F460176

General Info

Members Datasets Scaffolds Average Seq Length
531 299 531 123

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0276740|Ga0495667_0276740_198_692
Length 150
Sequence MGRGCHARPSRRTTGVDANQRGGLRADRYAVEDFPYHFDARGRTAEVDYDGHIRDLIEQVLFTSPGERVNRPDFGSGLLRLVFAPNSSELAATTQYLVQGSLQQYLGDLIQVDAVDVTSEDSTLRVSVRYLVRQTQTLQTAEFTKGVPTA

Samples

Sample ID Description Type Environment
1 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
197 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
263 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
264 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
265 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
266 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
267 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
268 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
269 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
270 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
271 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
272 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
273 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
277 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 5.46
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J14986_100666 3300001432 Bacteria 2020
2 JGI24746J21847_1034850 3300001977 Unclassified 695
3 JGI24748J21848_1000002 3300002074 Bacteria 426946
4 JGI24034J26672_10000004 3300002239 Bacteria 426946
5 JGI25406J46586_10037876 3300003203 Bacteria 1734
6 rootH2_10256832 3300003320 Unclassified 1932
7 rootL2_10257985 3300003322 Unclassified 2208
8 Ga0065712_10003716 3300005290 Bacteria 4962
9 Ga0065715_10013740 3300005293 Unclassified 3339
10 Ga0065715_11125805 3300005293 Bacteria 514
11 Ga0070676_10001365 3300005328 Bacteria 12295
12 Ga0070676_11037161 3300005328 Bacteria 617
13 Ga0070683_100316280 3300005329 Bacteria 1485
14 Ga0070690_100001967 3300005330 Bacteria 10937
15 Ga0070690_100823741 3300005330 Bacteria 721
16 Ga0070670_100006479 3300005331 Bacteria 9906
17 Ga0070670_100316144 3300005331 Bacteria 1367
18 Ga0070677_10007163 3300005333 Bacteria 3719
19 Ga0068869_100279860 3300005334 Bacteria 1341
20 Ga0070680_100033253 3300005336 Bacteria 4155
21 Ga0068868_100183959 3300005338 Bacteria 1735
22 Ga0068868_100992340 3300005338 Unclassified 768
23 Ga0068868_101530638 3300005338 Bacteria 625
24 Ga0068868_102260975 3300005338 Unclassified 518
25 Ga0070660_100124956 3300005339 Bacteria 2055
26 Ga0070689_100016478 3300005340 Bacteria 5408
27 Ga0070689_100852580 3300005340 Unclassified 804
28 Ga0070689_101922173 3300005340 Bacteria 540
29 Ga0070689_102200758 3300005340 Unclassified 505
30 Ga0070691_10030696 3300005341 Bacteria 2518
31 Ga0070687_100001554 3300005343 Bacteria 8146
32 Ga0070687_100128892 3300005343 Bacteria 1458
33 Ga0070687_100251155 3300005343 Bacteria 1099
34 Ga0070687_100567447 3300005343 Bacteria 775
35 Ga0070692_10127752 3300005345 Bacteria 1425
36 Ga0070668_100085699 3300005347 Unclassified 2476
37 Ga0070669_100013242 3300005353 Bacteria 5862
38 Ga0070669_100020637 3300005353 Bacteria 4705
39 Ga0070669_100035699 3300005353 Bacteria 3602
40 Ga0070669_100114782 3300005353 Unclassified 2048
41 Ga0070675_100001838 3300005354 Bacteria 15687
42 Ga0070675_100004173 3300005354 Bacteria 10972
43 Ga0070675_100026234 3300005354 Bacteria 4675
44 Ga0070675_100100022 3300005354 Bacteria 2442
45 Ga0070671_100015497 3300005355 Bacteria 6159
46 Ga0070671_100082296 3300005355 Bacteria 2691
47 Ga0070674_100020446 3300005356 Bacteria 4230
48 Ga0070674_100214152 3300005356 Bacteria 1495
49 Ga0070673_100073674 3300005364 Bacteria 2749
50 Ga0070673_100677866 3300005364 Unclassified 945
51 Ga0070673_101002897 3300005364 Bacteria 777
52 Ga0070688_100008040 3300005365 Bacteria 5709
53 Ga0070688_100086866 3300005365 Bacteria 2036
54 Ga0070688_100179262 3300005365 Bacteria 1468
55 Ga0070659_100063339 3300005366 Bacteria 2925
56 Ga0070667_100011622 3300005367 Bacteria 7279
57 Ga0070667_100017551 3300005367 Bacteria 5932
58 Ga0070667_100117872 3300005367 Bacteria 2307
59 Ga0070703_10000028 3300005406 Bacteria 70844
60 Ga0070703_10142371 3300005406 Unclassified 892
61 Ga0070714_100034209 3300005435 Unclassified 4254
62 Ga0070713_100009503 3300005436 Bacteria 6966
63 Ga0070713_100016390 3300005436 Bacteria 5571
64 Ga0070710_10028354 3300005437 Bacteria 2994
65 Ga0070701_10575934 3300005438 Bacteria 742
66 Ga0070711_100059933 3300005439 Unclassified 2644
67 Ga0070711_100805808 3300005439 Bacteria 797
68 Ga0070705_100767600 3300005440 Unclassified 764
69 Ga0070700_100006039 3300005441 Bacteria 6448
70 Ga0070700_100150489 3300005441 Bacteria 1591
71 Ga0070694_100073264 3300005444 Bacteria 2365
72 Ga0070694_100101608 3300005444 Bacteria 2035
73 Ga0070694_100623497 3300005444 Bacteria 870
74 Ga0070708_100084280 3300005445 Bacteria 2883
75 Ga0070663_100059127 3300005455 Bacteria 2755
76 Ga0070663_100487212 3300005455 Bacteria 1022
77 Ga0070678_100195213 3300005456 Bacteria 1667
78 Ga0070678_100256899 3300005456 Bacteria 1467
79 Ga0070662_100395686 3300005457 Bacteria 1139
80 Ga0070681_10021075 3300005458 Bacteria 6530
81 Ga0070681_10325744 3300005458 Bacteria 1446
82 Ga0070685_10020774 3300005466 Bacteria 3558
83 Ga0070706_100010342 3300005467 Bacteria 8668
84 Ga0070706_100386337 3300005467 Bacteria 1303
85 Ga0070706_100527300 3300005467 Bacteria 1099
86 Ga0070706_100707609 3300005467 Unclassified 934
87 Ga0070707_100000677 3300005468 Bacteria 33786
88 Ga0070698_100247589 3300005471 Bacteria 1715
89 Ga0070698_100252628 3300005471 Unclassified 1695
90 Ga0070698_101344631 3300005471 Bacteria 665
91 Ga0070699_100005249 3300005518 Bacteria 11376
92 Ga0070699_100084071 3300005518 Viruses 2777
93 Ga0070699_100096482 3300005518 Viruses 2589
94 Ga0070699_100901264 3300005518 Bacteria 810
95 Ga0070679_100034533 3300005530 Bacteria 5013
96 Ga0070679_100517025 3300005530 Bacteria 1138
97 Ga0070684_100320759 3300005535 Bacteria 1423
98 Ga0070697_100000542 3300005536 Bacteria 28399
99 Ga0070697_100209542 3300005536 Bacteria 1659
100 Ga0068853_100778756 3300005539 Bacteria 915
101 Ga0070672_100041276 3300005543 Bacteria 3546
102 Ga0070672_100070292 3300005543 Bacteria 2781
103 Ga0070686_100103885 3300005544 Bacteria 1924
104 Ga0070695_100036695 3300005545 Bacteria 3085
105 Ga0070695_100128826 3300005545 Bacteria 1742
106 Ga0070695_100335822 3300005545 Unclassified 1128
107 Ga0070695_100494532 3300005545 Unclassified 945
108 Ga0070695_101509184 3300005545 Unclassified 559
109 Ga0070696_100038160 3300005546 Bacteria 3314
110 Ga0070696_100713004 3300005546 Viruses 819
111 Ga0070696_101046366 3300005546 Bacteria 684
112 Ga0070696_101099534 3300005546 Unclassified 668
113 Ga0070693_100012949 3300005547 Bacteria 4236
114 Ga0070693_101072797 3300005547 Unclassified 613
115 Ga0070665_100276841 3300005548 Unclassified 1680
116 Ga0070704_100194128 3300005549 Bacteria 1634
117 Ga0070704_100243365 3300005549 Unclassified 1473
118 Ga0070704_100434567 3300005549 Bacteria 1127
119 Ga0068855_100096198 3300005563 Bacteria 3412
120 Ga0068855_100585072 3300005563 Bacteria 1205
121 Ga0070664_100013944 3300005564 Bacteria 6553
122 Ga0070664_100021201 3300005564 Bacteria 5353
123 Ga0070664_100034015 3300005564 Bacteria 4274
124 Ga0068857_100057187 3300005577 Bacteria 3462
125 Ga0068854_100010313 3300005578 Bacteria 6056
126 Ga0068854_100124664 3300005578 Bacteria 1960
127 Ga0068854_100654585 3300005578 Unclassified 902
128 Ga0068856_100078468 3300005614 Bacteria 3274
129 Ga0070702_100413557 3300005615 Unclassified 968
130 Ga0068859_100003211 3300005617 Bacteria 16645
