | 120 |
| 340 | 3300025986 | Ga0207658_10047257 | Ga0207658_100472574 | 120 |
| 341 | 3300025986 | Ga0207658_10347951 | Ga0207658_103479513 | 120 |
| 342 | 3300025986 | Ga0207658_10436553 | Ga0207658_104365531 | 120 |
| 343 | 3300026023 | Ga0207677_10250654 | Ga0207677_102506542 | 120 |
| 344 | 3300026023 | Ga0207677_10465063 | Ga0207677_104650632 | 120 |
| 345 | 3300026035 | Ga0207703_10165442 | Ga0207703_101654422 | 120 |
| 346 | 3300026041 | Ga0207639_10674148 | Ga0207639_106741482 | 120 |
| 347 | 3300026075 | Ga0207708_10025555 | Ga0207708_100255558 | 120 |
| 348 | 3300026075 | Ga0207708_10064775 | Ga0207708_100647754 | 120 |
| 349 | 3300026088 | Ga0207641_10329707 | Ga0207641_103297072 | 120 |
| 350 | 3300026088 | Ga0207641_10503382 | Ga0207641_105033822 | 120 |
| 351 | 3300026089 | Ga0207648_10393763 | Ga0207648_103937633 | 120 |
| 352 | 3300026116 | Ga0207674_10044024 | Ga0207674_100440243 | 120 |
| 353 | 3300026118 | Ga0207675_100014281 | Ga0207675_1000142814 | 120 |
| 354 | 3300026121 | Ga0207683_10300578 | Ga0207683_103005782 | 120 |
| 355 | 3300026142 | Ga0207698_10527881 | Ga0207698_105278812 | 120 |
| 356 | 3300028379 | Ga0268266_10359571 | Ga0268266_103595713 | 120 |
| 357 | 3300028380 | Ga0268265_10060463 | Ga0268265_100604632 | 120 |
| 358 | 3300028380 | Ga0268265_10284054 | Ga0268265_102840543 | 120 |
| 359 | 3300028381 | Ga0268264_11047838 | Ga0268264_110478382 | 120 |
| 360 | 3300028381 | Ga0268264_11163453 | Ga0268264_111634532 | 120 |
| 361 | 3300028800 | Ga0265338_10525447 | Ga0265338_105254472 | 120 |
| 362 | 3300031456 | Ga0307513_10200799 | Ga0307513_102007994 | 120 |
| 363 | 3300031548 | Ga0307408_100924697 | Ga0307408_1009246972 | 120 |
| 364 | 3300031691 | Ga0316579_10318330 | Ga0316579_103183301 | 120 |
| 365 | 3300031731 | Ga0307405_10023447 | Ga0307405_100234476 | 120 |
| 366 | 3300031731 | Ga0307405_10311624 | Ga0307405_103116242 | 120 |
| 367 | 3300031852 | Ga0307410_10009883 | Ga0307410_100098831 | 120 |
| 368 | 3300031852 | Ga0307410_10811011 | Ga0307410_108110111 | 120 |
| 369 | 3300031852 | Ga0307410_11763947 | Ga0307410_117639472 | 120 |
| 370 | 3300031901 | Ga0307406_10022338 | Ga0307406_100223382 | 120 |
| 371 | 3300031911 | Ga0307412_10058787 | Ga0307412_100587874 | 120 |
| 372 | 3300032002 | Ga0307416_100016556 | Ga0307416_1000165562 | 120 |
| 373 | 3300032004 | Ga0307414_10006929 | Ga0307414_100069292 | 120 |
| 374 | 3300032004 | Ga0307414_10690872 | Ga0307414_106908722 | 120 |
| 375 | 3300032005 | Ga0307411_10359936 | Ga0307411_103599363 | 120 |
| 376 | 3300032005 | Ga0307411_10601877 | Ga0307411_106018772 | 120 |
| 377 | 3300032005 | Ga0307411_12358362 | Ga0307411_123583621 | 120 |