131 Ga0068859_100013203 3300005617 Bacteria 8291
132 Ga0068859_100040385 3300005617 Bacteria 4683
133 Ga0068859_100391782 3300005617 Bacteria 1485
134 Ga0068859_100701645 3300005617 Bacteria 1103
135 Ga0068866_10056606 3300005718 Bacteria 2017
136 Ga0068861_101487504 3300005719 Bacteria 664
137 Ga0068863_100065955 3300005841 Bacteria 3425
138 Ga0068863_100408514 3300005841 Bacteria 1329
139 Ga0068863_101029225 3300005841 Bacteria 827
140 Ga0068858_101162995 3300005842 Bacteria 758
141 Ga0068860_100065339 3300005843 Bacteria 3455
142 Ga0068860_100613528 3300005843 Bacteria 1094
143 Ga0068860_101897346 3300005843 Bacteria 617
144 Ga0068862_100008674 3300005844 Bacteria 8408
145 Ga0068862_100220408 3300005844 Bacteria 1717
146 Ga0081455_10000418 3300005937 Bacteria 55929
147 Ga0081455_10331710 3300005937 Bacteria 1080
148 Ga0081539_10000346 3300005985 Bacteria 101962
149 Ga0081539_10003337 3300005985 Bacteria 19955
150 Ga0070717_10011421 3300006028 Bacteria 6744
151 Ga0070717_10192232 3300006028 Bacteria 1783
152 Ga0070716_100018531 3300006173 Bacteria 3629
153 Ga0070716_100235579 3300006173 Unclassified 1238
154 Ga0070716_101463951 3300006173 Unclassified 557
155 Ga0070712_100006993 3300006175 Bacteria 7033
156 Ga0070712_100083329 3300006175 Bacteria 2322
157 Ga0070712_100085384 3300006175 Bacteria 2298
158 Ga0075370_10004194 3300006353 Bacteria 6958
159 Ga0068871_100884720 3300006358 Bacteria 827
160 Ga0075430_100025943 3300006846 Viruses 4987
161 Ga0075431_100004811 3300006847 Bacteria 13295
162 Ga0075431_100105862 3300006847 Unclassified 2902
163 Ga0075434_100022420 3300006871 Bacteria 6151
164 Ga0075434_100259198 3300006871 Unclassified 1758
165 Ga0075429_101103038 3300006880 Bacteria 693
166 Ga0068865_100284671 3300006881 Bacteria 1317
167 Ga0068865_100455234 3300006881 Bacteria 1059
168 Ga0075436_100034783 3300006914 Bacteria 3475
169 Ga0075436_100377736 3300006914 Unclassified 1024
170 Ga0075436_101107564 3300006914 Bacteria 596
171 Ga0097620_100003211 3300006931 Bacteria 16645
172 Ga0097620_100013203 3300006931 Bacteria 8291
173 Ga0097620_100040388 3300006931 Bacteria 4683
174 Ga0097620_100391765 3300006931 Bacteria 1485
175 Ga0097620_100701673 3300006931 Bacteria 1103
176 Ga0075435_100043004 3300007076 Bacteria 3616
177 Ga0075435_100310939 3300007076 Unclassified 1348
178 Ga0075435_100318447 3300007076 Bacteria 1331
179 Ga0075435_100394520 3300007076 Bacteria 1190
180 Ga0105240_10163923 3300009093 Bacteria 2638
181 Ga0111539_10060572 3300009094 Bacteria 4485
182 Ga0105245_10502328 3300009098 Unclassified 1229
183 Ga0105245_10895590 3300009098 Unclassified 929
184 Ga0105247_10064908 3300009101 Unclassified 2270
185 Ga0105247_10435517 3300009101 Bacteria 942
186 Ga0114129_10000925 3300009147 Bacteria 38300
187 Ga0114129_10560851 3300009147 Bacteria 1484
188 Ga0114129_10828683 3300009147 Unclassified 1178
189 Ga0114129_10837032 3300009147 Bacteria 1171
190 Ga0114129_11471129 3300009147 Bacteria 838
191 Ga0114129_13302790 3300009147 Unclassified 522
192 Ga0105243_10000996 3300009148 Bacteria 26244
193 Ga0105243_10047982 3300009148 Bacteria 3365
194 Ga0105241_10141772 3300009174 Bacteria 1958
195 Ga0105242_10322426 3300009176 Bacteria 1417
196 Ga0105242_10435053 3300009176 Unclassified 1233
197 Ga0105242_10766905 3300009176 Bacteria 951
198 Ga0105242_11449483 3300009176 Unclassified 716
199 Ga0105248_10003342 3300009177 Bacteria 17833
200 Ga0105248_11121967 3300009177 Unclassified 889
201 Ga0105238_10000453 3300009551 Bacteria 43016
202 Ga0105238_10015271 3300009551 Bacteria 7777
203 Ga0105238_10883052 3300009551 Bacteria 912
204 Ga0105249_10100889 3300009553 Bacteria 2714
205 Ga0105249_10214317 3300009553 Bacteria 1892
206 Ga0105249_10257651 3300009553 Bacteria 1732
207 Ga0105239_10005799 3300010375 Bacteria 14408
208 Ga0105239_12130245 3300010375 Unclassified 652
209 Ga0105246_10020900 3300011119 Bacteria 4204
210 Ga0105246_10104300 3300011119 Unclassified 2070
211 Ga0105246_11937632 3300011119 Bacteria 567
212 Ga0157371_10095319 3300013102 Bacteria 2109
213 Ga0157369_10914132 3300013105 Unclassified 900
214 Ga0157374_10015332 3300013296 Bacteria 6722
215 Ga0157374_10809308 3300013296 Unclassified 953
216 Ga0157378_10000015 3300013297 Bacteria 143601
217 Ga0157378_10066555 3300013297 Unclassified 3227
218 Ga0157378_10192643 3300013297 Unclassified 1924
219 Ga0157378_11283965 3300013297 Bacteria 773
220 Ga0157378_11303248 3300013297 Bacteria 767
221 Ga0157378_11757263 3300013297 Unclassified 668
222 Ga0157378_12375159 3300013297 Unclassified 582
223 Ga0163162_10050774 3300013306 Bacteria 4159
224 Ga0163162_11953080 3300013306 Unclassified 672
225 Ga0157372_10032933 3300013307 Bacteria 5688
226 Ga0157372_10053296 3300013307 Bacteria 4508
227 Ga0157372_11858954 3300013307 Bacteria 692
228 Ga0157375_10191789 3300013308 Bacteria 2198
229 Ga0157375_10377520 3300013308 Bacteria 1584
230 Ga0157375_11014638 3300013308 Bacteria 969
231 Ga0157375_12487289 3300013308 Bacteria 618
232 Ga0157375_12580182 3300013308 Unclassified 607
233 Ga0163163_10096287 3300014325 Unclassified 2980
234 Ga0163163_10115414 3300014325 Bacteria 2717
235 Ga0163163_10331350 3300014325 Bacteria 1577
236 Ga0163163_11423705 3300014325 Bacteria 755
237 Ga0163163_12610992 3300014325 Bacteria 563
238 Ga0163163_13070614 3300014325 Bacteria 521
239 Ga0157380_11754419 3300014326 Bacteria 679
240 Ga0182008_10118981 3300014497 Bacteria 1312
241 Ga0157377_10116578 3300014745 Bacteria 1613
242 Ga0157377_10629509 3300014745 Bacteria 769
243 Ga0157377_10928767 3300014745 Bacteria 653
244 Ga0157376_10008932 3300014969 Bacteria 7256
245 Ga0157376_10116132 3300014969 Bacteria 2364
246 Ga0157376_11229459 3300014969 Unclassified 778
247 Ga0207666_1030537 3300025271 Unclassified 824
248 Ga0207697_10001859 3300025315 Bacteria 11285
249 Ga0207697_10001865 3300025315 Bacteria 11253
250 Ga0207653_10000047 3300025885 Bacteria 91340
251 Ga0207682_10056831 3300025893 Bacteria 1630
252 Ga0207692_10075734 3300025898 Unclassified 1786
253 Ga0207692_10633053 3300025898 Bacteria 690
254 Ga0207642_10045965 3300025899 Bacteria 1942
255 Ga0207710_10000004 3300025900 Bacteria 846540
256 Ga0207710_10127913 3300025900 Unclassified 1218
257 Ga0207688_10034491 3300025901 Bacteria 2803
258 Ga0207688_10569816 3300025901 Unclassified 712
259 Ga0207680_10167098 3300025903 Bacteria 1479
260 Ga0207645_10003342 3300025907 Bacteria 12230
261 Ga0207645_10004181 3300025907 Bacteria 10718
262 Ga0207645_10061525 3300025907 Bacteria 2398
263 Ga0207643_10001177 3300025908 Bacteria 15527
264 Ga0207684_10011572 3300025910 Bacteria 7711
265 Ga0207684_10329809 3300025910 Bacteria 1315
266 Ga0207684_10555190 3300025910 Bacteria 982
267 Ga0207684_10774054 3300025910 Bacteria 812
268 Ga0207684_11411507 3300025910 Unclassified 570
269 Ga0207707_10555850 3300025912 Unclassified 975
270 Ga0207707_10863292 3300025912 Bacteria 750
271 Ga0207695_10401455 3300025913 Unclassified 1255
272 Ga0207695_10413148 3300025913 Unclassified 1234
273 Ga0207693_10010700 3300025915 Bacteria 7447
274 Ga0207693_10222704 3300025915 Bacteria 1482
275 Ga0207663_10041856 3300025916 Unclassified 2795
276 Ga0207663_10436040 3300025916 Bacteria 1008
277 Ga0207662_10019692 3300025918 Unclassified 3844
278 Ga0207662_10048376 3300025918 Bacteria 2519
279 Ga0207662_10817734 3300025918 Unclassified 657
280 Ga0207657_10006391 3300025919 Bacteria 12237
281 Ga0207649_10086454 3300025920 Bacteria 2043
282 Ga0207652_10284592 3300025921 Bacteria 1491
283 Ga0207646_10000550 3300025922 Bacteria 49383
284 Ga0207681_10025343 3300025923 Unclassified 3814
285 Ga0207681_10030921 3300025923 Bacteria 3494
286 Ga0207681_10076001 3300025923 Bacteria 2357
287 Ga0207681_10211174 3300025923 Bacteria 1496
288 Ga0207694_10003055 3300025924 Bacteria 13419
289 Ga0207694_10170679 3300025924 Bacteria 1761
290 Ga0207650_10038064 3300025925 Bacteria 3509
291 Ga0207650_10237763 3300025925 Unclassified 1471
292 Ga0207659_10059210 3300025926 Unclassified 2752
293 Ga0207659_10092391 3300025926 Bacteria 2262
294 Ga0207659_10283266 3300025926 Bacteria 1356
295 Ga0207659_10518755 3300025926 Unclassified 1010
296 Ga0207687_10176672 3300025927 Bacteria 1651
297 Ga0207664_10197518 3300025929 Unclassified 1735
298 Ga0207644_10002425 3300025931 Bacteria 12009
299 Ga0207644_10148250 3300025931 Bacteria 1813
300 Ga0207644_10473992 3300025931 Bacteria 1030
301 Ga0207690_10201492 3300025932 Unclassified 1512
302 Ga0207706_10000999 3300025933 Bacteria 28802
303 Ga0207706_10028863 3300025933 Bacteria 4952
304 Ga0207706_10068096 3300025933 Bacteria 3133
305 Ga0207706_10501378 3300025933 Bacteria 1048
306 Ga0207686_10279619 3300025934 Unclassified 1231
307 Ga0207686_10630113 3300025934 Unclassified 847
308 Ga0207709_10001187 3300025935 Bacteria 18824
309 Ga0207709_10596040 3300025935 Bacteria 874
310 Ga0207669_10299931 3300025937 Bacteria 1221
311 Ga0207704_10624163 3300025938 Bacteria 885
312 Ga0207665_10002211 3300025939 Bacteria 13127
313 Ga0207691_10008673 3300025940 Bacteria 9755
314 Ga0207691_10026915 3300025940 Bacteria 5395
315 Ga0207711_10006529 3300025941 Bacteria 9818
316 Ga0207711_10467061 3300025941 Bacteria 1175
317 Ga0207689_10001417 3300025942 Bacteria 22904
318 Ga0207679_10024837 3300025945 Bacteria 4113
319 Ga0207679_10787887 3300025945 Unclassified 866
320 Ga0207667_10502672 3300025949 Bacteria 1229
321 Ga0207712_10195838 3300025961 Bacteria 1598
322 Ga0207668_10014858 3300025972 Bacteria 4826
323 Ga0207658_10047257 3300025986 Unclassified 3149
324 Ga0207658_10290299 3300025986 Bacteria 1405
325 Ga0207658_10347951 3300025986 Bacteria 1290
326 Ga0207658_10436553 3300025986 Bacteria 1157
327 Ga0207677_10250654 3300026023 Bacteria 1438
328 Ga0207677_10465063 3300026023 Unclassified 1087
329 Ga0207703_10165442 3300026035 Bacteria 1940
330 Ga0207639_10674148 3300026041 Bacteria 958
331 Ga0207678_10093271 3300026067 Bacteria 2573
332 Ga0207708_10025555 3300026075 Bacteria 4469
333 Ga0207708_10064775 3300026075 Bacteria 2793
334 Ga0207708_10216782 3300026075 Bacteria 1532
335 Ga0207641_10329707 3300026088 Bacteria 1449
336 Ga0207641_10503382 3300026088 Bacteria 1177
337 Ga0207648_10393763 3300026089 Bacteria 1254
338 Ga0207674_10044024 3300026116 Bacteria 4600
339 Ga0207675_100014281 3300026118 Bacteria 7402
340 Ga0207683_10001033 3300026121 Bacteria 25396
341 Ga0207683_10300578 3300026121 Bacteria 1468
342 Ga0207698_10527881 3300026142 Bacteria 1153
343 Ga0268266_10359571 3300028379 Unclassified 1370
344 Ga0268265_10060463 3300028380 Bacteria 2903
345 Ga0268265_10284054 3300028380 Unclassified 1482
346 Ga0268264_11047838 3300028381 Bacteria 823
347 Ga0268264_11163453 3300028381 Bacteria 780
348 Ga0307515_10000008 3300028794 Bacteria 663660
349 Ga0265338_10525447 3300028800 Unclassified 831
350 Ga0265765_1013133 3300030879 Unclassified 945
351 Ga0307513_10200799 3300031456 Bacteria 1835
352 Ga0307408_100924697 3300031548 Unclassified 800
353 Ga0316579_10318330 3300031691 Unclassified 752
354 Ga0307405_10023447 3300031731 Bacteria 3507
355 Ga0307405_10311624 3300031731 Bacteria 1198
356 Ga0307410_10009883 3300031852 Bacteria 5377
357 Ga0307410_10811011 3300031852 Unclassified 797
358 Ga0307410_11763947 3300031852 Bacteria 549
359 Ga0307406_10022338 3300031901 Bacteria 3752
360 Ga0307412_10058787 3300031911 Bacteria 2573
361 Ga0307416_100016556 3300032002 Bacteria 5129
362 Ga0307414_10006929 3300032004 Bacteria 6349
363 Ga0307414_10690872 3300032004 Unclassified 923
364 Ga0307411_10359936 3300032005 Bacteria 1189
365 Ga0307411_10601877 3300032005 Unclassified 945
366 Ga0307411_12358362 3300032005 Unclassified 500
367 Ga0307415_100005575 3300032126 Bacteria 6699
368 Ga0373945_0304019 3300035116 Bacteria 684
369 Ga0373953_0053370 3300035117 Bacteria 1638
370 Ga0373954_0137601 3300035118 Bacteria 1191
371 Ga0373956_0430237 3300035119 Unclassified 630
372 Ga0373943_0072420 3300035170 Bacteria 1748
373 Ga0373924_0009892 3300035410 Bacteria 3507
374 Ga0373935_0522089 3300035692 Bacteria 864
375 Ga0373933_0011694 3300035724 Bacteria 4843
376 Ga0373947_0252479 3300035725 Bacteria 1167
377 Ga0373937_0002398 3300036401 Bacteria 15589
378 Ga0373937_0222746 3300036401 Bacteria 1776
379 Ga0373937_1018668 3300036401 Unclassified 777
380 Ga0400490_38445 3300038726 Bacteria 13294
381 Ga0400491_27425 3300038727 Bacteria 1319
382 Ga0436360_0507637 3300039438 Bacteria 689
383 Ga0436360_1307698 3300039438 Bacteria 767
384 Ga0436362_1097775 3300039453 Bacteria 972
385 Ga0451853_1505179 3300041512 Bacteria 531
386 Ga0439458_0188334 3300042157 Unclassified 562
387 Ga0439458_0206638 3300042157 Unclassified 538
388 Ga0439435_0054705 3300042436 Bacteria 1150
389 Ga0439459_0160735 3300042438 Bacteria 593
390 Ga0451576_0751411 3300045051 Unclassified 1024
391 Ga0495592_0137169 3300046454 Unclassified 1705
392 Ga0495629_0280222 3300046459 Bacteria 1144
393 Ga0495638_0638222 3300046460 Bacteria 519
394 Ga0495653_0689580 3300046463 Bacteria 621
395 Ga0495580_0147639 3300046472 Bacteria 1629
396 Ga0495664_0226376 3300046477 Unclassified 1132
397 Ga0495608_0279860 3300046511 Unclassified 1036
398 Ga0495608_0395505 3300046511 Bacteria 846
399 Ga0495628_0009589 3300046516 Bacteria 8265
400 Ga0495630_0342556 3300046517 Bacteria 1144
401 Ga0495630_0859365 3300046517 Bacteria 692
402 Ga0495630_1128335 3300046517 Viruses 594
403 Ga0495632_0147356 3300046519 Bacteria 1089
404 Ga0495637_0009569 3300046520 Bacteria 4724
405 Ga0495663_0051848 3300046525 Bacteria 1272
406 Ga0495663_0150724 3300046525 Bacteria 793
407 Ga0495652_0140516 3300046529 Bacteria 1899
408 Ga0495652_0198552 3300046529 Bacteria 1524
409 Ga0495587_0004194 3300046536 Bacteria 9544
410 Ga0495587_0223241 3300046536 Unclassified 1062
411 Ga0495645_0000820 3300046543 Bacteria 21250
412 Ga0495645_0002759 3300046543 Bacteria 11939
413 Ga0495667_0002410 3300046559 Bacteria 12483
414 Ga0495667_0276740 3300046559 Unclassified 1066
415 Ga0495625_0076225 3300046660 Bacteria 2345
416 Ga0495635_0945050 3300046663 Unclassified 550
417 Ga0495657_0108884 3300046675 Bacteria 1758
418 Ga0495599_0012245 3300046678 Bacteria 5282
419 Ga0495599_0021219 3300046678 Bacteria 4051
420 Ga0495623_0001030 3300046679 Bacteria 18825
421 Ga0495623_0113428 3300046679 Bacteria 1640
422 Ga0495646_0601879 3300046680 Viruses 558
423 Ga0495669_0049698 3300046684 Bacteria 1879
424 Ga0495669_0307797 3300046684 Bacteria 764
425 Ga0495600_0145983 3300046809 Unclassified 1533
426 Ga0495604_0375459 3300047317 Unclassified 940
427 Ga0495636_0152378 3300047318 Bacteria 1038
428 Ga0495674_0162166 3300047319 Bacteria 1870
429 Ga0495680_0108504 3300047322 Unclassified 2060
430 Ga0495675_0001362 3300047444 Bacteria 14798
431 Ga0495675_0033676 3300047444 Bacteria 3270
432 Ga0495677_0036485 3300047445 Bacteria 1796
433 Ga0495673_0291426 3300047469 Bacteria 587
434 Ga0495684_0011322 3300047471 Bacteria 6887
435 Ga0495684_0776527 3300047471 Unclassified 628
436 Ga0495602_0066884 3300048088 Bacteria 3094
437 Ga0495602_0961981 3300048088 Viruses 565
438 Ga0495615_0073356 3300048090 Bacteria 926
439 Ga0495626_0011025 3300048091 Bacteria 4795
440 Ga0496100_0476942 3300048903 Bacteria 959
441 Ga0496100_0652442 3300048903 Unclassified 819
442 Ga0496101_0070442 3300048904 Unclassified 2561
443 Ga0496101_0476625 3300048904 Unclassified 985