| 378 | 3300032126 | Ga0307415_100005575 | Ga0307415_1000055757 | 120 |
| 379 | 3300035116 | Ga0373945_0304019 | Ga0373945_0304019_70_435 | 120 |
| 380 | 3300035117 | Ga0373953_0053370 | Ga0373953_0053370_457_831 | 120 |
| 381 | 3300035118 | Ga0373954_0137601 | Ga0373954_0137601_31_405 | 120 |
| 382 | 3300035119 | Ga0373956_0430237 | Ga0373956_0430237_157_522 | 120 |
| 383 | 3300035170 | Ga0373943_0072420 | Ga0373943_0072420_429_791 | 120 |
| 384 | 3300035410 | Ga0373924_0009892 | Ga0373924_0009892_2579_2944 | 120 |
| 385 | 3300035692 | Ga0373935_0522089 | Ga0373935_0522089_35_397 | 120 |
| 386 | 3300035724 | Ga0373933_0011694 | Ga0373933_0011694_1303_1677 | 120 |
| 387 | 3300035725 | Ga0373947_0252479 | Ga0373947_0252479_43_408 | 120 |
| 388 | 3300036401 | Ga0373937_0002398 | Ga0373937_0002398_4618_4992 | 120 |
| 389 | 3300036401 | Ga0373937_0222746 | Ga0373937_0222746_921_1286 | 120 |
| 390 | 3300036401 | Ga0373937_1018668 | Ga0373937_1018668_339_704 | 120 |
| 391 | 3300038726 | Ga0400490_38445 | Ga0400490_38445_2061_2432 | 120 |
| 392 | 3300038727 | Ga0400491_27425 | Ga0400491_27425_788_1159 | 120 |
| 393 | 3300039438 | Ga0436360_0507637 | Ga0436360_0507637_147_527 | 120 |
| 394 | 3300039438 | Ga0436360_1307698 | Ga0436360_1307698_335_697 | 120 |
| 395 | 3300039453 | Ga0436362_1097775 | Ga0436362_1097775_180_542 | 120 |
| 396 | 3300041512 | Ga0451853_1505179 | Ga0451853_1505179_147_512 | 120 |
| 397 | 3300042157 | Ga0439458_0188334 | Ga0439458_0188334_174_539 | 120 |
| 398 | 3300042436 | Ga0439435_0054705 | Ga0439435_0054705_287_649 | 120 |
| 399 | 3300042438 | Ga0439459_0160735 | Ga0439459_0160735_164_529 | 120 |
| 400 | 3300046454 | Ga0495592_0137169 | Ga0495592_0137169_418_792 | 120 |
| 401 | 3300046459 | Ga0495629_0280222 | Ga0495629_0280222_20_385 | 120 |
| 402 | 3300046460 | Ga0495638_0638222 | Ga0495638_0638222_78_443 | 120 |
| 403 | 3300046463 | Ga0495653_0689580 | Ga0495653_0689580_193_558 | 120 |
| 404 | 3300046472 | Ga0495580_0147639 | Ga0495580_0147639_1212_1577 | 120 |
| 405 | 3300046477 | Ga0495664_0226376 | Ga0495664_0226376_472_837 | 120 |
| 406 | 3300046511 | Ga0495608_0279860 | Ga0495608_0279860_33_398 | 120 |
| 407 | 3300046511 | Ga0495608_0395505 | Ga0495608_0395505_105_479 | 120 |
| 408 | 3300046516 | Ga0495628_0009589 | Ga0495628_0009589_2954_3319 | 120 |
| 409 | 3300046517 | Ga0495630_0342556 | Ga0495630_0342556_364_738 | 120 |
| 410 | 3300046517 | Ga0495630_0859365 | Ga0495630_0859365_87_449 | 120 |
| 411 | 3300046517 | Ga0495630_1128335 | Ga0495630_1128335_96_461 | 120 |
| 412 | 3300046519 | Ga0495632_0147356 | Ga0495632_0147356_107_472 | 120 |
| 413 | 3300046520 | Ga0495637_0009569 | Ga0495637_0009569_1624_1992 | 120 |