444 Ga0496102_0027171 3300048905 Bacteria 5111
445 Ga0496102_0030887 3300048905 Bacteria 4799
446 Ga0496102_0747299 3300048905 Unclassified 901
447 Ga0496103_0074171 3300048906 Bacteria 2132
448 Ga0496103_0112306 3300048906 Bacteria 1732
449 Ga0496105_0336006 3300048908 Bacteria 1209
450 Ga0496105_0515090 3300048908 Bacteria 937
451 Ga0496106_0124012 3300048909 Bacteria 2021
452 Ga0496106_0391023 3300048909 Bacteria 1117
453 Ga0496107_0207714 3300048910 Bacteria 1456
454 Ga0496109_0006588 3300048912 Bacteria 9779
455 Ga0496109_0433862 3300048912 Bacteria 1241
456 Ga0496110_0011619 3300048913 Bacteria 7219
457 Ga0496110_0827444 3300048913 Bacteria 831
458 Ga0496111_0076220 3300048914 Unclassified 2444
459 Ga0496112_0128667 3300048915 Unclassified 2503
460 Ga0496112_0329301 3300048915 Unclassified 1471
461 Ga0496112_0488824 3300048915 Unclassified 1167
462 Ga0496113_0105891 3300048916 Bacteria 2184
463 Ga0496113_0111964 3300048916 Bacteria 2126
464 Ga0496114_0461409 3300048917 Bacteria 1124
465 Ga0496114_0579917 3300048917 Bacteria 990
466 Ga0496114_1060480 3300048917 Unclassified 695
467 Ga0496114_1536164 3300048917 Bacteria 554
468 Ga0496115_0012130 3300048918 Bacteria 6481
469 Ga0496119_0069680 3300048922 Bacteria 2066
470 Ga0496121_0016937 3300048924 Bacteria 7487
471 Ga0496121_0096602 3300048924 Bacteria 2292
472 Ga0496125_0024057 3300048928 Bacteria 5610
473 Ga0496126_0065674 3300048929 Bacteria 3246
474 Ga0496126_0977527 3300048929 Bacteria 637
475 Ga0501292_136908 3300049515 Unclassified 510
476 Ga0501076_0734613 3300049592 Bacteria 815
477 Ga0501201_016083 3300049651 Bacteria 764
478 Ga0501202_000507 3300049652 Bacteria 5592
479 Ga0501216_013641 3300049660 Bacteria 1350
480 Ga0501217_002038 3300049661 Bacteria 3908
481 Ga0501223_014092 3300049663 Bacteria 1587
482 Ga0501230_011931 3300049667 Bacteria 1383
483 Ga0501233_005464 3300049668 Bacteria 2359
484 Ga0501239_052103 3300049672 Bacteria 595
485 Ga0501246_026658 3300049676 Bacteria 629
486 Ga0501259_123981 3300049688 Bacteria 617
487 Ga0501221_077878 3300049704 Bacteria 793
488 Ga0501225_0004615 3300049705 Bacteria 4098
489 Ga0501229_008713 3300049706 Bacteria 1270
490 Ga0501245_069052 3300049708 Bacteria 662
491 Ga0501079_0588647 3300049741 Bacteria 875
492 Ga0501080_1796014 3300049742 Bacteria 515
493 Ga0501273_005459 3300049770 Bacteria 1436
494 Ga0501280_082445 3300049776 Bacteria 593
495 Ga0501045_0595925 3300049824 Bacteria 818
496 Ga0501204_011255 3300049850 Bacteria 1060
497 nmdc:mga07m45_5826_c1 3300050496 Bacteria 1663
498 nmdc:mga05p37_1194447_c1 3300050507 Bacteria 786
499 nmdc:mga05p37_1360481_c1 3300050507 Unclassified 718
500 nmdc:mga05p37_1651984_c1 3300050507 Bacteria 628
501 nmdc:mga05p37_2141600_c1 3300050507 Unclassified 522
502 nmdc:mga05p37_63_c1 3300050507 Bacteria 93704
503 nmdc:mga05p37_983004_c1 3300050507 Bacteria 899
504 nmdc:mga0qj67_112305_c1 3300050509 Unclassified 2200
505 nmdc:mga06r32_62953_c1 3300050510 Bacteria 3574
506 nmdc:mga06r32_687853_c1 3300050510 Unclassified 989
507 nmdc:mga08y16_308323_c1 3300050511 Bacteria 1630
508 nmdc:mga0n895_19806_c1 3300050512 Bacteria 6260
509 nmdc:mga0n895_432885_c1 3300050512 Bacteria 1329
510 nmdc:mga0n895_55054_c1 3300050512 Bacteria 3914
511 nmdc:mga0n895_90213_c1 3300050512 Bacteria 3066
512 nmdc:mga0rr50_1135260_c1 3300050513 Bacteria 664
513 nmdc:mga0rr50_265172_c1 3300050513 Unclassified 1430
514 nmdc:mga0rr50_74521_c1 3300050513 Bacteria 2598
515 nmdc:mga08x19_127090_c1 3300050514 Bacteria 1712
516 nmdc:mga08x19_669498_c1 3300050514 Bacteria 736
517 nmdc:mga0a205_1388114_c1 3300050515 Bacteria 550
518 Ga0495601_0177842 3300053077 Unclassified 1391
519 Ga0495612_0024164 3300053078 Bacteria 2440
520 Ga0495595_0231291 3300053084 Bacteria 924
521 Ga0495619_0106607 3300053085 Unclassified 1911
522 Ga0495619_0110832 3300053085 Bacteria 1875
523 Ga0495619_0748908 3300053085 Unclassified 663
524 Ga0500566_0460549 3300053094 Unclassified 555
525 Ga0500555_160123 3300053103 Bacteria 549
526 Ga0500562_003085 3300053108 Bacteria 4162
527 Ga0500655_012776 3300053133 Bacteria 1528
528 Ga0500627_0283775 3300053158 Bacteria 726
529 Ga0500634_0276622 3300053161 Bacteria 680
530 Ga0530510_0309470 3300061734 Bacteria 1183
531 Ga0530510_0309928 3300061734 Bacteria 1182

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0049698 Ga0495669_0049698_657_1151 113
2 3300009176 Ga0105242_10766905 Ga0105242_107669052 118
3 3300030879 Ga0265765_1013133 Ga0265765_10131332 118
4 3300049824 Ga0501045_0595925 Ga0501045_0595925_158_661 118
5 3300005290 Ga0065712_10003716 Ga0065712_100037162 119
6 3300005293 Ga0065715_10013740 Ga0065715_100137404 119
7 3300005330 Ga0070690_100001967 Ga0070690_1000019679 119
8 3300005331 Ga0070670_100006479 Ga0070670_1000064794 119
9 3300005333 Ga0070677_10007163 Ga0070677_100071632 119
10 3300005334 Ga0068869_100279860 Ga0068869_1002798602 119
11 3300005336 Ga0070680_100033253 Ga0070680_1000332532 119
12 3300005339 Ga0070660_100124956 Ga0070660_1001249563 119
13 3300005340 Ga0070689_100852580 Ga0070689_1008525801 119
14 3300005341 Ga0070691_10030696 Ga0070691_100306963 119
15 3300005343 Ga0070687_100128892 Ga0070687_1001288922 119
16 3300005345 Ga0070692_10127752 Ga0070692_101277522 119
17 3300005353 Ga0070669_100035699 Ga0070669_1000356992 119
18 3300005354 Ga0070675_100026234 Ga0070675_1000262344 119
19 3300005355 Ga0070671_100082296 Ga0070671_1000822962 119
20 3300005356 Ga0070674_100020446 Ga0070674_1000204464 119
21 3300005365 Ga0070688_100179262 Ga0070688_1001792623 119
22 3300005366 Ga0070659_100063339 Ga0070659_1000633392 119
23 3300005367 Ga0070667_100011622 Ga0070667_1000116228 119
24 3300005440 Ga0070705_100767600 Ga0070705_1007676002 119
25 3300005444 Ga0070694_100101608 Ga0070694_1001016082 119
26 3300005455 Ga0070663_100059127 Ga0070663_1000591272 119
27 3300005457 Ga0070662_100395686 Ga0070662_1003956862 119
28 3300005458 Ga0070681_10021075 Ga0070681_100210754 119
29 3300005467 Ga0070706_100707609 Ga0070706_1007076093 119
30 3300005471 Ga0070698_100252628 Ga0070698_1002526283 119
31 3300005518 Ga0070699_100096482 Ga0070699_1000964822 119
32 3300005530 Ga0070679_100034533 Ga0070679_1000345332 119
33 3300005536 Ga0070697_100000542 Ga0070697_1000005423 119
34 3300005536 Ga0070697_100209542 Ga0070697_1002095421 119
35 3300005543 Ga0070672_100070292 Ga0070672_1000702923 119
36 3300005544 Ga0070686_100103885 Ga0070686_1001038853 119
37 3300005545 Ga0070695_100036695 Ga0070695_1000366954 119
38 3300005545 Ga0070695_100494532 Ga0070695_1004945322 119
39 3300005546 Ga0070696_100038160 Ga0070696_1000381602 119
40 3300005546 Ga0070696_100713004 Ga0070696_1007130042 119
41 3300005547 Ga0070693_100012949 Ga0070693_1000129492 119
42 3300005548 Ga0070665_100276841 Ga0070665_1002768412 119
43 3300005563 Ga0068855_100096198 Ga0068855_1000961982 119
44 3300005564 Ga0070664_100021201 Ga0070664_1000212017 119
45 3300005578 Ga0068854_100010313 Ga0068854_1000103133 119
46 3300005614 Ga0068856_100078468 Ga0068856_1000784682 119
47 3300005718 Ga0068866_10056606 Ga0068866_100566062 119
48 3300005842 Ga0068858_101162995 Ga0068858_1011629951 119
49 3300006871 Ga0075434_100259198 Ga0075434_1002591982 119
50 3300007076 Ga0075435_100318447 Ga0075435_1003184472 119
51 3300009093 Ga0105240_10163923 Ga0105240_101639232 119
52 3300009094 Ga0111539_10060572 Ga0111539_100605725 119
53 3300009098 Ga0105245_10895590 Ga0105245_108955901 119
54 3300009148 Ga0105243_10047982 Ga0105243_100479822 119
55 3300009174 Ga0105241_10141772 Ga0105241_101417722 119
56 3300009176 Ga0105242_10322426 Ga0105242_103224262 119
57 3300009177 Ga0105248_11121967 Ga0105248_111219671 119
58 3300009551 Ga0105238_10883052 Ga0105238_108830522 119
59 3300009553 Ga0105249_10257651 Ga0105249_102576513 119
60 3300010375 Ga0105239_10005799 Ga0105239_1000579910 119
61 3300011119 Ga0105246_10020900 Ga0105246_100209007 119
62 3300013102 Ga0157371_10095319 Ga0157371_100953192 119
63 3300013296 Ga0157374_10015332 Ga0157374_100153327 119
64 3300013297 Ga0157378_12375159 Ga0157378_123751592 119
65 3300013306 Ga0163162_10050774 Ga0163162_100507742 119
66 3300013307 Ga0157372_10053296 Ga0157372_100532964 119
67 3300013308 Ga0157375_10191789 Ga0157375_101917892 119
68 3300014325 Ga0163163_10331350 Ga0163163_103313501 119
69 3300014497 Ga0182008_10118981 Ga0182008_101189812 119
70 3300014745 Ga0157377_10116578 Ga0157377_101165782 119
71 3300014969 Ga0157376_10008932 Ga0157376_100089326 119
72 3300025315 Ga0207697_10001865 Ga0207697_100018652 119
73 3300025893 Ga0207682_10056831 Ga0207682_100568311 119
74 3300025899 Ga0207642_10045965 Ga0207642_100459652 119
75 3300025901 Ga0207688_10034491 Ga0207688_100344912 119
76 3300025907 Ga0207645_10003342 Ga0207645_100033423 119
77 3300025910 Ga0207684_10774054 Ga0207684_107740541 119
78 3300025912 Ga0207707_10555850 Ga0207707_105558502 119
79 3300025913 Ga0207695_10413148 Ga0207695_104131482 119
80 3300025918 Ga0207662_10048376 Ga0207662_100483762 119
81 3300025919 Ga0207657_10006391 Ga0207657_1000639110 119
82 3300025920 Ga0207649_10086454 Ga0207649_100864542 119
83 3300025921 Ga0207652_10284592 Ga0207652_102845922 119
84 3300025923 Ga0207681_10076001 Ga0207681_100760012 119
85 3300025925 Ga0207650_10038064 Ga0207650_100380642 119
86 3300025926 Ga0207659_10518755 Ga0207659_105187552 119
87 3300025931 Ga0207644_10148250 Ga0207644_101482502 119
88 3300025933 Ga0207706_10000999 Ga0207706_1000099915 119
89 3300025934 Ga0207686_10279619 Ga0207686_102796192 119
90 3300025940 Ga0207691_10026915 Ga0207691_100269152 119
91 3300025945 Ga0207679_10787887 Ga0207679_107878872 119
92 3300025949 Ga0207667_10502672 Ga0207667_105026723 119
93 3300025986 Ga0207658_10290299 Ga0207658_102902992 119
94 3300026067 Ga0207678_10093271 Ga0207678_100932712 119
95 3300026075 Ga0207708_10216782 Ga0207708_102167822 119
96 3300026121 Ga0207683_10001033 Ga0207683_1000103314 119
97 3300028794 Ga0307515_10000008 Ga0307515_10000008144 119
98 3300042157 Ga0439458_0206638 Ga0439458_0206638_127_492 119
99 3300045051 Ga0451576_0751411 Ga0451576_0751411_247_672 119
100 3300048906 Ga0496103_0112306 Ga0496103_0112306_944_1309 119
101 3300048910 Ga0496107_0207714 Ga0496107_0207714_795_1160 119
102 3300048915 Ga0496112_0329301 Ga0496112_0329301_573_938 119
103 3300048916 Ga0496113_0111964 Ga0496113_0111964_1436_1801 119
104 3300050511 nmdc:mga08y16_308323_c1 nmdc:mga08y16_308323_c1_531_896 119
105 3300050512 nmdc:mga0n895_55054_c1 nmdc:mga0n895_55054_c1_2874_3239 119
106 3300050514 nmdc:mga08x19_127090_c1 nmdc:mga08x19_127090_c1_589_954 119
107 3300001432 JGI24034J14986_100666 JGI24034J14986_1006662 120
108 3300001977 JGI24746J21847_1034850 JGI24746J21847_10348502 120
109 3300002074 JGI24748J21848_1000002 JGI24748J21848_1000002263 120
110 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004111 120
111 3300003203 JGI25406J46586_10037876 JGI25406J46586_100378762 120
112 3300003320 rootH2_10256832 rootH2_102568322 120
113 3300003322 rootL2_10257985 rootL2_102579854 120
114 3300005293 Ga0065715_11125805 Ga0065715_111258051 120
115 3300005328 Ga0070676_10001365 Ga0070676_1000136511 120
116 3300005328 Ga0070676_11037161 Ga0070676_110371612 120
117 3300005329 Ga0070683_100316280 Ga0070683_1003162802 120
118 3300005330 Ga0070690_100823741 Ga0070690_1008237412 120
119 3300005331 Ga0070670_100316144 Ga0070670_1003161442 120
120 3300005338 Ga0068868_100183959 Ga0068868_1001839592 120
121 3300005338 Ga0068868_100992340 Ga0068868_1009923402 120
122 3300005338 Ga0068868_101530638 Ga0068868_1015306381 120
123 3300005338 Ga0068868_102260975 Ga0068868_1022609751 120
124 3300005340 Ga0070689_100016478 Ga0070689_1000164787 120
125 3300005340 Ga0070689_101922173 Ga0070689_1019221732 120
126 3300005340 Ga0070689_102200758 Ga0070689_1022007581 120
127 3300005343 Ga0070687_100001554 Ga0070687_1000015547 120
128 3300005343 Ga0070687_100251155 Ga0070687_1002511552 120
129 3300005343 Ga0070687_100567447 Ga0070687_1005674472 120
130 3300005347 Ga0070668_100085699 Ga0070668_1000856994 120
131 3300005353 Ga0070669_100013242 Ga0070669_1000132424 120
132 3300005353 Ga0070669_100020637 Ga0070669_1000206376 120
133 3300005353 Ga0070669_100114782 Ga0070669_1001147824 120
134 3300005354 Ga0070675_100001838 Ga0070675_1000018382 120
135 3300005354 Ga0070675_100004173 Ga0070675_1000041739 120
136 3300005354 Ga0070675_100100022 Ga0070675_1001000224 120
137 3300005355 Ga0070671_100015497 Ga0070671_1000154972 120
138 3300005356 Ga0070674_100214152 Ga0070674_1002141522 120
139 3300005364 Ga0070673_100073674 Ga0070673_1000736742 120
140 3300005364 Ga0070673_100677866 Ga0070673_1006778662 120
141 3300005364 Ga0070673_101002897 Ga0070673_1010028972 120
142 3300005365 Ga0070688_100008040 Ga0070688_1000080403 120
143 3300005365 Ga0070688_100086866 Ga0070688_1000868664 120
144 3300005367 Ga0070667_100017551 Ga0070667_1000175514 120
145 3300005367 Ga0070667_100117872 Ga0070667_1001178722 120
146 3300005406 Ga0070703_10000028 Ga0070703_1000002834 120
147 3300005406 Ga0070703_10142371 Ga0070703_101423712 120
148 3300005435 Ga0070714_100034209 Ga0070714_1000342094 120
149 3300005436 Ga0070713_100009503 Ga0070713_1000095032 120
150 3300005436 Ga0070713_100016390 Ga0070713_1000163902 120
151 3300005437 Ga0070710_10028354 Ga0070710_100283544 120
152 3300005438 Ga0070701_10575934 Ga0070701_105759342 120
153 3300005439 Ga0070711_100059933 Ga0070711_1000599332 120
154 3300005439 Ga0070711_100805808 Ga0070711_1008058081 120
155 3300005441 Ga0070700_100006039 Ga0070700_1000060393 120
156 3300005441 Ga0070700_100150489 Ga0070700_1001504894 120
157 3300005444 Ga0070694_100073264 Ga0070694_1000732641 120
158 3300005444 Ga0070694_100623497 Ga0070694_1006234972 120
159 3300005445 Ga0070708_100084280 Ga0070708_1000842802 120
160 3300005455 Ga0070663_100487212 Ga0070663_1004872121 120
161 3300005456 Ga0070678_100195213 Ga0070678_1001952133 120
162 3300005456 Ga0070678_100256899 Ga0070678_1002568992 120
163 3300005458 Ga0070681_10325744 Ga0070681_103257442 120
164 3300005466 Ga0070685_10020774 Ga0070685_100207741 120
165 3300005467 Ga0070706_100010342 Ga0070706_1000103429 120
166 3300005467 Ga0070706_100386337 Ga0070706_1003863372 120
167 3300005467 Ga0070706_100527300 Ga0070706_1005273002 120
168 3300005468 Ga0070707_100000677 Ga0070707_10000067711 120
169 3300005471 Ga0070698_100247589 Ga0070698_1002475892 120
170 3300005471 Ga0070698_101344631 Ga0070698_1013446311 120
171 3300005518 Ga0070699_100005249 Ga0070699_1000052495 120
172 3300005518 Ga0070699_100084071 Ga0070699_1000840712 120
173 3300005518 Ga0070699_100901264 Ga0070699_1009012642 120
174 3300005530 Ga0070679_100517025 Ga0070679_1005170252 120
175 3300005535 Ga0070684_100320759 Ga0070684_1003207591 120
176 3300005539 Ga0068853_100778756 Ga0068853_1007787561 120
177 3300005543 Ga0070672_100041276 Ga0070672_1000412762 120
178 3300005545 Ga0070695_100128826 Ga0070695_1001288263 120
179 3300005545 Ga0070695_100335822 Ga0070695_1003358223 120
180 3300005545 Ga0070695_101509184 Ga0070695_1015091841 120
181 3300005546 Ga0070696_101046366 Ga0070696_1010463662 120
182 3300005546 Ga0070696_101099534 Ga0070696_1010995341 120
183 3300005547 Ga0070693_101072797 Ga0070693_1010727972 120
184 3300005549 Ga0070704_100194128 Ga0070704_1001941283 120