| 414 | 3300046525 | Ga0495663_0051848 | Ga0495663_0051848_465_842 | 120 |
| 415 | 3300046525 | Ga0495663_0150724 | Ga0495663_0150724_211_573 | 120 |
| 416 | 3300046529 | Ga0495652_0140516 | Ga0495652_0140516_1126_1491 | 120 |
| 417 | 3300046529 | Ga0495652_0198552 | Ga0495652_0198552_358_732 | 120 |
| 418 | 3300046536 | Ga0495587_0004194 | Ga0495587_0004194_9120_9494 | 120 |
| 419 | 3300046536 | Ga0495587_0223241 | Ga0495587_0223241_362_727 | 120 |
| 420 | 3300046543 | Ga0495645_0000820 | Ga0495645_0000820_18461_18835 | 120 |
| 421 | 3300046543 | Ga0495645_0002759 | Ga0495645_0002759_9745_10110 | 120 |
| 422 | 3300046559 | Ga0495667_0002410 | Ga0495667_0002410_1945_2319 | 120 |
| 423 | 3300046559 | Ga0495667_0276740 | Ga0495667_0276740_198_692 | 120 |
| 424 | 3300046660 | Ga0495625_0076225 | Ga0495625_0076225_1692_2057 | 120 |
| 425 | 3300046663 | Ga0495635_0945050 | Ga0495635_0945050_165_530 | 120 |
| 426 | 3300046675 | Ga0495657_0108884 | Ga0495657_0108884_654_1148 | 120 |
| 427 | 3300046678 | Ga0495599_0012245 | Ga0495599_0012245_2179_2544 | 120 |
| 428 | 3300046678 | Ga0495599_0021219 | Ga0495599_0021219_1351_1725 | 120 |
| 429 | 3300046679 | Ga0495623_0001030 | Ga0495623_0001030_10292_10666 | 120 |
| 430 | 3300046679 | Ga0495623_0113428 | Ga0495623_0113428_876_1241 | 120 |
| 431 | 3300046680 | Ga0495646_0601879 | Ga0495646_0601879_11_376 | 120 |
| 432 | 3300046684 | Ga0495669_0307797 | Ga0495669_0307797_382_744 | 120 |
| 433 | 3300046809 | Ga0495600_0145983 | Ga0495600_0145983_735_1109 | 120 |
| 434 | 3300047317 | Ga0495604_0375459 | Ga0495604_0375459_354_719 | 120 |
| 435 | 3300047318 | Ga0495636_0152378 | Ga0495636_0152378_540_902 | 120 |
| 436 | 3300047319 | Ga0495674_0162166 | Ga0495674_0162166_913_1278 | 120 |
| 437 | 3300047322 | Ga0495680_0108504 | Ga0495680_0108504_1619_1984 | 120 |
| 438 | 3300047444 | Ga0495675_0001362 | Ga0495675_0001362_11188_11562 | 120 |
| 439 | 3300047444 | Ga0495675_0033676 | Ga0495675_0033676_1163_1528 | 120 |
| 440 | 3300047445 | Ga0495677_0036485 | Ga0495677_0036485_87_461 | 120 |
| 441 | 3300047469 | Ga0495673_0291426 | Ga0495673_0291426_96_461 | 120 |
| 442 | 3300047471 | Ga0495684_0011322 | Ga0495684_0011322_5067_5441 | 120 |
| 443 | 3300047471 | Ga0495684_0776527 | Ga0495684_0776527_40_405 | 120 |
| 444 | 3300048088 | Ga0495602_0066884 | Ga0495602_0066884_1830_2195 | 120 |
| 445 | 3300048088 | Ga0495602_0961981 | Ga0495602_0961981_58_432 | 120 |
| 446 | 3300048090 | Ga0495615_0073356 | Ga0495615_0073356_62_436 | 120 |
| 447 | 3300048091 | Ga0495626_0011025 | Ga0495626_0011025_1172_1540 | 120 |
| 448 | 3300048903 | Ga0496100_0476942 | Ga0496100_0476942_387_752 | 120 |