185 3300005549 Ga0070704_100243365 Ga0070704_1002433651 120
186 3300005549 Ga0070704_100434567 Ga0070704_1004345672 120
187 3300005563 Ga0068855_100585072 Ga0068855_1005850722 120
188 3300005564 Ga0070664_100013944 Ga0070664_1000139441 120
189 3300005564 Ga0070664_100034015 Ga0070664_1000340153 120
190 3300005577 Ga0068857_100057187 Ga0068857_1000571874 120
191 3300005578 Ga0068854_100124664 Ga0068854_1001246642 120
192 3300005578 Ga0068854_100654585 Ga0068854_1006545851 120
193 3300005615 Ga0070702_100413557 Ga0070702_1004135573 120
194 3300005617 Ga0068859_100003211 Ga0068859_10000321112 120
195 3300005617 Ga0068859_100013203 Ga0068859_1000132032 120
196 3300005617 Ga0068859_100040385 Ga0068859_1000403852 120
197 3300005617 Ga0068859_100391782 Ga0068859_1003917823 120
198 3300005617 Ga0068859_100701645 Ga0068859_1007016451 120
199 3300005719 Ga0068861_101487504 Ga0068861_1014875042 120
200 3300005841 Ga0068863_100065955 Ga0068863_1000659552 120
201 3300005841 Ga0068863_100408514 Ga0068863_1004085142 120
202 3300005841 Ga0068863_101029225 Ga0068863_1010292252 120
203 3300005843 Ga0068860_100065339 Ga0068860_1000653392 120
204 3300005843 Ga0068860_100613528 Ga0068860_1006135282 120
205 3300005843 Ga0068860_101897346 Ga0068860_1018973462 120
206 3300005844 Ga0068862_100008674 Ga0068862_1000086747 120
207 3300005844 Ga0068862_100220408 Ga0068862_1002204083 120
208 3300005937 Ga0081455_10000418 Ga0081455_100004189 120
209 3300005937 Ga0081455_10331710 Ga0081455_103317102 120
210 3300005985 Ga0081539_10000346 Ga0081539_100003468 120
211 3300005985 Ga0081539_10003337 Ga0081539_1000333710 120
212 3300006028 Ga0070717_10011421 Ga0070717_100114213 120
213 3300006028 Ga0070717_10192232 Ga0070717_101922322 120
214 3300006173 Ga0070716_100018531 Ga0070716_1000185312 120
215 3300006173 Ga0070716_100235579 Ga0070716_1002355791 120
216 3300006173 Ga0070716_101463951 Ga0070716_1014639511 120
217 3300006175 Ga0070712_100006993 Ga0070712_1000069933 120
218 3300006175 Ga0070712_100083329 Ga0070712_1000833294 120
219 3300006175 Ga0070712_100085384 Ga0070712_1000853844 120
220 3300006353 Ga0075370_10004194 Ga0075370_100041944 120
221 3300006358 Ga0068871_100884720 Ga0068871_1008847202 120
222 3300006846 Ga0075430_100025943 Ga0075430_1000259438 120
223 3300006847 Ga0075431_100004811 Ga0075431_1000048116 120
224 3300006847 Ga0075431_100105862 Ga0075431_1001058625 120
225 3300006871 Ga0075434_100022420 Ga0075434_1000224208 120
226 3300006880 Ga0075429_101103038 Ga0075429_1011030381 120
227 3300006881 Ga0068865_100284671 Ga0068865_1002846712 120
228 3300006881 Ga0068865_100455234 Ga0068865_1004552342 120
229 3300006914 Ga0075436_100034783 Ga0075436_1000347833 120
230 3300006914 Ga0075436_100377736 Ga0075436_1003777362 120
231 3300006914 Ga0075436_101107564 Ga0075436_1011075642 120
232 3300006931 Ga0097620_100003211 Ga0097620_1000032115 120
233 3300006931 Ga0097620_100013203 Ga0097620_1000132032 120
234 3300006931 Ga0097620_100040388 Ga0097620_1000403882 120
235 3300006931 Ga0097620_100391765 Ga0097620_1003917653 120
236 3300006931 Ga0097620_100701673 Ga0097620_1007016733 120
237 3300007076 Ga0075435_100043004 Ga0075435_1000430042 120
238 3300007076 Ga0075435_100310939 Ga0075435_1003109392 120
239 3300007076 Ga0075435_100394520 Ga0075435_1003945202 120
240 3300009098 Ga0105245_10502328 Ga0105245_105023281 120
241 3300009101 Ga0105247_10064908 Ga0105247_100649082 120
242 3300009101 Ga0105247_10435517 Ga0105247_104355172 120
243 3300009147 Ga0114129_10000925 Ga0114129_100009253 120
244 3300009147 Ga0114129_10560851 Ga0114129_105608511 120
245 3300009147 Ga0114129_10828683 Ga0114129_108286832 120
246 3300009147 Ga0114129_10837032 Ga0114129_108370322 120
247 3300009147 Ga0114129_11471129 Ga0114129_114711292 120
248 3300009147 Ga0114129_13302790 Ga0114129_133027901 120
249 3300009148 Ga0105243_10000996 Ga0105243_1000099624 120
250 3300009176 Ga0105242_10435053 Ga0105242_104350532 120
251 3300009176 Ga0105242_11449483 Ga0105242_114494832 120
252 3300009177 Ga0105248_10003342 Ga0105248_1000334210 120
253 3300009551 Ga0105238_10000453 Ga0105238_100004538 120
254 3300009551 Ga0105238_10015271 Ga0105238_100152714 120
255 3300009553 Ga0105249_10100889 Ga0105249_101008894 120
256 3300009553 Ga0105249_10214317 Ga0105249_102143172 120
257 3300010375 Ga0105239_12130245 Ga0105239_121302451 120
258 3300011119 Ga0105246_10104300 Ga0105246_101043002 120
259 3300011119 Ga0105246_11937632 Ga0105246_119376322 120
260 3300013105 Ga0157369_10914132 Ga0157369_109141322 120
261 3300013296 Ga0157374_10809308 Ga0157374_108093082 120
262 3300013297 Ga0157378_10000015 Ga0157378_10000015100 120
263 3300013297 Ga0157378_10066555 Ga0157378_100665551 120
264 3300013297 Ga0157378_10192643 Ga0157378_101926434 120
265 3300013297 Ga0157378_11283965 Ga0157378_112839652 120
266 3300013297 Ga0157378_11303248 Ga0157378_113032482 120
267 3300013297 Ga0157378_11757263 Ga0157378_117572632 120
268 3300013306 Ga0163162_11953080 Ga0163162_119530802 120
269 3300013307 Ga0157372_10032933 Ga0157372_100329337 120
270 3300013307 Ga0157372_11858954 Ga0157372_118589541 120
271 3300013308 Ga0157375_10377520 Ga0157375_103775202 120
272 3300013308 Ga0157375_11014638 Ga0157375_110146382 120
273 3300013308 Ga0157375_12487289 Ga0157375_124872892 120
274 3300013308 Ga0157375_12580182 Ga0157375_125801821 120
275 3300014325 Ga0163163_10096287 Ga0163163_100962872 120
276 3300014325 Ga0163163_10115414 Ga0163163_101154142 120
277 3300014325 Ga0163163_11423705 Ga0163163_114237052 120
278 3300014325 Ga0163163_12610992 Ga0163163_126109921 120
279 3300014325 Ga0163163_13070614 Ga0163163_130706142 120
280 3300014326 Ga0157380_11754419 Ga0157380_117544192 120
281 3300014745 Ga0157377_10629509 Ga0157377_106295092 120
282 3300014745 Ga0157377_10928767 Ga0157377_109287671 120
283 3300014969 Ga0157376_10116132 Ga0157376_101161322 120
284 3300014969 Ga0157376_11229459 Ga0157376_112294592 120
285 3300025271 Ga0207666_1030537 Ga0207666_10305372 120
286 3300025315 Ga0207697_10001859 Ga0207697_100018593 120
287 3300025885 Ga0207653_10000047 Ga0207653_1000004722 120
288 3300025898 Ga0207692_10075734 Ga0207692_100757344 120
289 3300025898 Ga0207692_10633053 Ga0207692_106330532 120
290 3300025900 Ga0207710_10000004 Ga0207710_10000004104 120
291 3300025900 Ga0207710_10127913 Ga0207710_101279132 120
292 3300025901 Ga0207688_10569816 Ga0207688_105698162 120
293 3300025903 Ga0207680_10167098 Ga0207680_101670982 120
294 3300025907 Ga0207645_10004181 Ga0207645_1000418112 120
295 3300025907 Ga0207645_10061525 Ga0207645_100615254 120
296 3300025908 Ga0207643_10001177 Ga0207643_100011775 120
297 3300025910 Ga0207684_10011572 Ga0207684_100115722 120
298 3300025910 Ga0207684_10329809 Ga0207684_103298092 120
299 3300025910 Ga0207684_10555190 Ga0207684_105551902 120
300 3300025910 Ga0207684_11411507 Ga0207684_114115071 120
301 3300025912 Ga0207707_10863292 Ga0207707_108632922 120
302 3300025913 Ga0207695_10401455 Ga0207695_104014552 120
303 3300025915 Ga0207693_10010700 Ga0207693_100107007 120
304 3300025915 Ga0207693_10222704 Ga0207693_102227042 120
305 3300025916 Ga0207663_10041856 Ga0207663_100418565 120
306 3300025916 Ga0207663_10436040 Ga0207663_104360403 120
307 3300025918 Ga0207662_10019692 Ga0207662_100196927 120
308 3300025918 Ga0207662_10817734 Ga0207662_108177342 120
309 3300025922 Ga0207646_10000550 Ga0207646_1000055014 120
310 3300025923 Ga0207681_10025343 Ga0207681_100253432 120
311 3300025923 Ga0207681_10030921 Ga0207681_100309213 120
312 3300025923 Ga0207681_10211174 Ga0207681_102111742 120
313 3300025924 Ga0207694_10003055 Ga0207694_1000305513 120
314 3300025924 Ga0207694_10170679 Ga0207694_101706793 120
315 3300025925 Ga0207650_10237763 Ga0207650_102377631 120
316 3300025926 Ga0207659_10059210 Ga0207659_100592104 120
317 3300025926 Ga0207659_10092391 Ga0207659_100923914 120
318 3300025926 Ga0207659_10283266 Ga0207659_102832662 120
319 3300025927 Ga0207687_10176672 Ga0207687_101766723 120
320 3300025929 Ga0207664_10197518 Ga0207664_101975182 120
321 3300025931 Ga0207644_10002425 Ga0207644_100024253 120
322 3300025931 Ga0207644_10473992 Ga0207644_104739922 120
323 3300025932 Ga0207690_10201492 Ga0207690_102014921 120
324 3300025933 Ga0207706_10028863 Ga0207706_100288632 120
325 3300025933 Ga0207706_10068096 Ga0207706_100680962 120
326 3300025933 Ga0207706_10501378 Ga0207706_105013781 120
327 3300025934 Ga0207686_10630113 Ga0207686_106301133 120
328 3300025935 Ga0207709_10001187 Ga0207709_100011872 120
329 3300025935 Ga0207709_10596040 Ga0207709_105960402 120
330 3300025937 Ga0207669_10299931 Ga0207669_102999312 120
331 3300025938 Ga0207704_10624163 Ga0207704_106241632 120
332 3300025939 Ga0207665_10002211 Ga0207665_100022115 120
333 3300025940 Ga0207691_10008673 Ga0207691_100086731 120
334 3300025941 Ga0207711_10006529 Ga0207711_1000652911 120
335 3300025941 Ga0207711_10467061 Ga0207711_104670612 120
336 3300025942 Ga0207689_10001417 Ga0207689_100014173 120
337 3300025945 Ga0207679_10024837 Ga0207679_100248373 120
338 3300025961 Ga0207712_10195838 Ga0207712_101958383 120
339 3300025972 Ga0207668_10014858 Ga0207668_100148583 120
340 3300025986 Ga0207658_10047257 Ga0207658_100472574 120
341 3300025986 Ga0207658_10347951 Ga0207658_103479513 120
342 3300025986 Ga0207658_10436553 Ga0207658_104365531 120
343 3300026023 Ga0207677_10250654 Ga0207677_102506542 120
344 3300026023 Ga0207677_10465063 Ga0207677_104650632 120
345 3300026035 Ga0207703_10165442 Ga0207703_101654422 120
346 3300026041 Ga0207639_10674148 Ga0207639_106741482 120
347 3300026075 Ga0207708_10025555 Ga0207708_100255558 120
348 3300026075 Ga0207708_10064775 Ga0207708_100647754 120
349 3300026088 Ga0207641_10329707 Ga0207641_103297072 120
350 3300026088 Ga0207641_10503382 Ga0207641_105033822 120
351 3300026089 Ga0207648_10393763 Ga0207648_103937633 120
352 3300026116 Ga0207674_10044024 Ga0207674_100440243 120
353 3300026118 Ga0207675_100014281 Ga0207675_1000142814 120
354 3300026121 Ga0207683_10300578 Ga0207683_103005782 120
355 3300026142 Ga0207698_10527881 Ga0207698_105278812 120
356 3300028379 Ga0268266_10359571 Ga0268266_103595713 120
357 3300028380 Ga0268265_10060463 Ga0268265_100604632 120
358 3300028380 Ga0268265_10284054 Ga0268265_102840543 120
359 3300028381 Ga0268264_11047838 Ga0268264_110478382 120
360 3300028381 Ga0268264_11163453 Ga0268264_111634532 120
361 3300028800 Ga0265338_10525447 Ga0265338_105254472 120
362 3300031456 Ga0307513_10200799 Ga0307513_102007994 120
363 3300031548 Ga0307408_100924697 Ga0307408_1009246972 120
364 3300031691 Ga0316579_10318330 Ga0316579_103183301 120
365 3300031731 Ga0307405_10023447 Ga0307405_100234476 120
366 3300031731 Ga0307405_10311624 Ga0307405_103116242 120
367 3300031852 Ga0307410_10009883 Ga0307410_100098831 120
368 3300031852 Ga0307410_10811011 Ga0307410_108110111 120
369 3300031852 Ga0307410_11763947 Ga0307410_117639472 120
370 3300031901 Ga0307406_10022338 Ga0307406_100223382 120
371 3300031911 Ga0307412_10058787 Ga0307412_100587874 120
372 3300032002 Ga0307416_100016556 Ga0307416_1000165562 120
373 3300032004 Ga0307414_10006929 Ga0307414_100069292 120
374 3300032004 Ga0307414_10690872 Ga0307414_106908722 120
375 3300032005 Ga0307411_10359936 Ga0307411_103599363 120
376 3300032005 Ga0307411_10601877 Ga0307411_106018772 120
377 3300032005 Ga0307411_12358362 Ga0307411_123583621 120
378 3300032126 Ga0307415_100005575 Ga0307415_1000055757 120
379 3300035116 Ga0373945_0304019 Ga0373945_0304019_70_435 120
380 3300035117 Ga0373953_0053370 Ga0373953_0053370_457_831 120
381 3300035118 Ga0373954_0137601 Ga0373954_0137601_31_405 120
382 3300035119 Ga0373956_0430237 Ga0373956_0430237_157_522 120
383 3300035170 Ga0373943_0072420 Ga0373943_0072420_429_791 120
384 3300035410 Ga0373924_0009892 Ga0373924_0009892_2579_2944 120
385 3300035692 Ga0373935_0522089 Ga0373935_0522089_35_397 120
386 3300035724 Ga0373933_0011694 Ga0373933_0011694_1303_1677 120
387 3300035725 Ga0373947_0252479 Ga0373947_0252479_43_408 120
388 3300036401 Ga0373937_0002398 Ga0373937_0002398_4618_4992 120
389 3300036401 Ga0373937_0222746 Ga0373937_0222746_921_1286 120
390 3300036401 Ga0373937_1018668 Ga0373937_1018668_339_704 120
391 3300038726 Ga0400490_38445 Ga0400490_38445_2061_2432 120
392 3300038727 Ga0400491_27425 Ga0400491_27425_788_1159 120
393 3300039438 Ga0436360_0507637 Ga0436360_0507637_147_527 120
394 3300039438 Ga0436360_1307698 Ga0436360_1307698_335_697 120
395 3300039453 Ga0436362_1097775 Ga0436362_1097775_180_542 120
396 3300041512 Ga0451853_1505179 Ga0451853_1505179_147_512 120
397 3300042157 Ga0439458_0188334 Ga0439458_0188334_174_539 120
398 3300042436 Ga0439435_0054705 Ga0439435_0054705_287_649 120
399 3300042438 Ga0439459_0160735 Ga0439459_0160735_164_529 120
400 3300046454 Ga0495592_0137169 Ga0495592_0137169_418_792 120
401 3300046459 Ga0495629_0280222 Ga0495629_0280222_20_385 120
402 3300046460 Ga0495638_0638222 Ga0495638_0638222_78_443 120
403 3300046463 Ga0495653_0689580 Ga0495653_0689580_193_558 120
404 3300046472 Ga0495580_0147639 Ga0495580_0147639_1212_1577 120
405 3300046477 Ga0495664_0226376 Ga0495664_0226376_472_837 120
406 3300046511 Ga0495608_0279860 Ga0495608_0279860_33_398 120
407 3300046511 Ga0495608_0395505 Ga0495608_0395505_105_479 120
408 3300046516 Ga0495628_0009589 Ga0495628_0009589_2954_3319 120
409 3300046517 Ga0495630_0342556 Ga0495630_0342556_364_738 120
410 3300046517 Ga0495630_0859365 Ga0495630_0859365_87_449 120
411 3300046517 Ga0495630_1128335 Ga0495630_1128335_96_461 120
412 3300046519 Ga0495632_0147356 Ga0495632_0147356_107_472 120
413 3300046520 Ga0495637_0009569 Ga0495637_0009569_1624_1992 120
414 3300046525 Ga0495663_0051848 Ga0495663_0051848_465_842 120
415 3300046525 Ga0495663_0150724 Ga0495663_0150724_211_573 120
416 3300046529 Ga0495652_0140516 Ga0495652_0140516_1126_1491 120
417 3300046529 Ga0495652_0198552 Ga0495652_0198552_358_732 120
418 3300046536 Ga0495587_0004194 Ga0495587_0004194_9120_9494 120
419 3300046536 Ga0495587_0223241 Ga0495587_0223241_362_727 120
420 3300046543 Ga0495645_0000820 Ga0495645_0000820_18461_18835 120
421 3300046543 Ga0495645_0002759 Ga0495645_0002759_9745_10110 120
422 3300046559 Ga0495667_0002410 Ga0495667_0002410_1945_2319 120
423 3300046559 Ga0495667_0276740 Ga0495667_0276740_198_692 120
424 3300046660 Ga0495625_0076225 Ga0495625_0076225_1692_2057 120
425 3300046663 Ga0495635_0945050 Ga0495635_0945050_165_530 120
426 3300046675 Ga0495657_0108884 Ga0495657_0108884_654_1148 120
427 3300046678 Ga0495599_0012245 Ga0495599_0012245_2179_2544 120
428 3300046678 Ga0495599_0021219 Ga0495599_0021219_1351_1725 120
429 3300046679 Ga0495623_0001030 Ga0495623_0001030_10292_10666 120
430 3300046679 Ga0495623_0113428 Ga0495623_0113428_876_1241 120
431 3300046680 Ga0495646_0601879 Ga0495646_0601879_11_376 120
432 3300046684 Ga0495669_0307797 Ga0495669_0307797_382_744 120
433 3300046809 Ga0495600_0145983 Ga0495600_0145983_735_1109 120
434 3300047317 Ga0495604_0375459 Ga0495604_0375459_354_719 120
435 3300047318 Ga0495636_0152378 Ga0495636_0152378_540_902 120
436 3300047319 Ga0495674_0162166 Ga0495674_0162166_913_1278 120
437 3300047322 Ga0495680_0108504 Ga0495680_0108504_1619_1984 120
438 3300047444 Ga0495675_0001362 Ga0495675_0001362_11188_11562 120