| 449 | 3300048903 | Ga0496100_0652442 | Ga0496100_0652442_122_496 | 120 |
| 450 | 3300048904 | Ga0496101_0070442 | Ga0496101_0070442_679_1044 | 120 |
| 451 | 3300048904 | Ga0496101_0476625 | Ga0496101_0476625_60_434 | 120 |
| 452 | 3300048905 | Ga0496102_0027171 | Ga0496102_0027171_2832_3206 | 120 |
| 453 | 3300048905 | Ga0496102_0030887 | Ga0496102_0030887_3282_3647 | 120 |
| 454 | 3300048905 | Ga0496102_0747299 | Ga0496102_0747299_254_616 | 120 |
| 455 | 3300048906 | Ga0496103_0074171 | Ga0496103_0074171_1645_2019 | 120 |
| 456 | 3300048908 | Ga0496105_0336006 | Ga0496105_0336006_274_639 | 120 |
| 457 | 3300048908 | Ga0496105_0515090 | Ga0496105_0515090_204_569 | 120 |
| 458 | 3300048909 | Ga0496106_0124012 | Ga0496106_0124012_1559_1933 | 120 |
| 459 | 3300048909 | Ga0496106_0391023 | Ga0496106_0391023_539_904 | 120 |
| 460 | 3300048912 | Ga0496109_0006588 | Ga0496109_0006588_1693_2067 | 120 |
| 461 | 3300048912 | Ga0496109_0433862 | Ga0496109_0433862_16_381 | 120 |
| 462 | 3300048913 | Ga0496110_0011619 | Ga0496110_0011619_4820_5194 | 120 |
| 463 | 3300048913 | Ga0496110_0827444 | Ga0496110_0827444_313_678 | 120 |
| 464 | 3300048914 | Ga0496111_0076220 | Ga0496111_0076220_1878_2252 | 120 |
| 465 | 3300048915 | Ga0496112_0128667 | Ga0496112_0128667_1845_2219 | 120 |
| 466 | 3300048915 | Ga0496112_0488824 | Ga0496112_0488824_594_959 | 120 |
| 467 | 3300048916 | Ga0496113_0105891 | Ga0496113_0105891_338_712 | 120 |
| 468 | 3300048917 | Ga0496114_0461409 | Ga0496114_0461409_720_1085 | 120 |
| 469 | 3300048917 | Ga0496114_0579917 | Ga0496114_0579917_356_721 | 120 |
| 470 | 3300048917 | Ga0496114_1060480 | Ga0496114_1060480_164_538 | 120 |
| 471 | 3300048917 | Ga0496114_1536164 | Ga0496114_1536164_65_430 | 120 |
| 472 | 3300048918 | Ga0496115_0012130 | Ga0496115_0012130_3674_4039 | 120 |
| 473 | 3300048922 | Ga0496119_0069680 | Ga0496119_0069680_283_648 | 120 |
| 474 | 3300048924 | Ga0496121_0016937 | Ga0496121_0016937_5117_5482 | 120 |
| 475 | 3300048924 | Ga0496121_0096602 | Ga0496121_0096602_1639_2013 | 120 |
| 476 | 3300048928 | Ga0496125_0024057 | Ga0496125_0024057_1863_2228 | 120 |
| 477 | 3300048929 | Ga0496126_0065674 | Ga0496126_0065674_737_1102 | 120 |
| 478 | 3300048929 | Ga0496126_0977527 | Ga0496126_0977527_52_417 | 120 |
| 479 | 3300049515 | Ga0501292_136908 | Ga0501292_136908_66_431 | 120 |
| 480 | 3300049592 | Ga0501076_0734613 | Ga0501076_0734613_164_529 | 120 |
| 481 | 3300049651 | Ga0501201_016083 | Ga0501201_016083_172_534 | 120 |
| 482 | 3300049652 | Ga0501202_000507 | Ga0501202_000507_786_1148 | 120 |
| 483 | 3300049660 | Ga0501216_013641 | Ga0501216_013641_536_898 | 120 |
| 484 | 3300049661 | Ga0501217_002038 | Ga0501217_002038_88_450 | 120 |
| 485 | 3300049663 | Ga0501223_014092 | Ga0501223_014092_318_680 | 120 |
| 486 | 3300049667 | Ga0501230_011931 | Ga0501230_011931_813_1175 | 120 |
| 487 | 3300049668 | Ga0501233_005464 | Ga0501233_005464_1853_2215 | 120 |
| 488 | 3300049672 | Ga0501239_052103 | Ga0501239_052103_192_554 | 120 |
| 489 | 3300049676 | Ga0501246_026658 | Ga0501246_026658_91_453 | 120 |
| 490 | 3300049688 | Ga0501259_123981 | Ga0501259_123981_35_397 | 120 |
| 491 | 3300049704 | Ga0501221_077878 | Ga0501221_077878_140_502 | 120 |
| 492 | 3300049705 | Ga0501225_0004615 | Ga0501225_0004615_174_536 | 120 |
| 493 | 3300049706 | Ga0501229_008713 | Ga0501229_008713_355_717 | 120 |
| 494 | 3300049708 | Ga0501245_069052 | Ga0501245_069052_253_615 | 120 |
| 495 | 3300049741 | Ga0501079_0588647 | Ga0501079_0588647_104_469 | 120 |
| 496 | 3300049742 | Ga0501080_1796014 | Ga0501080_1796014_132_494 | 120 |
| 497 | 3300049770 | Ga0501273_005459 | Ga0501273_005459_154_516 | 120 |
| 498 | 3300049776 | Ga0501280_082445 | Ga0501280_082445_38_400 | 120 |
| 499 | 3300049850 | Ga0501204_011255 | Ga0501204_011255_14_376 | 120 |
| 500 | 3300050496 | nmdc:mga07m45_5826_c1 | nmdc:mga07m45_5826_c1_1262_1636 | 120 |
| 501 | 3300050507 | nmdc:mga05p37_1194447_c1 | nmdc:mga05p37_1194447_c1_38_400 | 120 |
| 502 | 3300050507 | nmdc:mga05p37_1360481_c1 | nmdc:mga05p37_1360481_c1_239_604 | 120 |
| 503 | 3300050507 | nmdc:mga05p37_1651984_c1 | nmdc:mga05p37_1651984_c1_227_595 | 120 |
| 504 | 3300050507 | nmdc:mga05p37_2141600_c1 | nmdc:mga05p37_2141600_c1_92_463 | 120 |
| 505 | 3300050507 | nmdc:mga05p37_63_c1 | nmdc:mga05p37_63_c1_68462_68827 | 120 |
| 506 | 3300050507 | nmdc:mga05p37_983004_c1 | nmdc:mga05p37_983004_c1_23_385 | 120 |
| 507 | 3300050509 | nmdc:mga0qj67_112305_c1 | nmdc:mga0qj67_112305_c1_973_1347 | 120 |
| 508 | 3300050510 | nmdc:mga06r32_62953_c1 | nmdc:mga06r32_62953_c1_995_1369 | 120 |
| 509 | 3300050510 | nmdc:mga06r32_687853_c1 | nmdc:mga06r32_687853_c1_487_858 | 120 |
| 510 | 3300050512 | nmdc:mga0n895_19806_c1 | nmdc:mga0n895_19806_c1_834_1196 | 120 |
| 511 | 3300050512 | nmdc:mga0n895_432885_c1 | nmdc:mga0n895_432885_c1_909_1283 | 120 |
| 512 | 3300050512 | nmdc:mga0n895_90213_c1 | nmdc:mga0n895_90213_c1_1324_1686 | 120 |
| 513 | 3300050513 | nmdc:mga0rr50_1135260_c1 | nmdc:mga0rr50_1135260_c1_235_603 | 120 |
| 514 | 3300050513 | nmdc:mga0rr50_265172_c1 | nmdc:mga0rr50_265172_c1_697_1071 | 120 |
| 515 | 3300050513 | nmdc:mga0rr50_74521_c1 | nmdc:mga0rr50_74521_c1_2205_2567 | 120 |
| 516 | 3300050514 | nmdc:mga08x19_669498_c1 | nmdc:mga08x19_669498_c1_343_705 | 120 |
| 517 | 3300050515 | nmdc:mga0a205_1388114_c1 | nmdc:mga0a205_1388114_c1_34_399 | 120 |