439 3300047444 Ga0495675_0033676 Ga0495675_0033676_1163_1528 120
440 3300047445 Ga0495677_0036485 Ga0495677_0036485_87_461 120
441 3300047469 Ga0495673_0291426 Ga0495673_0291426_96_461 120
442 3300047471 Ga0495684_0011322 Ga0495684_0011322_5067_5441 120
443 3300047471 Ga0495684_0776527 Ga0495684_0776527_40_405 120
444 3300048088 Ga0495602_0066884 Ga0495602_0066884_1830_2195 120
445 3300048088 Ga0495602_0961981 Ga0495602_0961981_58_432 120
446 3300048090 Ga0495615_0073356 Ga0495615_0073356_62_436 120
447 3300048091 Ga0495626_0011025 Ga0495626_0011025_1172_1540 120
448 3300048903 Ga0496100_0476942 Ga0496100_0476942_387_752 120
449 3300048903 Ga0496100_0652442 Ga0496100_0652442_122_496 120
450 3300048904 Ga0496101_0070442 Ga0496101_0070442_679_1044 120
451 3300048904 Ga0496101_0476625 Ga0496101_0476625_60_434 120
452 3300048905 Ga0496102_0027171 Ga0496102_0027171_2832_3206 120
453 3300048905 Ga0496102_0030887 Ga0496102_0030887_3282_3647 120
454 3300048905 Ga0496102_0747299 Ga0496102_0747299_254_616 120
455 3300048906 Ga0496103_0074171 Ga0496103_0074171_1645_2019 120
456 3300048908 Ga0496105_0336006 Ga0496105_0336006_274_639 120
457 3300048908 Ga0496105_0515090 Ga0496105_0515090_204_569 120
458 3300048909 Ga0496106_0124012 Ga0496106_0124012_1559_1933 120
459 3300048909 Ga0496106_0391023 Ga0496106_0391023_539_904 120
460 3300048912 Ga0496109_0006588 Ga0496109_0006588_1693_2067 120
461 3300048912 Ga0496109_0433862 Ga0496109_0433862_16_381 120
462 3300048913 Ga0496110_0011619 Ga0496110_0011619_4820_5194 120
463 3300048913 Ga0496110_0827444 Ga0496110_0827444_313_678 120
464 3300048914 Ga0496111_0076220 Ga0496111_0076220_1878_2252 120
465 3300048915 Ga0496112_0128667 Ga0496112_0128667_1845_2219 120
466 3300048915 Ga0496112_0488824 Ga0496112_0488824_594_959 120
467 3300048916 Ga0496113_0105891 Ga0496113_0105891_338_712 120
468 3300048917 Ga0496114_0461409 Ga0496114_0461409_720_1085 120
469 3300048917 Ga0496114_0579917 Ga0496114_0579917_356_721 120
470 3300048917 Ga0496114_1060480 Ga0496114_1060480_164_538 120
471 3300048917 Ga0496114_1536164 Ga0496114_1536164_65_430 120
472 3300048918 Ga0496115_0012130 Ga0496115_0012130_3674_4039 120
473 3300048922 Ga0496119_0069680 Ga0496119_0069680_283_648 120
474 3300048924 Ga0496121_0016937 Ga0496121_0016937_5117_5482 120
475 3300048924 Ga0496121_0096602 Ga0496121_0096602_1639_2013 120
476 3300048928 Ga0496125_0024057 Ga0496125_0024057_1863_2228 120
477 3300048929 Ga0496126_0065674 Ga0496126_0065674_737_1102 120
478 3300048929 Ga0496126_0977527 Ga0496126_0977527_52_417 120
479 3300049515 Ga0501292_136908 Ga0501292_136908_66_431 120
480 3300049592 Ga0501076_0734613 Ga0501076_0734613_164_529 120
481 3300049651 Ga0501201_016083 Ga0501201_016083_172_534 120
482 3300049652 Ga0501202_000507 Ga0501202_000507_786_1148 120
483 3300049660 Ga0501216_013641 Ga0501216_013641_536_898 120
484 3300049661 Ga0501217_002038 Ga0501217_002038_88_450 120
485 3300049663 Ga0501223_014092 Ga0501223_014092_318_680 120
486 3300049667 Ga0501230_011931 Ga0501230_011931_813_1175 120
487 3300049668 Ga0501233_005464 Ga0501233_005464_1853_2215 120
488 3300049672 Ga0501239_052103 Ga0501239_052103_192_554 120
489 3300049676 Ga0501246_026658 Ga0501246_026658_91_453 120
490 3300049688 Ga0501259_123981 Ga0501259_123981_35_397 120
491 3300049704 Ga0501221_077878 Ga0501221_077878_140_502 120
492 3300049705 Ga0501225_0004615 Ga0501225_0004615_174_536 120
493 3300049706 Ga0501229_008713 Ga0501229_008713_355_717 120
494 3300049708 Ga0501245_069052 Ga0501245_069052_253_615 120
495 3300049741 Ga0501079_0588647 Ga0501079_0588647_104_469 120
496 3300049742 Ga0501080_1796014 Ga0501080_1796014_132_494 120
497 3300049770 Ga0501273_005459 Ga0501273_005459_154_516 120
498 3300049776 Ga0501280_082445 Ga0501280_082445_38_400 120
499 3300049850 Ga0501204_011255 Ga0501204_011255_14_376 120
500 3300050496 nmdc:mga07m45_5826_c1 nmdc:mga07m45_5826_c1_1262_1636 120
501 3300050507 nmdc:mga05p37_1194447_c1 nmdc:mga05p37_1194447_c1_38_400 120
502 3300050507 nmdc:mga05p37_1360481_c1 nmdc:mga05p37_1360481_c1_239_604 120
503 3300050507 nmdc:mga05p37_1651984_c1 nmdc:mga05p37_1651984_c1_227_595 120
504 3300050507 nmdc:mga05p37_2141600_c1 nmdc:mga05p37_2141600_c1_92_463 120
505 3300050507 nmdc:mga05p37_63_c1 nmdc:mga05p37_63_c1_68462_68827 120
506 3300050507 nmdc:mga05p37_983004_c1 nmdc:mga05p37_983004_c1_23_385 120
507 3300050509 nmdc:mga0qj67_112305_c1 nmdc:mga0qj67_112305_c1_973_1347 120
508 3300050510 nmdc:mga06r32_62953_c1 nmdc:mga06r32_62953_c1_995_1369 120
509 3300050510 nmdc:mga06r32_687853_c1 nmdc:mga06r32_687853_c1_487_858 120
510 3300050512 nmdc:mga0n895_19806_c1 nmdc:mga0n895_19806_c1_834_1196 120
511 3300050512 nmdc:mga0n895_432885_c1 nmdc:mga0n895_432885_c1_909_1283 120
512 3300050512 nmdc:mga0n895_90213_c1 nmdc:mga0n895_90213_c1_1324_1686 120
513 3300050513 nmdc:mga0rr50_1135260_c1 nmdc:mga0rr50_1135260_c1_235_603 120
514 3300050513 nmdc:mga0rr50_265172_c1 nmdc:mga0rr50_265172_c1_697_1071 120
515 3300050513 nmdc:mga0rr50_74521_c1 nmdc:mga0rr50_74521_c1_2205_2567 120
516 3300050514 nmdc:mga08x19_669498_c1 nmdc:mga08x19_669498_c1_343_705 120
517 3300050515 nmdc:mga0a205_1388114_c1 nmdc:mga0a205_1388114_c1_34_399 120
518 3300053077 Ga0495601_0177842 Ga0495601_0177842_897_1262 120
519 3300053078 Ga0495612_0024164 Ga0495612_0024164_723_1088 120
520 3300053084 Ga0495595_0231291 Ga0495595_0231291_177_551 120
521 3300053085 Ga0495619_0106607 Ga0495619_0106607_869_1234 120
522 3300053085 Ga0495619_0110832 Ga0495619_0110832_1213_1587 120
523 3300053085 Ga0495619_0748908 Ga0495619_0748908_96_461 120
524 3300053094 Ga0500566_0460549 Ga0500566_0460549_28_393 120
525 3300053103 Ga0500555_160123 Ga0500555_160123_113_478 120
526 3300053108 Ga0500562_003085 Ga0500562_003085_2608_2973 120
527 3300053133 Ga0500655_012776 Ga0500655_012776_685_1050 120
528 3300053158 Ga0500627_0283775 Ga0500627_0283775_148_513 120
529 3300053161 Ga0500634_0276622 Ga0500634_0276622_145_510 120
530 3300061734 Ga0530510_0309470 Ga0530510_0309470_347_712 120
531 3300061734 Ga0530510_0309928 Ga0530510_0309928_239_604 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

47

137

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oyy-assembly2.cif.gz_B structure of pseudomonas aeruginosa elongation factor p 0.8925 81 114
7n4d-assembly2.cif.gz_B translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863 0.8723 81 114
6bt2-assembly2.cif.gz_B structure of the human nocturnin catalytic domain with bound sulfate anion 0.8715 79 115
3oyy-assembly1.cif.gz_A structure of pseudomonas aeruginosa elongation factor p 0.8512 81 114
1yby-assembly1.cif.gz_B conserved hypothetical protein cth-95 from clostridium thermocellum 0.8505 81 114
ID Description Score Start End Superfamily
af_P06864_732_1002_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9063 81 103 2.70.98.10
af_Q557H6_34_95_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9052 81 114 2.30.30.30
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.903 81 114 2.30.30.30
3oyyB01 Mainly Beta;Roll;SH3 type barrels.; 0.8925 81 114 2.30.30.30
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8892 81 115 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1P8YPY5-F1-model_v4 Lysozyme family protein 0.9856 18 116
AF-A0A7V4G7W4-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9653 23 119
AF-A0A0E3Z1I2-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9642 21 115
AF-A0A3A8KT25-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9553 23 120
AF-A0A0C2D3V1-F1-model_v4 Uncharacterized protein 0.9545 69 118

Feature Viewer

pLDDT pTM Quality
76.52 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map