| 518 | 3300053077 | Ga0495601_0177842 | Ga0495601_0177842_897_1262 | 120 |
| 519 | 3300053078 | Ga0495612_0024164 | Ga0495612_0024164_723_1088 | 120 |
| 520 | 3300053084 | Ga0495595_0231291 | Ga0495595_0231291_177_551 | 120 |
| 521 | 3300053085 | Ga0495619_0106607 | Ga0495619_0106607_869_1234 | 120 |
| 522 | 3300053085 | Ga0495619_0110832 | Ga0495619_0110832_1213_1587 | 120 |
| 523 | 3300053085 | Ga0495619_0748908 | Ga0495619_0748908_96_461 | 120 |
| 524 | 3300053094 | Ga0500566_0460549 | Ga0500566_0460549_28_393 | 120 |
| 525 | 3300053103 | Ga0500555_160123 | Ga0500555_160123_113_478 | 120 |
| 526 | 3300053108 | Ga0500562_003085 | Ga0500562_003085_2608_2973 | 120 |
| 527 | 3300053133 | Ga0500655_012776 | Ga0500655_012776_685_1050 | 120 |
| 528 | 3300053158 | Ga0500627_0283775 | Ga0500627_0283775_148_513 | 120 |
| 529 | 3300053161 | Ga0500634_0276622 | Ga0500634_0276622_145_510 | 120 |
| 530 | 3300061734 | Ga0530510_0309470 | Ga0530510_0309470_347_712 | 120 |
| 531 | 3300061734 | Ga0530510_0309928 | Ga0530510_0309928_239_604 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oyy-assembly2.cif.gz_B | structure of pseudomonas aeruginosa elongation factor p | 0.8925 | 81 | 114 |
| 7n4d-assembly2.cif.gz_B | translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863 | 0.8723 | 81 | 114 |
| 6bt2-assembly2.cif.gz_B | structure of the human nocturnin catalytic domain with bound sulfate anion | 0.8715 | 79 | 115 |
| 3oyy-assembly1.cif.gz_A | structure of pseudomonas aeruginosa elongation factor p | 0.8512 | 81 | 114 |
| 1yby-assembly1.cif.gz_B | conserved hypothetical protein cth-95 from clostridium thermocellum | 0.8505 | 81 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06864_732_1002_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9063 | 81 | 103 | 2.70.98.10 |
| af_Q557H6_34_95_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9052 | 81 | 114 | 2.30.30.30 |
| af_I1JVU1_64_124_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.903 | 81 | 114 | 2.30.30.30 |
| 3oyyB01 | Mainly Beta;Roll;SH3 type barrels.; | 0.8925 | 81 | 114 | 2.30.30.30 |
| af_A0A1D6L8D5_102_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8892 | 81 | 115 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8YPY5-F1-model_v4 | Lysozyme family protein | 0.9856 | 18 | 116 |
|
| AF-A0A7V4G7W4-F1-model_v4 | IraD/Gp25-like domain-containing protein | 0.9653 | 23 | 119 |
|
| AF-A0A0E3Z1I2-F1-model_v4 | IraD/Gp25-like domain-containing protein | 0.9642 | 21 | 115 |
|
| AF-A0A3A8KT25-F1-model_v4 | IraD/Gp25-like domain-containing protein | 0.9553 | 23 | 120 |
|
| AF-A0A0C2D3V1-F1-model_v4 | Uncharacterized protein | 0.9545 | 69 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar